Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4325625612870.0
CAGL0I00946g25923610271e-142
Sklu_1979.227323510221e-141
Kwal_55.215702412119861e-136
ACR087C2572509851e-136
YOR039W (CKB2)2582269771e-135
KLLA0E21967g2602399591e-132
Kwal_47.174492502254503e-55
KLLA0A04818g2772174516e-55
CAGL0A00275g2662234481e-54
AGR163W2752604403e-53
Scas_638.72702394393e-53
Sklu_1768.43292374433e-53
YGL019W (CKB1)2782594263e-51
Kwal_34.15798287129890.002
KLLA0E22814g136376653.4
CAGL0H02783g178548626.1
KLLA0F26455g86334617.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.43
         (256 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.43                                                           500   0.0  
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   400   e-142
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        398   e-141
Kwal_55.21570                                                         384   e-136
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   384   e-136
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   380   e-135
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   374   e-132
Kwal_47.17449                                                         177   3e-55
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   178   6e-55
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   177   1e-54
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   174   3e-53
Scas_638.7                                                            173   3e-53
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        175   3e-53
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   168   3e-51
Kwal_34.15798                                                          39   0.002
KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces...    30   3.4  
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...    28   6.1  
KLLA0F26455g 2450871..2453462 similar to sp|P36016 Saccharomyces...    28   7.9  

>Scas_699.43
          Length = 256

 Score =  500 bits (1287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/256 (93%), Positives = 240/256 (93%)

Query: 1   MAAAKTMVQEEGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDR 60
           MAAAKTMVQEEGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDR
Sbjct: 1   MAAAKTMVQEEGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDR 60

Query: 61  FNLINLQKTVSKFSQVVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVK 120
           FNLINLQKTVSKFSQVVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVK
Sbjct: 61  FNLINLQKTVSKFSQVVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVK 120

Query: 121 GLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHS 180
           GLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHS
Sbjct: 121 GLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHS 180

Query: 181 CIDGAFFGTSFPGMFLQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRXXXXXX 240
           CIDGAFFGTSFPGMFLQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQR      
Sbjct: 181 CIDGAFFGTSFPGMFLQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRLKLEKK 240

Query: 241 XXXXXXXXXXNGGYSA 256
                     NGGYSA
Sbjct: 241 LKTLDVDLTKNGGYSA 256

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  400 bits (1027), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 201/236 (85%)

Query: 19  EDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQ 78
           +D+ M + TDSSEY   WIDLFLG+KGHEYFCD+DP+YITDRFNLINLQKTVSKFSQVVQ
Sbjct: 22  DDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQ 81

Query: 79  YIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCP 138
           YIVDELD+SI+E MS ARLEQLENDARKFYGLIHARYIITVKGLQKML K+KDADFGRC 
Sbjct: 82  YIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCS 141

Query: 139 RVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQA 198
           RVYCN+QPLLPVGLHD PG+D VKLYC SCEDLY PKS RHS IDGA+FGTSFPGMFLQA
Sbjct: 142 RVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQA 201

Query: 199 FPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRXXXXXXXXXXXXXXXXNGGY 254
           FP+MVPKHPT +YVPKIFGFELHKQAQL RWQE QR                +GG+
Sbjct: 202 FPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVDLSKSGGF 257

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  398 bits (1022), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 202/235 (85%)

Query: 20  DDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQY 79
           D++  + TDSSEYV+ WIDLFLG+KGHEYFCD+D DYITDRFNLINLQKTVS+F+QV+QY
Sbjct: 37  DEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQY 96

Query: 80  IVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPR 139
           IVDELD++ LE MS +RLEQLE+DARK YGLIHARYIITVKGLQKML K++DADFGRCPR
Sbjct: 97  IVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRDADFGRCPR 156

Query: 140 VYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAF 199
           VYCN+Q LLPVGLHD PG+DCVKLYC SCEDLYIPKS RHS IDGA+FGTSFPGMFLQAF
Sbjct: 157 VYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAF 216

Query: 200 PEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRXXXXXXXXXXXXXXXXNGGY 254
           PEMVPKHP K+YVP+IFGFELHKQAQLARWQE QR                NGGY
Sbjct: 217 PEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDKEGVELSKNGGY 271

>Kwal_55.21570
          Length = 241

 Score =  384 bits (986), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 194/211 (91%)

Query: 24  GEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDE 83
            E +DSSEY + WIDLFLG+KGHEYFCDID +YITDRFNLINLQK+V+KF+QV+QY+VDE
Sbjct: 14  AEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDE 73

Query: 84  LDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCN 143
           LD+ ILE MS+ RLEQLE+DARK YGLIHARY+IT+KGLQKML K+K+ADFGRCPRVYCN
Sbjct: 74  LDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCN 133

Query: 144 YQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEMV 203
           +QPLLPVGLHD PG DCVKLYCA CEDLYIPKS RHS IDGA+FGTSFPGMFLQAFPEMV
Sbjct: 134 FQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMV 193

Query: 204 PKHPTKKYVPKIFGFELHKQAQLARWQEFQR 234
           PKHP K+YVPKIFGFELHKQAQ+ARWQE QR
Sbjct: 194 PKHPVKRYVPKIFGFELHKQAQVARWQELQR 224

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  384 bits (985), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/250 (71%), Positives = 202/250 (80%), Gaps = 3/250 (1%)

Query: 8   VQEEGLTHTQD---EDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLI 64
           ++E G   T D    D      T SS+YV+ WIDLFLGKKGHEYFCD+D +YITDRFNLI
Sbjct: 6   LEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLI 65

Query: 65  NLQKTVSKFSQVVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQK 124
           NLQKTVSKF+QV+QY+VDELD++ LE MS  +L QLE DARK YGLIHARYIIT+KGLQK
Sbjct: 66  NLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQK 125

Query: 125 MLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDG 184
           ML K++DADF RCPRV+CN+QPLLPVGLHD PG+DCVKLYC SCEDLYIPKS RHS IDG
Sbjct: 126 MLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDG 185

Query: 185 AFFGTSFPGMFLQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRXXXXXXXXXX 244
           A+FGTSFPGMFLQAFPE+VPKHPTK+YVPK+FGF+LHKQAQLARWQE QR          
Sbjct: 186 AYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKLERELIKK 245

Query: 245 XXXXXXNGGY 254
                 NGGY
Sbjct: 246 GVDLTKNGGY 255

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  380 bits (977), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 194/226 (85%)

Query: 31  EYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDELDESILE 90
           EYVD WIDLFLG+KGHEYFCD+DP+YITDRFNL+NLQKTVSKFS VVQYIVD+LD+SILE
Sbjct: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92

Query: 91  TMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCNYQPLLPV 150
            M++ARLEQLE+D+RK YGLIHARYIIT+KGLQKM  K+K+ADFGRCPRVYCN Q LLPV
Sbjct: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152

Query: 151 GLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEMVPKHPTKK 210
           GLHD PG+DCVKLYC SCEDLYIPKS RHS IDGA+FGTSFPGMFLQAFP+MVPKHPTK+
Sbjct: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212

Query: 211 YVPKIFGFELHKQAQLARWQEFQRXXXXXXXXXXXXXXXXNGGYSA 256
           YVPKIFGFELHKQAQL RWQE QR                +GG+  
Sbjct: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKSGGFKT 258

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  374 bits (959), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 194/239 (81%), Gaps = 4/239 (1%)

Query: 16  TQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQ 75
             D+DD     +DS EYV+ WIDLFLGKKGHEYFCDID +YITDRFNLINLQKTVSKF+ 
Sbjct: 24  VNDQDDG----SDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTT 79

Query: 76  VVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFG 135
           VVQY+VD+L+E I+E+MS ARLEQLE D RK YGLIHARYIIT KGLQKML K+K ADFG
Sbjct: 80  VVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFG 139

Query: 136 RCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMF 195
           RCPR +CN+QPLLPVGLHD PG+DCVKLYC SCEDLY PKS RHS IDGA+FGTSFPGMF
Sbjct: 140 RCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMF 199

Query: 196 LQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRXXXXXXXXXXXXXXXXNGGY 254
           LQ FPEM PKHPTK+YVPK+FGF+LHKQAQL RWQE QR                +GGY
Sbjct: 200 LQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLKLEKLLITKGINLNESGGY 258

>Kwal_47.17449
          Length = 250

 Score =  177 bits (450), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 130/225 (57%), Gaps = 21/225 (9%)

Query: 20  DDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQY 79
           D+S    +D S   DEWI  F  + GHEYFC +  ++I D FN+  L + V  + + +  
Sbjct: 7   DNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHYRKALDL 66

Query: 80  IVDELDESILETMSNARLEQ---------LENDARKFYGLIHARYIITVKGLQKMLDKFK 130
           ++D      LE MS+   +          +E+ A + YGL+HARYI+T  GLQ M +KF 
Sbjct: 67  VLD------LEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHARYILTKPGLQAMAEKFD 120

Query: 131 DADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTS 190
             +FG CPR YC    +LP GL DT G   V+LYC SC+DLY+P+S RH C++GAF+GTS
Sbjct: 121 HKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEGAFWGTS 180

Query: 191 FPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQAQLA---RW 229
           FPG+FL+ F E+   V +     Y  ++FGF +  +A      RW
Sbjct: 181 FPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRW 225

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  178 bits (451), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 93/217 (42%), Positives = 132/217 (60%), Gaps = 17/217 (7%)

Query: 24  GEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVD- 82
            + +DS  Y +EWI  F  + GHEYFC +  D+I D FNL  L + V+ + + +  I+D 
Sbjct: 8   NDSSDSGNY-EEWIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILDL 66

Query: 83  ----ELDESILETMSNARLEQ--------LENDARKFYGLIHARYIITVKGLQKMLDKFK 130
               + +E   +  SN++ +         +E+ A + YGLIHAR+I+T  GLQ M +KF 
Sbjct: 67  ESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMAEKFD 126

Query: 131 DADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTS 190
             +FG CPR +C    LLP GL DT G   V+LYC SC+DLYIP+S RH  ++GA++GTS
Sbjct: 127 RKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAYWGTS 186

Query: 191 FPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQA 224
           FPG+FL+ F E+   V K   + Y  KIFGF + K+A
Sbjct: 187 FPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEA 223

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  177 bits (448), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 130/223 (58%), Gaps = 25/223 (11%)

Query: 27  TDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVD---- 82
           +D S   DEWI  F  + GHEYFC +  D+I D FN+ +L + V  + + +  I+D    
Sbjct: 11  SDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLILDLEMV 70

Query: 83  ----ELDE--SILETMSNARLEQLEND------------ARKFYGLIHARYIITVKGLQK 124
               ++DE  S  E+ S A      N             A + YGLIHARYI+T  GLQ 
Sbjct: 71  SDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHARYILTKPGLQA 130

Query: 125 MLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDG 184
           M +KF   DFG CPR +C+   LLP GL DT G   V+LYC SC+DLY+P+S RH C++G
Sbjct: 131 MAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSRHLCLEG 190

Query: 185 AFFGTSFPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQA 224
           A++GTSFPG+FL+ F E+   V +   + Y  K+FGF ++ QA
Sbjct: 191 AYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  174 bits (440), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 142/260 (54%), Gaps = 47/260 (18%)

Query: 21  DSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYI 80
           + + +V++SS Y DEWI  F  + GHE+FC +  ++I D FNL  L   V  + + +  I
Sbjct: 5   EDVSDVSESSNY-DEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLI 63

Query: 81  VD-----ELDE-----------SILETMSNARLEQ-------------LENDARKFYGLI 111
           +D     E DE           +  +  +   + Q             +++ A + YGLI
Sbjct: 64  LDLESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLI 123

Query: 112 HARYIITVKGLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDL 171
           HARYI+T +GLQ M +KF   +FG CPR YC    LLP GL DT G + V+LYCASC+DL
Sbjct: 124 HARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDL 183

Query: 172 YIPKSMRHSCIDGAFFGTSFPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQ----- 223
           Y+P S RH C++GAF+GTSFPG+FL+ F E+   V +     Y  +IFGF + K+     
Sbjct: 184 YLPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISGP 243

Query: 224 ---------AQLARWQEFQR 234
                    +  A WQEF++
Sbjct: 244 RMEWLRQYPSTEAEWQEFEK 263

>Scas_638.7
          Length = 270

 Score =  173 bits (439), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 135/239 (56%), Gaps = 28/239 (11%)

Query: 19  EDDSMGEVTDS-SEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVV 77
           E  S GE++D  S   +EWI  F  + GHEYFC++  ++I D FNL +L + V  + + +
Sbjct: 7   EVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKAL 66

Query: 78  QYIVD---------------------ELDESILETMSNARLEQLENDARKFYGLIHARYI 116
             I+D                     + DE + +         +E+ A + YGLIHARYI
Sbjct: 67  DLILDLEAISEEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYI 126

Query: 117 ITVKGLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKS 176
           +T  GLQ M +KF   +FG CPR +C    LLP GL DT G   V+LYC SC+DLY+P+S
Sbjct: 127 LTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQS 186

Query: 177 MRHSCIDGAFFGTSFPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQA---QLARW 229
            R  C++GAF+GTSFPG+FL+ F E+   V +     Y  K+FGF+++ +A   Q  +W
Sbjct: 187 SRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  175 bits (443), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 131/237 (55%), Gaps = 42/237 (17%)

Query: 34  DEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDELDESILETMS 93
           DEWI  F  + GHEYFC +  ++I D FN+  L + +  + + +  I+D      LE MS
Sbjct: 90  DEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILD------LEAMS 143

Query: 94  NARLEQ-------------------LENDARKFYGLIHARYIITVKGLQKMLDKFKDADF 134
           +   E                    +E+ A + YGLIHARYI+T  GLQ M +KF   +F
Sbjct: 144 DEDDEDDNDGAAEEDGSGEPVNRSIMEHAAEQLYGLIHARYILTKPGLQSMAEKFDHKEF 203

Query: 135 GRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGM 194
           G CPR YC    +LP GL DT G   V+LYC SC+DLY+P+S RH C+DGAF+GTSFPG+
Sbjct: 204 GTCPRYYCGGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGV 263

Query: 195 FLQAFPEM---VPKHPTKKYVPKIFGFELHKQ--------------AQLARWQEFQR 234
           FL+ F E+   V +     Y  K+FGF+++ +              A  A W+EF++
Sbjct: 264 FLKHFKELEDYVERKSKDVYELKVFGFKINGEAVSGPRMKWLRQYPATEAEWEEFEK 320

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  168 bits (426), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 138/259 (53%), Gaps = 52/259 (20%)

Query: 4   AKTMVQEEGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNL 63
           ++  V++   T + D++DS           DEWI  F  + GHEYFC +  ++I D FN+
Sbjct: 2   SQEFVEDYSRTGSSDDEDSGA--------YDEWIPSFCSRFGHEYFCQVPTEFIEDDFNM 53

Query: 64  INLQKTVSKFSQVVQYIVDELDESILETMSNARLEQ------------------------ 99
            +L + V  + + +  I+D      LE MS+   ++                        
Sbjct: 54  TSLSQEVPHYRKALDLILD------LEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKR 107

Query: 100 -----------LENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCNYQPLL 148
                      +E+ A + YGLIHAR+I+T  GLQ M +KF   +FG CPR YCN   LL
Sbjct: 108 RNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLL 167

Query: 149 PVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEM---VPK 205
           P GL DT G   V+LYC SC+DLY+P+S R  C++GAF+GTSFPG+FL+ F E+   V +
Sbjct: 168 PCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVER 227

Query: 206 HPTKKYVPKIFGFELHKQA 224
              + Y  K+FGF ++ +A
Sbjct: 228 KSKESYELKVFGFRINDEA 246

>Kwal_34.15798
          Length = 287

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 56/129 (43%), Gaps = 8/129 (6%)

Query: 11  EGLTHTQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTV 70
           + L HT +E + +  +T   E VD  + L L +       +     +     L  LQK  
Sbjct: 114 KNLEHTPEEREKIKSITVELEVVDSQVGLLLQEIQVLLSANEVSKAMVQSVKLQELQKHR 173

Query: 71  SKFSQVVQYIVDELDESILETMS-----NARLEQLENDAR---KFYGLIHARYIITVKGL 122
              ++ V+ I + + +S  + +       A L +L+ D R    F G IH  Y+I  + L
Sbjct: 174 QDVAKRVREITENVGQSAQQKLQVCEICGAYLSRLDTDRRLADHFIGKIHLGYVIIRQEL 233

Query: 123 QKMLDKFKD 131
           + +  +FKD
Sbjct: 234 ENLKKRFKD 242

>KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces
           cerevisiae YJR033c RAV1 singleton, start by similarity
          Length = 1363

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 28  DSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTV---SKFSQVVQYIVDEL 84
           D+ + V +W  + + K  +E FC I   ++  +     L+KT+   S  S++++YI+++ 
Sbjct: 234 DNKKNVQQWGTVEMSKSNNERFCVILDSWLIQK----TLRKTIKDQSHQSEMIKYILEKK 289

Query: 85  DESILETMSNARLEQL 100
            E IL T  + ++  L
Sbjct: 290 PEIILFTTPSLKIRVL 305

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score = 28.5 bits (62), Expect = 6.1,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 10/48 (20%)

Query: 50  CDIDPDYIT-DRFNLINLQKTVSKFSQVVQYIVDELDESILETMSNAR 96
           CD+DPD++  D FN+ N+ + +         + DELD S +  +S+ R
Sbjct: 128 CDLDPDFVVKDVFNVDNIVRVI---------LNDELDISEITPVSSYR 166

>KLLA0F26455g 2450871..2453462 similar to sp|P36016 Saccharomyces
           cerevisiae YKL073w LHS1 chaperone of the ER lumen, start
           by similarity
          Length = 863

 Score = 28.1 bits (61), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 80  IVDELDESILETMSNARLEQLENDARKFYGLIHA 113
           IVD L+   LE+  N R EQ E+DA     L+ A
Sbjct: 273 IVDLLENDFLESNPNIRTEQFESDASAKAKLVQA 306

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,525,572
Number of extensions: 381330
Number of successful extensions: 1112
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1103
Number of HSP's successfully gapped: 26
Length of query: 256
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 157
Effective length of database: 13,168,927
Effective search space: 2067521539
Effective search space used: 2067521539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)