Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4288588546280.0
YOR038C (HIR2)87590822470.0
Sklu_1979.384791319890.0
ACR088W85090318340.0
Kwal_55.2156687389918260.0
KLLA0E21945g84789916200.0
CAGL0I00968g99751913141e-166
Scas_702.168162501884e-14
AGR168W8253771804e-13
KLLA0A04928g8612101751e-12
Kwal_47.174658003581671e-11
CAGL0E02805g8403731643e-11
YBL008W (HIR1)8402211616e-11
KLLA0E11143g4933681321e-07
YML102W (CAC2)4681041033e-04
Kwal_27.103855361031025e-04
Scas_512.35341111016e-04
CAGL0J06512g545189930.006
Scas_657.1341154850.054
AER280C51096830.10
KLLA0C08547g515119790.26
YBR195C (MSI1)42267790.29
AER263C513117780.34
ADR339C63380780.37
ACR017W423211750.70
AFL118W832191750.84
Sklu_2364.455559731.4
Kwal_27.1259634930721.8
Kwal_33.15136473200722.1
AFL014C55770712.5
Sklu_2381.4640161712.6
KLLA0E04741g459127702.8
AAL009C30379702.8
CAGL0M05291g41956703.2
Kwal_47.1782752395703.7
YPR085C443171694.4
Sklu_1994.262484685.5
CAGL0M12749g45272676.4
YBR103W (SIF2)53550676.5
KLLA0E23529g82649686.6
KLLA0D00814g408118676.7
Sklu_2406.1142662677.2
CAGL0J03344g54357669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.42
         (885 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.42                                                          1787   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   870   0.0  
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                           770   0.0  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   711   0.0  
Kwal_55.21566                                                         707   0.0  
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   628   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   510   e-166
Scas_702.16                                                            77   4e-14
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    74   4e-13
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    72   1e-12
Kwal_47.17465                                                          69   1e-11
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    68   3e-11
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    67   6e-11
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    55   1e-07
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    44   3e-04
Kwal_27.10385                                                          44   5e-04
Scas_512.3                                                             44   6e-04
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    40   0.006
Scas_657.13                                                            37   0.054
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    37   0.10 
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    35   0.26 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    35   0.29 
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    35   0.34 
ADR339C [2080] [Homologous to NOHBY] (1305031..1306932) [1902 bp...    35   0.37 
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    33   0.70 
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    33   0.84 
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         33   1.4  
Kwal_27.12596                                                          32   1.8  
Kwal_33.15136                                                          32   2.1  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    32   2.5  
Sklu_2381.4 YPR074C, Contig c2381 6519-8436 reverse complement         32   2.6  
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    32   2.8  
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    32   2.8  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    32   3.2  
Kwal_47.17827                                                          32   3.7  
YPR085C (YPR085C) [5511] chr16 complement(708493..709824) Protei...    31   4.4  
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            31   5.5  
CAGL0M12749g 1255738..1257096 similar to sp|P40512 Saccharomyces...    30   6.4  
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    30   6.5  
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    31   6.6  
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    30   6.7  
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      30   7.2  
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    30   9.7  

>Scas_699.42
          Length = 885

 Score = 1787 bits (4628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 872/885 (98%), Positives = 872/885 (98%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120
           FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV
Sbjct: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120

Query: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTR 180
           ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTR
Sbjct: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTR 180

Query: 181 FTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTS 240
           FTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTS
Sbjct: 181 FTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTS 240

Query: 241 KDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGT 300
           KDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGT
Sbjct: 241 KDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGT 300

Query: 301 EDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGD 360
           EDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGD
Sbjct: 301 EDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGD 360

Query: 361 QLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPSS 420
           QLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPSS
Sbjct: 361 QLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPSS 420

Query: 421 KRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESSTPLNGEQNP 480
           KRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYN             ESSTPLNGEQNP
Sbjct: 421 KRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNVPKDLKRKKPKVKESSTPLNGEQNP 480

Query: 481 SPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGSG 540
           SPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGSG
Sbjct: 481 SPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGSG 540

Query: 541 SEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYTD 600
           SEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYTD
Sbjct: 541 SEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYTD 600

Query: 601 SGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIR 660
           SGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIR
Sbjct: 601 SGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIR 660

Query: 661 YSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDSL 720
           YSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDSL
Sbjct: 661 YSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDSL 720

Query: 721 NNDYKNDSNTLEELKNAENKKSLINMMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENM 780
           NNDYKNDSNTLEELKNAENKKSLINMMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENM
Sbjct: 721 NNDYKNDSNTLEELKNAENKKSLINMMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENM 780

Query: 781 EEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGK 840
           EEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGK
Sbjct: 781 EEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGK 840

Query: 841 SDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGMLASSIP 885
           SDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGMLASSIP
Sbjct: 841 SDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGMLASSIP 885

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/908 (49%), Positives = 609/908 (67%), Gaps = 60/908 (6%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           MRLLKYPLD+ ++ V AL A+G ++I+  + GHV  W QQ LV+TAF+++ I+DL+   S
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNK-------KFECVFQC 113
           FQ+D        ++F + G  + L + +E+R+     WL RD N          + +F+C
Sbjct: 61  FQVDQ---DTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFEC 117

Query: 114 HMGSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLI 173
              S + ITD+K D    I+ V + + ++ILLF  +T   ++ I  + K S   +PIT I
Sbjct: 118 K--SPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITID-KAS---KPITGI 171

Query: 174 IDPCGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLIN 233
           IDP G  FTV+ SDRS+LVYQIN++G  KL+N   Q+VQ++PLHY+I+M PQ D LP+IN
Sbjct: 172 IDPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVIN 231

Query: 234 SIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYN 293
           S+KG  +   + T LLD N+NYK+  T+V+PSS+  +VL YSP  YEK N KKGT   YN
Sbjct: 232 SVKGVPNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYN 291

Query: 294 LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAF 353
           L+ATSG+ DGTIL+WNTKRMKPLFNA+  SS  IND+ WSQDG TLFAIS+D+ LYTFAF
Sbjct: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAF 351

Query: 354 QDNDLGDQLSIEQVTLLRDQNKKLPILSNLNLDK--KVLQSKLDACLNKSDEKTITKIQK 411
           Q+ DLG  L   ++  L++ NKKLP L     ++  K     +    + S       I +
Sbjct: 352 QEKDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGR 411

Query: 412 EEGTKKPSSKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESS 471
               KKP+ K+         A +Q + +K  QST+MEFN PSY              + +
Sbjct: 412 SAVGKKPTKKKT--------ANNQTNGIKTIQSTSMEFNTPSY----TVPRDLKRKPKEA 459

Query: 472 TPLNGEQNPSP-TKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPN 530
           TP     N +P +KK K++L+PI FLDTGLLLPN SFSR+RLATPKIR  F Y+P ++PN
Sbjct: 460 TP----SNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPN 515

Query: 531 LYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCT 590
           L + +KNGSG+EQ P+IV L  K L       Q +++FQDFIPK +  C AG++FW  C+
Sbjct: 516 LILDVKNGSGNEQRPTIVKLTSKVLD------QDQVLFQDFIPKLITICTAGDTFWSFCS 569

Query: 591 SDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTT 650
            DG++Y Y+DSGR+L+ P+ LGV I+FL+AC  YLLC+TS+GELYCW++  KKL FP  T
Sbjct: 570 EDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNT 629

Query: 651 VYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWW 710
           +YPLL PS+RYSDD+LTR ENIT+C++T KGVPL TLSNGDGY+FDK+ME+WLLVSDGWW
Sbjct: 630 IYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWW 689

Query: 711 AYGSQYW---------------DSLNNDYKNDSNTLEELKNAENKKSLINMMERKTNEEL 755
           AYGSQYW               DS N    N +  + ++KN  + +S+IN +E KTN+EL
Sbjct: 690 AYGSQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKN--DNQSIINFLECKTNDEL 747

Query: 756 DRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSR 815
           +RKGRIK+LQRFA+T+LMKEGFENMEEIVTLSHLEN+IL+S++LEE  EF  L++ Y  R
Sbjct: 748 NRKGRIKNLQRFARTILMKEGFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIR 807

Query: 816 LGELGYIERLNDMLQWIYNDGKMGKSDLLLGQS--RELILKDILIACADMRHVQRVTKAY 873
           L ELGY++RLND+ QW+Y+D  +  +         +  +LK ILIAC D+R VQRVT  Y
Sbjct: 808 LSELGYMDRLNDVFQWLYDDLPISGTGSAFADKDFKRNLLKKILIACGDIRQVQRVTTRY 867

Query: 874 ASAIGMLA 881
           A  + +++
Sbjct: 868 AKEMNIIS 875

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/913 (46%), Positives = 581/913 (63%), Gaps = 95/913 (10%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           M+LLKYP  L D ++ A  AI   L+ V +   V VW  + L++TA  K    +L E  S
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGS-ERVSVWDTKQLLDTAMGKSSANELSELFS 59

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120
            + +  N KL   VFA   T+  L + T++ +  + +WL   +   F  +++    S   
Sbjct: 60  SKGNFNNEKLCY-VFA---TDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPS--T 113

Query: 121 ITDMKIDQLNKI--VLVSMVSPDQI-LLFNLETL-KLINVIDQEFKPSLNRRPITLIIDP 176
           ITD+K D LN I  +LVS+ S   + +L+   T  +L  ++       L  +P+T IIDP
Sbjct: 114 ITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEIL-------LPTKPMTGIIDP 166

Query: 177 CGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIK 236
            G  FT++ + RS+ +YQ N  G++KL++  PQYVQ+ P+HY +TM P  DT+P+INS++
Sbjct: 167 MGQIFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLR 226

Query: 237 GSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLA 296
            ST     + VLLD N+ +K+ +T+V    S  K+LK+SP +YEKTN+   T+  YNLLA
Sbjct: 227 NSTP----SVVLLDRNNEFKVSTTLVG-YDSKCKILKFSPNLYEKTNKTGTTR--YNLLA 279

Query: 297 TSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDN 356
           +SG E+G++ +WNTKR +PLFNA   +   IND+VW+ DG+ LFA+SDD  +Y FAFQ+ 
Sbjct: 280 SSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEK 339

Query: 357 DLGDQLSIEQVTLLRDQNKKLPILSNLNLD-------KKVLQSKLDACLNKSDEKTITKI 409
           +LG  L  E+   L+   KKL  L    L        K    S ++  LN          
Sbjct: 340 ELGQVLPQEETVKLQASIKKLEPLPTEELKPSHDIKPKTSGGSSVNLSLN---------- 389

Query: 410 QKEEGTKKPSSKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXE 469
                   P++  ++  K+ +P           QST+MEFNPPSY+             +
Sbjct: 390 --------PTTVTKSGKKKVVPTT--------IQSTSMEFNPPSYSVPKDLKRKPK---D 430

Query: 470 SSTPLNGEQNPSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDP 529
             T +NG       KK K+D++P+ FLDT +L+PN+SFS++RLATPKIR+ F Y+P  + 
Sbjct: 431 EETMVNG-------KKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPVHNK 483

Query: 530 NLYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCC 589
           NL   +KNG+G+EQ P+ +SL  K      +  Q ++IFQDFIPK+V    AGESFW CC
Sbjct: 484 NLIFDVKNGTGNEQKPTSISLLLK------EPEQDRMIFQDFIPKFVTLSSAGESFWACC 537

Query: 590 TSDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMT 649
           T DGTLY Y+D+G+RLLPPM +GVP +FL+AC +YLLCVTS+G+LYCWD+  K+L FP+ 
Sbjct: 538 TEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVN 597

Query: 650 TVYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGW 709
           TVYPLL P +RYSDD+LTR ENITMCT+T  GVPL TLSNGDGY+FD DME+WLL+SD W
Sbjct: 598 TVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLISDSW 657

Query: 710 WAYGSQYWDSLN------------NDYKN------DSNTLEELKNAENKKSLINMMERKT 751
           WAYGSQYWD  N            +D KN        N +  +++  NK S++N +E KT
Sbjct: 658 WAYGSQYWDMTNTNGVVVTTGSDKDDKKNRYWNPEAENLVSNVRS--NKSSIVNYLESKT 715

Query: 752 NEELDRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIA 811
           N+EL RKGRI++LQ+FAKT+LMKEGFEN+E+IVTLSHLENR+LVSLKL E  EF  L+I 
Sbjct: 716 NDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTRLLIV 775

Query: 812 YSSRLGELGYIERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTK 871
           Y  RLGE+GY  RLND+LQW+YN+G   K + + G +RE +LK IL+ACAD+R VQRVT 
Sbjct: 776 YCIRLGEMGYKNRLNDVLQWLYNNGNY-KMEKIAGTTREELLKQILVACADIRQVQRVTV 834

Query: 872 AYASAIGMLASSI 884
           +YA+ +G++  S+
Sbjct: 835 SYATVLGLIDESL 847

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/903 (43%), Positives = 544/903 (60%), Gaps = 72/903 (7%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           M+LLKYP  L D  + A   +G  L++V     +  +    L   A  ++ +R++     
Sbjct: 1   MKLLKYPRQLHDGQLLAGCVVGGLLVVVGR-DRISAYDCGKLQAAARGELAVREVSAEVE 59

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILIS-RNWLIRDKNKKFECVFQCHMGSDN 119
            Q++     L R V   EG    L++A + +I  +  +W    +  +F  V Q   G+  
Sbjct: 60  LQVEVGEDAL-RYVAGGEGE---LVVAGDRQIWAAGADWRSAGRGTRFLTVAQLAGGA-- 113

Query: 120 VITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGT 179
            +TD+K D    +V VS+   D++ L+     + + V+      +L  +P+TL++DP G 
Sbjct: 114 CVTDVKADGAG-LVFVSVSGKDEVWLYATGAWERVGVV------TLAAKPVTLVVDPLGE 166

Query: 180 RFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGST 239
             TV+  +RS+ VYQ N  G  ++    PQYVQ +PL Y ITM PQGD LPL+NSIK   
Sbjct: 167 LLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNG- 225

Query: 240 SKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSG 299
              + +  LLD    + ++ST+V       K+L++SP +YEK N+ K     YNLLA+SG
Sbjct: 226 ---LPSAQLLDRTAGFSVQSTLVG-YVDKCKILRFSPRLYEKPNKDK-PPTQYNLLASSG 280

Query: 300 TEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLG 359
            EDG++++WNTKR KPL NA   +   IND+ WS+DG  LFAIS+D  L+ FAF + +LG
Sbjct: 281 NEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELG 340

Query: 360 DQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPS 419
             L   ++  LR    +L          + L       L KS+ K     + +  +   S
Sbjct: 341 RLLDDAELEKLRQSVPRL----------EPLPPPTPKSLAKSEAKPQQDTKPDAKSSANS 390

Query: 420 SKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESSTPLNGEQN 479
              +T  K+  P         +  ST+MEFN PSY              + + P      
Sbjct: 391 VSAKTGKKKIAPT--------VITSTSMEFNEPSYTVPKDLKRRPKQETQRTGP------ 436

Query: 480 PSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGS 539
             PTK+ KRD+EP+ FLDT LL+PN+SFS+ RLATPK+R+ F Y      NL M +KNG+
Sbjct: 437 --PTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGT 494

Query: 540 GSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYT 599
           GSEQ P+ ++L    L+ ++KD    ++FQDF P++V  C  G SFW CCT +G +Y Y+
Sbjct: 495 GSEQKPTSITL---TLKDKEKDM---VLFQDFTPRFVTICTCGHSFWACCTEEGIVYVYS 548

Query: 600 DSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSI 659
           ++G++LLPPM +GVP++FL+ C  YLLCVTS+G+L+CW++   KL FP+ T+YPLL PSI
Sbjct: 549 NTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSI 608

Query: 660 RYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDS 719
           RYSDDVLTR ENITMCT T  G+PL TLSNGDGY+FD DME WLL++D WWAYGSQYWD 
Sbjct: 609 RYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWAYGSQYWDF 668

Query: 720 LNNDYKNDS----NTLEELKN--------------AENKKSLINMMERKTNEELDRKGRI 761
            N  +   S    N  E+ KN               +NKKS++N +E KTN+E+ RKG I
Sbjct: 669 TNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKNKKSVVNYLESKTNDEMTRKGLI 728

Query: 762 KHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGY 821
           ++LQRFAKT+LMKEGFEN+E+IVTLSHLENR+LV+LKL E NEF  L+  Y   L E+G+
Sbjct: 729 RNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYCISLAEMGF 788

Query: 822 IERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGMLA 881
             RL+D+L W+YNDG+  K   +  + RE +LK IL+ACAD+R VQRVT +YASA+G+L 
Sbjct: 789 KNRLDDVLSWLYNDGEY-KVGTIANEKREELLKQILVACADIRQVQRVTTSYASALGLLD 847

Query: 882 SSI 884
            S+
Sbjct: 848 VSL 850

>Kwal_55.21566
          Length = 873

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/899 (42%), Positives = 551/899 (61%), Gaps = 73/899 (8%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           M+LLKYP  L    +     IG +L+       V VWS   LV  A   I  +++RE   
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQ-DSVCVWSCSQLVGAAMGNISAKEVREK-- 81

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120
           F+I     +L+     V G++  L + T+  +L + + L + +   F+ ++  H+ +   
Sbjct: 82  FEIKVLEARLEPLRLVV-GSDACLYVGTDRTVLYADSLLEKGEKTSFQTLY--HVEAPAC 138

Query: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLN-RRPITLIIDPCGT 179
           +TD+K D     + V +   ++     L  L       Q  + SL   +PIT ++DP G 
Sbjct: 139 VTDVKFDFQTGTIFVLVNQGNEGNYVAL--LDAAGGGAQVGQISLGASKPITGVVDPAGQ 196

Query: 180 RFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGST 239
            FTV+C+DR++ V+Q    G+ KLL+    Y+QV PL Y I+M PQ DTLPL+NS+ GST
Sbjct: 197 IFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGST 256

Query: 240 SKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSG 299
                  +LLD    +K+++T+V       ++ ++SP++YEK  QK GTKV+YNL ATSG
Sbjct: 257 P----AILLLDRKSGFKLRATLVG-HFDKCQICQFSPSLYEKV-QKSGTKVTYNLAATSG 310

Query: 300 TEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLG 359
            + G++++WNTKR+KPL N   T    + D+ WS DG TLFA++++ +L+ FAF+D +LG
Sbjct: 311 FDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELG 370

Query: 360 DQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPS 419
             L    V  LR     L  L    +   + Q+     +       ITK+  +     P+
Sbjct: 371 KTLPKSHVDKLRSDCATLSPLPPTEV-PDLNQTIKPEIVAPGSSGVITKVNGKNKVA-PT 428

Query: 420 SKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESSTPLNGEQN 479
           + R                     S +MEF  PSY+                 PL    N
Sbjct: 429 TIR---------------------SLSMEFIAPSYSVPKDLKR------RPKDPLQATTN 461

Query: 480 PSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGS 539
               KK K DLEP+ FLDT LL+P VSFS++RLA PK+RL FTY P +  +L +++KNGS
Sbjct: 462 ----KKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGS 517

Query: 540 GSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYT 599
           G+EQTP++++L  K      +  Q K IF+DF+PK +  C +G++FW CC+ DGT+Y Y+
Sbjct: 518 GNEQTPTVITLKLK------ESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYS 571

Query: 600 DSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSI 659
           DSGR+LLPPM +GVP +FL+AC  +LLCVTS+G++YCW++   +LLFP T++YPLL P++
Sbjct: 572 DSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNL 631

Query: 660 RYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWD- 718
           R+SDDVLTR ENITMCT+T+ GVP+ TLSNGDGY++DK ME W+L++D WWAYGSQYWD 
Sbjct: 632 RFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDT 691

Query: 719 ---SLNNDYKNDSNTLEELKN--------------AENKKSLINMMERKTNEELDRKGRI 761
              + N  Y ++ N   + KN               ENK S++N +E +TN+EL+RKGR+
Sbjct: 692 TKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRV 751

Query: 762 KHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGY 821
           ++LQ+FAKT+LMKEG+EN+EE+VTLSHLEN++LVSL+L E+ EF  L+  Y  RL E+GY
Sbjct: 752 RNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGY 811

Query: 822 IERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGML 880
             RL+D+LQW+Y+DG   K+  + G   E +L+ IL+ACAD+RHVQRVT +YA+AIG++
Sbjct: 812 KNRLDDVLQWLYDDGNY-KAKSVAGVKAEELLRKILVACADIRHVQRVTTSYATAIGLI 869

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/899 (39%), Positives = 528/899 (58%), Gaps = 67/899 (7%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60
           M+LLK P  L D  +       + L I+    ++ +W  Q+L+N A  K  +++++E   
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGG-KYLSIWDSQTLLNAATGKTDVKEVKELEK 59

Query: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120
             +D      +   + V   N  L+  +++  L++   L +D N +++         +  
Sbjct: 60  MSLDLLESNQEDGRWLVVLDNQRLVYGSDH--LLACLDLNKDSNSEYKSREIGIFKDNEA 117

Query: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTR 180
           ITD+K D++N ++ VS+   + + + + +T +L + I+      L  +PI++I DP G  
Sbjct: 118 ITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIE------LKSKPISIITDPLGQL 171

Query: 181 FTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTS 240
            TV+  +RS+ +YQ +  G  KL  +  Q+VQ +PL Y++TM PQGD +P+INS+     
Sbjct: 172 LTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHN--- 228

Query: 241 KDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKV-SYNLLATSG 299
            ++ T VLLD    +KIK ++V    ++ K+LK+SP IY KT         ++NLLA+SG
Sbjct: 229 -NVPTAVLLDRIQKFKIKLSLVG-YVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSG 286

Query: 300 TEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLG 359
            EDG +++WNT R+KPLF+A    +  I D+ W   GL LFAIS D  L  FAFQ+N+LG
Sbjct: 287 NEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELG 346

Query: 360 DQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPS 419
           D + +E VT   +  K++ +L  L    K                      +E  TK P 
Sbjct: 347 DVMPVEAVT---EAAKEIKLLDPLPFKPKA---------------------EEPDTKLPP 382

Query: 420 SKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESSTPLNGEQN 479
           +K       N   Q + + +    STNMEF  PSY               +  PL   QN
Sbjct: 383 NKTAQQTTTNSKKQPKAAEITTISSTNMEFIQPSY----MVPKDLKRKPVTEDPLLA-QN 437

Query: 480 PSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGS 539
               KK K++L+ I FLDT L LP+VSFS++RLA PKIR  F Y+  S  N  + IKNG 
Sbjct: 438 KPANKKAKKELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQYS--SQGNFVLDIKNGL 495

Query: 540 GSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYT 599
           G++Q P+ ++L       R+ +   K +FQ F+PK+V  C AG SFW   T  G +Y  +
Sbjct: 496 GNDQKPTSITL------TRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYVTS 549

Query: 600 DSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSI 659
            SG+ L PPM LGVP++FL+    YLLC+TS+G++YCW+++  K+ FP+  VY LL P +
Sbjct: 550 ISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPINDVYSLLNPML 609

Query: 660 RYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDS 719
           RYSDDVL+R ENITMC VTS+G+P+ TLSNGDGY+FD  ME+W+L++D WW YGSQYW+ 
Sbjct: 610 RYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYWNF 669

Query: 720 LNND----YKNDSNTLEELKNAE----------NKKSLINMMERKTNEELDRKGRIKHLQ 765
           +++       ND    ++  NAE          NK S+IN +E KTN+EL RKGR+KHLQ
Sbjct: 670 MSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELTRKGRMKHLQ 729

Query: 766 RFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERL 825
           RFAK LLMKEGFEN+EE++TL+HLEN+ILVS +L+E  E   L+  Y  R+ E+GY +R 
Sbjct: 730 RFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTDRF 789

Query: 826 NDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKAYASAIGMLASSI 884
           +  L W+Y+      S L + + R LI KDI+I+CA++R VQRVT +YA+ +G+++ S+
Sbjct: 790 SQTLSWLYDPTNTKFSPLDIDRRRNLI-KDIIISCANIRQVQRVTTSYANELGVISDSL 847

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  510 bits (1314), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 258/519 (49%), Positives = 356/519 (68%), Gaps = 30/519 (5%)

Query: 373 QNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTI---TKIQKEEGTKKPSSKRRTSLKQN 429
           ++K   + ++ N+ KKV  SK +  +  +++KT      I+ E G  K +  + T     
Sbjct: 490 ESKSSSVTTSDNIQKKVEDSKSNVSVTATEKKTKPDKKSIKSENGESKVNKAQNT----- 544

Query: 430 LPAQSQDSMVKITQSTNMEFNPPSYNXXXXXXXXXXXXXESSTPLNGEQNPSPTKKLKRD 489
                ++S     +ST  +F  PSY                  P       + TK+ K+D
Sbjct: 545 --ISPKESNTTDNKSTTPDFKNPSYQVPKDLKRK---------PKEDALGNAVTKRAKKD 593

Query: 490 LEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGSGSEQTPSIVS 549
           LEP+ FLDTGLLLPNV+FSR+RL+TP IR+    T  +D  + + I+NGSG+EQ P+IV 
Sbjct: 594 LEPVDFLDTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVK 653

Query: 550 LYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYTDSGRRLLPPM 609
           L  K +      T  + +FQDFIPK+V    +G+ FW C + DGTLY + D GR+++PP+
Sbjct: 654 LLDKTV------TPERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPL 707

Query: 610 TLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIRYSDDVLTRV 669
           T+GVPI+FL+AC +YLLCV+S+GELYCW+++  KL FP+TT++PLL PSIRYSDD+LTR 
Sbjct: 708 TIGVPISFLEACGKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRA 767

Query: 670 ENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDSLNN-DYKNDS 728
           ENITMC+VT+ G P+ATLSNGDGY++DK+ME+WLLVSDGWWAYGSQYWDS NN +   DS
Sbjct: 768 ENITMCSVTNNGFPIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDS 827

Query: 729 NT--LEELKNAE-NKKSLINMMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENMEEIVT 785
           +T   E   + E +K S++ ++E+KTN EL RKGRIK+L+RFA+T+LMKEGFEN+EEIVT
Sbjct: 828 STKPTEGQSSTEISKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVT 887

Query: 786 LSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGKSDLLL 845
           LSHLEN++LV+L+LEE +EFK LI  Y+ +LGELGY++RL D+  WI +D      DL+ 
Sbjct: 888 LSHLENKLLVTLRLEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSN-DNGDLIP 946

Query: 846 GQSRELILKDILIACADMRHVQRVTKAYASAIGMLASSI 884
           G +R+ ++K +L ACAD+R VQRVT  YA  +G L + I
Sbjct: 947 GINRKELVKTLLTACADLRSVQRVTIDYADMLGYLPNDI 985

 Score =  298 bits (764), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 172/389 (44%), Positives = 245/389 (62%), Gaps = 16/389 (4%)

Query: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIV-SNVGHVHVWSQQSLVNTAFNKIPIRDLRESH 59
           MRLLKYPL+    +V +LV I +  ++V  + G + VW QQ L++TAF++  +  L+  +
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 60  SFQIDSFNPKLDRN--VFAVEGTNDLLILATENRILISRNWL--IRDKNKKFECVFQCHM 115
           SF   +F  K D +  VFA+ G  D L L TE+ +     WL  +   +   E       
Sbjct: 61  SF---TFELKDDEDELVFAM-GDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTT 116

Query: 116 GSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIID 175
            S ++ITD+K D L  I+ V    P +I LF+  +     +         N +P+T ++D
Sbjct: 117 VSQSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDK--NSKPLTGVVD 174

Query: 176 PCGT-RFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINS 234
           P G   FTVL SDRS++VY IN +G++K +    Q+V V+PLHYKITMPPQ D LP+INS
Sbjct: 175 PSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINS 234

Query: 235 IKGST-SKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYN 293
           +KGS+ +   T TVLL+ N+NYK+ ST+V  +SSNTKVL +SP +YEK N K+GT   YN
Sbjct: 235 LKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYN 294

Query: 294 LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAF 353
           L+ATS   DG+I++WNTKR KPLF  ++ S   IND++WS +GLTLFA+S+D+VLYTFAF
Sbjct: 295 LVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAF 354

Query: 354 QDNDLGDQLSIEQVTLLRDQN---KKLPI 379
             +DLG  + +E++  +R  N   + LPI
Sbjct: 355 LQDDLGKTVPMEEIENIRQSNIIKEPLPI 383

>Scas_702.16
          Length = 816

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 115/250 (46%), Gaps = 30/250 (12%)

Query: 133 VLVSMVSPDQILLFN---LETLKLINVIDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRS 189
           +LVS+     ++++N    E LK  +V     K         +I DP    F     DR+
Sbjct: 151 LLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVK--------GVIFDPANKYFATASDDRT 202

Query: 190 MLVYQINESGN--FKLLNTFPQYVQVHPL---HYKITMPPQGDTLPLINSIKGSTSKDIT 244
           M +++ ++ G+  F + +   +  +  PL     +++  P G  +   N+  G  S    
Sbjct: 203 MKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNATNGPVS---- 258

Query: 245 TTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYE--------KTNQKKGTKVSYNLLA 296
            +V +     +    +++    + T+V++++P ++E        K  Q  G   S   + 
Sbjct: 259 -SVAIINRGTWDSNISLIG-HDAPTEVVRFNPRLFEVNDGMTPAKRKQDSGPNDSMESII 316

Query: 297 TSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDN 356
            +  +D T+++W+T R +P+F A   ++  I D+ W+ DG  LF  S DS +    F+DN
Sbjct: 317 ATAGQDKTVVVWSTTRARPIFIAFDIANKSITDMQWTPDGTMLFLTSLDSSITILVFEDN 376

Query: 357 DLGDQLSIEQ 366
           +LG  + +E+
Sbjct: 377 ELGKIIPLEK 386

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 15/131 (11%)

Query: 533 MTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYV--------CQCIAGES 584
           + IKNG          +LY  P ++     Q K+    F+P+ V        CQC     
Sbjct: 638 LEIKNGVERSIQFDKEALYDNPTKLVGY-YQGKICLTAFLPEVVITAVGSSHCQC----- 691

Query: 585 FWCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKL 644
            WC  T++G+LY    +G+   P +++G  I  +   ++YL+ +T  G  Y WD+   KL
Sbjct: 692 -WCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMINRERYLIALTERGLFYIWDIEDLKL 750

Query: 645 LFPMTTVYPLL 655
           +     + P+L
Sbjct: 751 VSKNIPILPIL 761

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/377 (21%), Positives = 158/377 (41%), Gaps = 58/377 (15%)

Query: 32  GHVHVWSQQSLVNTAFNKI--PIRD----------LRESHSFQIDSFNPKLDRNVFAVEG 79
           G + +WS   ++  A  K+  P R+           R + S     F+P    N +   G
Sbjct: 39  GKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSVTALKFSPD---NKYLASG 95

Query: 80  TNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNVITDMKIDQLNKIVLVSMVS 139
           ++D ++L  E      +     + + +   V +  +  DN I D+     +  +LV++  
Sbjct: 96  SDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICW-APDSSILVTVGL 154

Query: 140 PDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRSMLVYQINESG 199
              I+++N  T + I   D             ++ DP    F     DR++ V++ ++  
Sbjct: 155 DRSIIVWNGSTFEKIKRFDVH-----QSHVKGVVFDPANKYFATASDDRTVKVFRYHKGT 209

Query: 200 N--FKLLNTFPQYVQVHPL---HYKITMPPQGDTLPLINSIKGSTSKDITTTVLLDANDN 254
           +  F + +   +  Q  PL     +++  P G  + + N+  G  S     TV + +  N
Sbjct: 210 DLSFTIEHIITEPFQGSPLTTYFRRLSWSPDGQHIAVPNATNGPVS-----TVAIISRGN 264

Query: 255 YKIKSTIVSPSSSNTKVLKYSPTIYEKT-NQKKGTKVSY--------------------- 292
           +    ++V      T+V  ++P ++E   N ++G +V                       
Sbjct: 265 WDTSVSLVG-HDQPTEVACFNPRLFEHNDNHERGEEVDGASKDNSAASESSGKRRLKDDD 323

Query: 293 ---NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLY 349
              +++AT+G +D T+ +W+T R +P+F A   +S  + DI W+ DG  LF  S D  + 
Sbjct: 324 RVDSVIATAG-QDKTLAVWSTSRARPIFVAYDLTSKSVTDIAWTCDGTALFLTSLDGRII 382

Query: 350 TFAFQDNDLGDQLSIEQ 366
              F++ +LG  + +EQ
Sbjct: 383 VITFEEGELGKAIPLEQ 399

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 77/172 (44%), Gaps = 3/172 (1%)

Query: 533 MTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESF--WCCCT 590
           + I+NG          +L++ P +I     Q +   + F+P+ V  C+  ++   W   T
Sbjct: 643 LEIRNGVERSIQFDREALFENPTKILGYH-QGERTLEAFLPEVVISCVGSKACQCWALAT 701

Query: 591 SDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTT 650
           + G+LY Y + G+ L+P +++G  +  L A + +++  T     + WD+   KL+    +
Sbjct: 702 ASGSLYIYGNHGQLLVPKISIGHKVIKLIAWQHFVIAFTETCLFWIWDIRAMKLVEKEIS 761

Query: 651 VYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESW 702
           V P+L       + V      +    +      L  +S+G  Y++ K +  W
Sbjct: 762 VLPVLVQDQPQCNRVRISRRILDFRMLADSHELLVEMSDGASYVWKKALGCW 813

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 96/210 (45%), Gaps = 21/210 (10%)

Query: 172 LIIDPCGTRFTVLCSDRSMLVYQINESG--NFKLLNTFPQYVQVHPL---HYKITMPPQG 226
           ++ DP    F     DR++ +++ +++G  +F + +   +  +  PL     +++  P G
Sbjct: 182 VVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDG 241

Query: 227 DTLPLINSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKT---- 282
             +   N++ G  S     TV +     ++   ++V      T+V  ++P I+++     
Sbjct: 242 QHIAAPNAMNGPVS-----TVAIIERGTWESPVSLVG-HDQPTEVASFNPRIFKRQKDDS 295

Query: 283 ------NQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDG 336
                  +K G     + +  S  +D T+ +W+T + +PL  A       I D+ W+ DG
Sbjct: 296 TTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARPLIVAQDICGKSITDMSWTPDG 355

Query: 337 LTLFAISDDSVLYTFAFQDNDLGDQLSIEQ 366
             LF  S DS +    F+DN+ G+ + +EQ
Sbjct: 356 KILFITSLDSSIVVLTFEDNEFGEAIPLEQ 385

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 2/90 (2%)

Query: 568 FQDFIPKYVCQCIA--GESFWCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYL 625
           F+ F P  V  C+       W   T+ G L+     G+   P +++G  I  L   + ++
Sbjct: 697 FELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLCTSQSHV 756

Query: 626 LCVTSLGELYCWDLSMKKLLFPMTTVYPLL 655
           + +T    +Y WDL    L      + PLL
Sbjct: 757 IAITETALIYVWDLVSMSLTLKNIPLLPLL 786

>Kwal_47.17465
          Length = 800

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/358 (21%), Positives = 160/358 (44%), Gaps = 63/358 (17%)

Query: 56  RESHSFQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHM 115
           R + S  +  F+P  D N F   G++D ++L  E      +     + +K+   V +  +
Sbjct: 20  RHTGSVTVVRFSP--DGN-FLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLV 76

Query: 116 GSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIID 175
             DN I D+     +  +LV++     ++++N  T + I   D     SL +    +I D
Sbjct: 77  AHDNDIQDI-CWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFD--VHQSLVK---GVIFD 130

Query: 176 PCGTRFTVLCSDRSMLVYQINESGN--FKLLNTFPQYVQVHPL---HYKITMPPQGDTLP 230
           P    F     DR++ +++ +++G+  F + +   +  +  P+     +++  P G  + 
Sbjct: 131 PANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQHIA 190

Query: 231 LINSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYE----KTNQKK 286
             N+  G  S     +V + A  ++    T++    S T+V++++P +++    KT + K
Sbjct: 191 APNATNGPVS-----SVSIIARGSWDTSVTLIG-HDSPTEVVRFNPRLFQVLEKKTEKNK 244

Query: 287 --------------GTKVSYN------------------------LLATSGTEDGTILMW 308
                         G K S +                        ++AT+G +D T+++W
Sbjct: 245 PEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIATAG-QDKTLVVW 303

Query: 309 NTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIEQ 366
           +T + +P+F A   +S  I D+VW+ +G  LF  S D  + TF F + +LG+ + +E+
Sbjct: 304 STGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFGEKELGEAIPLER 361

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 62/130 (47%), Gaps = 6/130 (4%)

Query: 530 NLY-MTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGE---SF 585
           +LY M ++NG          +L++ P +I       ++I  D +   V  C+ G      
Sbjct: 622 DLYVMEVRNGVERALQFDREALFEHPTRILAYHKGERII--DLLIPDVIICVVGSLKCKC 679

Query: 586 WCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLL 645
           W   T+DG +Y YT  G++ +P + LG  +  + A  +Y++ +T  G LY W++  +  +
Sbjct: 680 WVLATADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVVILTETGLLYAWNIEAEICI 739

Query: 646 FPMTTVYPLL 655
                + P+L
Sbjct: 740 HKKVPIMPIL 749

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 154/373 (41%), Gaps = 67/373 (17%)

Query: 32  GHVHVWSQQSLVNTAFNKIPI-RDL--------RESHSFQIDSFNPKLDRNVFAVEGTND 82
           G + +WS  +LV+ A  +  + RD         R + S     F+P  D N  A  G++D
Sbjct: 39  GKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSP--DGNYLA-SGSDD 95

Query: 83  LLILATENRILISRNWLIRDKN----------KKFECVFQCHMGSDNVITDMKIDQLNKI 132
            ++L           W + ++N          K+   V +  +  DN I D+     + I
Sbjct: 96  RILLI----------WAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSI 145

Query: 133 VLVSMVSPDQILL--FNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRSM 190
           ++   +    I+    N E LK  +V     K         +I DP    F     DR+M
Sbjct: 146 LVTVGLDRSVIVWNGLNFERLKRFDVHQSLVK--------GVIFDPANKYFATASDDRTM 197

Query: 191 LVYQINESG--NFKLLNTFPQYVQVHPL---HYKITMPPQGDTLPLINSIKGSTSKDITT 245
            V++ +++G  +F +     +     PL     +++  P G  + + N+  G  S     
Sbjct: 198 RVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDGQHIAVPNATNGPVS----- 252

Query: 246 TVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNL----------- 294
           +V +     +    +++    + T+V +++P +++   +KK       L           
Sbjct: 253 SVAIINRGTWDSSISLIG-HDAPTEVARFNPRLFKSDVEKKAKNAKDELSKDTKNNKKLE 311

Query: 295 --LATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFA 352
             +AT+G +D ++ +W T R +P+F A   +   I D+ W+ +G  LF  S DS +    
Sbjct: 312 SIIATAG-QDKSLALWITSRPRPIFVAYDIAQKSITDMAWNPNGNILFVTSLDSSIVMLM 370

Query: 353 FQDNDLGDQLSIE 365
           F  N+LG  + IE
Sbjct: 371 FDANELGMPIPIE 383

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 549 SLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAG--ESFWCCCTSDGTLYTYTDSGRRLL 606
           +L+  P +I       + I + FIP  +   +      +W   T+DG +Y  + +G+ L+
Sbjct: 656 ALFDNPTRILGYHEGQRTI-EAFIPNVIISGVGSPVSKYWSLATADGFIYIISYNGQLLI 714

Query: 607 PPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLL 655
           P + LG  +     C  YLL +T  G  Y WD+S K+ +    ++ P++
Sbjct: 715 PKINLGQKVVKQVVCSNYLLVLTERGLFYAWDISAKRSVIKNVSILPII 763

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 105/221 (47%), Gaps = 33/221 (14%)

Query: 172 LIIDPCGTRFTVLCSDRSMLVYQINESGN--FKLLNTFPQYVQVHPLHYKITMP---PQG 226
           ++ DP    F     DR+M +++ +++G+  F + +   +  +  PL      P   P G
Sbjct: 185 VVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDG 244

Query: 227 DTLPLINSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEK---TN 283
             + + N+  G  S     ++ +     +    +++    + T+V +++P ++E+     
Sbjct: 245 QHIAVPNATNGPVS-----SMAIVNRGTWDTNVSLIG-HDAPTEVARFNPRLFERNAGVK 298

Query: 284 QKKGT------------KVSY------NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSM 325
           QKK              KV +      +++AT+G +D ++ +W+T R +P+  A   ++ 
Sbjct: 299 QKKDDDPENALVGQNDDKVHHFDKNIDSVVATAG-QDKSLAVWSTSRPRPILVAFDIANK 357

Query: 326 PINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIEQ 366
            I D+ W+ DG  LF  S DS +  F F++N+LG  + +E+
Sbjct: 358 SITDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIPLEK 398

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 565 KLIFQDFIPKYVCQCIAGESF--WCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACK 622
           K   + FIP+ +   I  +    WC  +++G++Y  + +G++ +P + LG  +  +    
Sbjct: 696 KRTIETFIPEVIICAIGSKDCKCWCLASANGSIYILSYNGQQRIPKICLGHKVIKMVTSS 755

Query: 623 QYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIRYSDDVLTRVENITMCTVTSKGV 682
           +YLL +T  G  + WDL   KL+     + P+L     + + V  R+  +  C       
Sbjct: 756 KYLLVLTERGLFFAWDLLDLKLVLRNVPILPILNGQPIHGNKV--RINKVIKCFRLDGSS 813

Query: 683 PLATLSNGDG---YIFDKDMESWLL 704
               L  GD    Y + KD+  W L
Sbjct: 814 CDLLLEVGDPKNVYKWTKDLGCWSL 838

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 152/368 (41%), Gaps = 77/368 (20%)

Query: 66  FNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVF------QCHMGSDN 119
           FN + D    A  G + LL+L  +N  ++    +  D+ + F+  +      +    S+ 
Sbjct: 79  FNKQGD--TLATAGDDGLLLLWKKNETMVKEFGVDDDEFQDFKESWAVWKRLRSGSASNA 136

Query: 120 VITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGT 179
            I D+  +     + ++ +  + + +FN++  K++  I +      N     ++ DP G 
Sbjct: 137 EIYDISWNPQGTCIAIASLD-NTVRVFNVDQGKVVGHITEH-----NHYVQGIVWDPQGE 190

Query: 180 RFTVLCSDRSM----LVYQINESGNFKLLN-------------------------TFPQY 210
                 +DRS+    ++Y+ NE    +L+N                         TF  +
Sbjct: 191 FIVSQSADRSLAICKMIYEDNEVKGLQLVNKILKSELPRRKNPGEKELDFDKSKVTFLFH 250

Query: 211 VQVHPLHYK-ITMPPQGDTLPLI--------------NSIKGSTSKDITTTVLLDANDNY 255
            +  P  ++ ++M P G  L +               N+ + + +  I T   L +N N 
Sbjct: 251 NETLPSFFRRLSMSPCGSLLCVPAGVFRNDEQTDASNNNPEYANAVYIYTRASLTSNSNK 310

Query: 256 KIKST--IVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNTKRM 313
            + S   +  P+     V+K++P +YE  ++    K  Y L+    T +  +L+++T+  
Sbjct: 311 PVFSLPFLQKPA----LVVKFNPIMYETASE--WVKAPYTLVFAVATTN-EVLVYDTQNT 363

Query: 314 KPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIEQVTLLRDQ 373
            P+  A +    PI D+ WSQDG  L   S D       F DND G        T L+DQ
Sbjct: 364 SPIAIAGNLHYTPITDLAWSQDGTLLMISSTDGFCSYIHFTDNDFG--------TPLKDQ 415

Query: 374 NKKLPILS 381
           +  +PIL+
Sbjct: 416 S--IPILT 421

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 244 TTTVLLDANDNYKIKSTIVSPSSSNTKVLK-YSPTIYEKTNQKKGTKVSYNLLATSGTED 302
           T + +L++    K +  I  PS     ++  +SP  YE T QK   K+ Y L+    T +
Sbjct: 294 TRSGILNSAGGVKNRPAIRIPSLKKPALMAAFSPVFYE-TCQKSVLKLPYKLVFAIATTN 352

Query: 303 GTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDS 346
             +L+++T  ++PL    +    PI D+ WS+DG TL   S D 
Sbjct: 353 -EVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDG 395

>Kwal_27.10385
          Length = 536

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 2/103 (1%)

Query: 271 VLKYSPTIYE-KTNQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPIND 329
           V+ ++P  Y+  T  +    + Y L+    T D  +L+++++   P+    +    PI D
Sbjct: 327 VISFNPLYYKLATKTQPYINLPYKLVFAVATSD-EVLVFDSETTSPICVIGNLHYTPITD 385

Query: 330 IVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIEQVTLLRD 372
           + WSQDGL L   S D      +F++  LG Q+    V    D
Sbjct: 386 LSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQIGESVVKTAND 428

>Scas_512.3
          Length = 534

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 7/111 (6%)

Query: 271 VLKYSPTIYEKTNQKK-GTK-----VSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSS 324
           V+ ++P  Y+ T++++ GTK     + Y L+    T +  +L+++T  +KP+    +   
Sbjct: 339 VVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAVATSN-EVLIYDTVNVKPISIIGNLHY 397

Query: 325 MPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIEQVTLLRDQNK 375
             + D+ WSQDG  L   S D        ++N  G++L+IE+     + NK
Sbjct: 398 TALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFGEKLTIEEREQYINANK 448

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 71/189 (37%), Gaps = 35/189 (18%)

Query: 163 PSLNRRPITLIIDPCGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITM 222
           PS  RR   L++ PCG          S+LV                  ++ HP    I  
Sbjct: 284 PSFFRR---LVMSPCG----------SLLVVPTG-------------LIKNHPTSTSIGT 317

Query: 223 PPQGDTLPLINSIKGSTSKDITTTVLLDANDNYKIKSTIVSPS------SSNTKVLKYSP 276
              G+     NSI  S S D    V +       IK  +  PS            + +SP
Sbjct: 318 KDDGEESSQSNSINTSASSDFNNAVFIYTR--AAIKQNLGKPSICLPFFKKPAVAVAFSP 375

Query: 277 TIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDG 336
             YE+T+ K    + Y L+    T +  ++ ++T+ ++P+    +    P+ D+ WS  G
Sbjct: 376 IFYERTSNKPYVDLPYKLVFAIATIN-QVIFYDTENIEPISIVSNLHYTPLTDLTWSPRG 434

Query: 337 LTLFAISDD 345
             +   S D
Sbjct: 435 DMVMVSSTD 443

>Scas_657.13
          Length = 411

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 298 SGTEDGTILMWNT--KRMKPLFNAMSTSSMPINDIVWSQDGLTLF-AISDDSVL 348
           SG++DGTI +WN       P++   S  S  +ND  WS   L +F ++S+DS L
Sbjct: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 271 VLKYSPTIYE-KTNQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPIND 329
           V+++SP +Y+ +T  +   ++ Y L+    T    +++++T   KP+    +    P+ D
Sbjct: 324 VVRFSPILYKIETGVEPWIQLPYKLVFAVATST-EVVIYDTVTTKPIAVVGNLHYTPLTD 382

Query: 330 IVWSQDGLTLFAISDDSVLYTFAFQDNDLGDQLSIE 365
           + WS  G  L   S D      + +D+  G+  S E
Sbjct: 383 LSWSDSGHLLVVSSTDGFCSYISMEDSLFGEPYSSE 418

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 260 TIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNT-KRMKPLFN 318
           T  SP  +  K LK     YEK  ++KG    +  L  + ++D T+ +WN  K  KP+  
Sbjct: 345 TPASPEEAQQKALKN----YEKVAKRKG---DFEELMVTASDDFTMYLWNPLKSTKPI-T 396

Query: 319 AMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDL-----GDQLSIEQVTLLRD 372
            M+     +N + +S DG  + + S D+ +  +  +D        G   S+ QV    D
Sbjct: 397 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSD 455

>YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin
           assembly complex, subunit 3, involved in both nucleosome
           assembly linked with DNA replication and negative
           regulation of the RAS pathway, has WD (WD-40) repeats
           [1269 bp, 422 aa]
          Length = 422

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 294 LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVW-SQDGLTLFAISDDSVLYTFA 352
           +LAT+G EDG + +W+T   + +F       + +NDI W + D   + ++++D+ ++ + 
Sbjct: 355 VLATAGQEDGLVKLWDTSCEETIF-THGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

Query: 353 FQDNDLG 359
              N +G
Sbjct: 414 PAGNLVG 420

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 262 VSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNT-KRMKPLFNAM 320
            SP  +  + L+     YEK  +K GT      L  +G++D T+ +WN  K  KP+   M
Sbjct: 345 ASPEDAQARALRN----YEKVAKKNGT---MEELMVTGSDDFTMYLWNPLKGSKPILR-M 396

Query: 321 STSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDL-----GDQLSIEQVTLLRD 372
           +     +N + +S DG  + + S D+ +  +  +D        G   S+ QV    D
Sbjct: 397 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSD 453

>ADR339C [2080] [Homologous to NOHBY] (1305031..1306932) [1902 bp,
           633 aa]
          Length = 633

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 332 WSQDG---LTLFAISDDSVLYTFAFQDNDLGDQLSIEQVTLLRDQNKKLPILSNLNLDKK 388
           WS  G   +  + I D +     AFQ     + L   ++ L+ DQNK   +L     D +
Sbjct: 49  WSDPGAWTVYFYGIFDHAATGIRAFQGTKSVNGL---KINLVNDQNKNFGVLFEFAEDVR 105

Query: 389 VLQSKLDACLNKSDEKTITK 408
           VL+S +    NK D   + K
Sbjct: 106 VLKSHVGISFNKDDGVEVAK 125

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 84/211 (39%), Gaps = 39/211 (18%)

Query: 139 SPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRSMLVYQINES 198
           SP+Q L+F   T              +N   +  I  P G    +   D+     + N+ 
Sbjct: 83  SPEQSLIFGTHTAG----------EEVNYLKVATINLPAG----IAGLDQGDEEDEANDH 128

Query: 199 GNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTSKDITTTVLLDANDNYKIK 258
            +F + N FP   +V    Y   MP   + +  IN  KG      T ++     +  K +
Sbjct: 129 SSFAIANKFPHIEEVIRARY---MPANSNIIATING-KG------TISIFDRTLEESKAQ 178

Query: 259 STIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFN 318
            + ++    N   L ++P I            S  LL  SG++D T+ +W+ +  K   +
Sbjct: 179 VSTLAFHKENGYGLAFNPHI------------SGELL--SGSDDTTVALWDIEAAKKPKS 224

Query: 319 AMSTSSMPINDIVWSQDGLTLFA-ISDDSVL 348
            +++    +ND+ W +    +F  +S+D  L
Sbjct: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTL 255

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 79/191 (41%), Gaps = 25/191 (13%)

Query: 142 QILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRSMLVYQINESGNF 201
           +I +FN  T +   V+D E  P   R    L + P  TR  VL +   + V   N   N+
Sbjct: 78  KIRVFNYNTGE--KVVDFEAHPDYIR---ALAVHP--TRSYVLSASDDLTVKLWNWEKNW 130

Query: 202 KLLNTFPQYVQ-VHPLHYKITMPPQGDTLPLINSIK----GSTSKDITTTVLLDANDNY- 255
            L  TF  +   V  + +    P    T  L +++K    G  + + T    L+   N+ 
Sbjct: 131 ALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFV 190

Query: 256 -----KIKSTIVSPSSSNT-KVLKYSPTIYEKTNQKKGTKVSYNL------LATSGTEDG 303
                + K  +++ S   T KV  Y       T +   + VSY +      +  SG+EDG
Sbjct: 191 DYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDG 250

Query: 304 TILMWNTKRMK 314
           T+ +WN+   K
Sbjct: 251 TVKIWNSNTYK 261

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 293 NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTF 351
           N + TSG+ D  IL  + +  +P F  + T +  +  + W+ D   L +  +D+V+Y +
Sbjct: 343 NHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVY 401

>Kwal_27.12596
          Length = 349

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 4/30 (13%)

Query: 347 VLYTFAFQDNDLGDQLSIEQVTLLRDQNKK 376
           +LYTF F    LGDQL  ++V++LRD  KK
Sbjct: 263 ILYTFLF----LGDQLPAQEVSVLRDLGKK 288

>Kwal_33.15136
          Length = 473

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 75/200 (37%), Gaps = 43/200 (21%)

Query: 116 GSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIID 175
           G+DNV T +K +Q    +  S  S + ++L++L T    N   Q+F   +  R   L  +
Sbjct: 213 GADNVST-VKFNQNETDIFASAGSDNSVVLYDLRT----NSPTQKFVQKM--RTNALCWN 265

Query: 176 PC-GTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINS 234
           P     F V   D +   Y +      + L+ F  +V        +   P GD +     
Sbjct: 266 PMEAYNFVVANEDHNAYYYDMRNLS--RALHVFKDHVSAV---MDVDFSPTGDEI----- 315

Query: 235 IKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNL 294
           + GS  K I           Y++K               +S  IY     +   +V Y +
Sbjct: 316 VTGSYDKTIRI---------YQVKHG-------------HSREIYHTKRMQHVFQVKYTM 353

Query: 295 ---LATSGTEDGTILMWNTK 311
                 SG++DG + MW  K
Sbjct: 354 DSRYIVSGSDDGNVRMWRAK 373

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 293 NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFA 352
            L   SG  D T+++W+T++ +PL+      +  +  I W  D + L A    S+     
Sbjct: 359 GLQLASGGNDNTVMIWDTRQDEPLW-VKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIH 417

Query: 353 FQDNDLGDQL 362
           F +   G ++
Sbjct: 418 FWNTTTGARI 427

>Sklu_2381.4 YPR074C, Contig c2381 6519-8436 reverse complement
          Length = 640

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 711 AYGSQ--YWDSLNNDYKNDSNTLEELKNAENKKSLINMMERKTNEELDRKGRIKHLQRF- 767
           AYG +  Y ++ N D    +  LEE K +++K +LI M+       L+      H     
Sbjct: 209 AYGWEVLYVENGNEDMDAIAKALEEAKQSKDKPTLIKMVTTIGFGSLNAGSHSVHGAPLK 268

Query: 768 ---AKTLLMKEGFENMEEIVT---LSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGY 821
               K L MK GF   E  V    +    N+  +    +   E+ +L   Y+++  ELG 
Sbjct: 269 GDDVKQLKMKFGFNPEESFVVPQEVYDFYNKTTIEPGAKANEEWNELFEQYTAKYPELGA 328

Query: 822 --IERLNDML--QWIYNDGKMGKSDLLLGQSR--ELILKDI 856
               RL+  L   W+        SD  +   +  E++L+DI
Sbjct: 329 ELKRRLSGKLPEGWLSKLPTYSPSDSAVATRKLSEMVLQDI 369

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 240 SKDITTTVLLDANDN-------YKIKSTIVSPSSSNTKVL----KYSPTIYEKTNQKKGT 288
           S D TT  +L  ND        +   S I S S   T +L    K +P + ++ +  +  
Sbjct: 250 SGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDKTWILIDTVKQAPILIQEGHSAEVF 309

Query: 289 KVSYN----LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISD 344
            +S++    L++T+G  D   L+W+ +  K +  ++   S PI  + WSQ+G  L + S 
Sbjct: 310 SLSFHNDGSLVSTAGL-DAIALIWDIRSGKNIM-SLQGHSKPIYSVDWSQNGYQLASGSG 367

Query: 345 DSVLYTF 351
           D  +  +
Sbjct: 368 DGTIKVW 374

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 293 NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFA 352
           N    S +EDGTI +W+ +   P          P+N++V   +   L +   D  +  + 
Sbjct: 87  NKWMVSSSEDGTIKVWDVR--SPSVQRNYKHDAPVNEVVIHPNQGELISCDQDGNIKIWD 144

Query: 353 FQDNDLGDQLSIEQVTLLR 371
             +N   +QL++E  T L+
Sbjct: 145 LGENQCTNQLALEDNTALQ 163

>CAGL0M05291g complement(566250..567509) similar to sp|P13712
           Saccharomyces cerevisiae YBR195c MSI1, hypothetical
           start
          Length = 419

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 294 LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWS-QDGLTLFAISDDSVL 348
           + A++G EDG + +W+    K +F       + +NDI W   D   + ++S+D+ +
Sbjct: 351 VFASAGQEDGLVKLWDASVGKEIF-VHGGHMLGVNDISWDMHDPWLMASVSNDNTI 405

>Kwal_47.17827
          Length = 523

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 268 NTKVLKYSPTIYEKTNQKKGTKVSYN----LLATSGTEDGTILMWNTKRMKPLFNAMSTS 323
           +T+  K+ P I  K +      +S+N     L  SG ++GT  +W+ ++  P  NA S S
Sbjct: 362 DTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSP-NNAASVS 420

Query: 324 SMPINDIVWSQDGLTLFAIS--DDSVLYTFAFQDN 356
             P+    + +  +T  A +  DDS++   A +DN
Sbjct: 421 --PVAQYSFHKGAITSIAFNPLDDSII-AVASEDN 452

>YPR085C (YPR085C) [5511] chr16 complement(708493..709824) Protein
           of unknown function [1332 bp, 443 aa]
          Length = 443

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 69/171 (40%), Gaps = 31/171 (18%)

Query: 298 SGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDND 357
           SG   G  +MW+    +P+ +     +  I    W +    L+ +S DS+L  F     D
Sbjct: 47  SGDNYGYFVMWDLVTKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFEL---D 103

Query: 358 LGDQLSIEQVTLLRDQNK----------KLPILSNLNLDKKVLQSKLD----------AC 397
              QLSI+ V  L   NK          ++PI + LN    ++++++            C
Sbjct: 104 SSTQLSIDLVRKLSQANKTDHLQWTKIYEMPI-NTLNFANFIIEAEVKPTKDNKSYRLVC 162

Query: 398 LNKSDEKTITKIQKEEGT----KKPSSK---RRTSLKQNLPAQSQDSMVKI 441
            +  D +TI   Q  E +    K+P +     R   +QN    S+DS   I
Sbjct: 163 CHTDDSETIDIYQIIEDSTFKLKRPFNNINFPRFLKQQNFLGISKDSKFGI 213

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 735 KNAENKKSLINMMERKTNEELDRKGRIKHLQRFAKTLL---MKEGFENMEEIVTLSHLEN 791
           KN E +  L+N++E K  EEL   GR+     F    L   M+ GF  M  +  L   + 
Sbjct: 24  KNPETRSELLNLVEGKHWEEL--HGRLDERISFGTAGLRSRMEAGFSRMNTLTVLQASQG 81

Query: 792 RILVSLKLEEFNEFKDLIIAYSSR 815
             L S    +F E   +I+ +  R
Sbjct: 82  --LASYIKSQFPENLSVIVGHDHR 103

>CAGL0M12749g 1255738..1257096 similar to sp|P40512 Saccharomyces
           cerevisiae YIL071c, hypothetical start
          Length = 452

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 712 YGSQYWDSLNNDYKNDSNTLEELKNAENKKSLINMMERKTNEELDRKGRIKHLQRFAKTL 771
           Y S   +S  ND  N+      +K+  + K L  +     N ++D K   KH+++FAK +
Sbjct: 75  YSSANDESHTNDTDNEHRDDNVMKHLLSGKYLEALALLDANSKMD-KSPFKHMEQFAKIM 133

Query: 772 LMKEGFENMEEI 783
           +    +EN++E+
Sbjct: 134 IFSRNYENVQEL 145

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 298 SGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSV 347
           +G E+G + +WN  +   L N ++    PI  + W++DG  + ++  ++V
Sbjct: 237 TGVENGELRLWN--KTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENV 284

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 297 TSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDD 345
           T+G+EDGTI++W+    K +         PI  I ++++G  L     D
Sbjct: 695 TTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGAD 743

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 60/118 (50%), Gaps = 20/118 (16%)

Query: 233 NSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSY 292
           +S+ G+ S+D  T ++ D N +  I+   VS S+ NT  L +S             K S 
Sbjct: 228 SSLFGTVSED-NTLIIHDTNSDRAIQKLSVS-SAFNT--LAFS-------------KRSE 270

Query: 293 NLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWS--QDGLTLFAISDDSVL 348
           NLLA +GT D  + +++ +R++   ++M+     +  + +S  QDGL   + SD  ++
Sbjct: 271 NLLAAAGT-DSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRII 327

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 290 VSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLY 349
            SY+ +  SG  DG + +W+T+    + N   + S  I+ + +  DG ++   SDD +  
Sbjct: 232 TSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDS-DISTVRFFSDGNSIITGSDDGIAR 290

Query: 350 TF 351
            F
Sbjct: 291 LF 292

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 292 YNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVL 348
           +N +   G  +GT+ +W+    +PL   +S    PIN +   + G  +  +S D  L
Sbjct: 232 WNAVMHLGHSNGTVTLWSPSMPEPLVKLLSGRG-PINSVAVDRSGYYMATVSQDKSL 287

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,557,907
Number of extensions: 1378045
Number of successful extensions: 5654
Number of sequences better than 10.0: 90
Number of HSP's gapped: 5828
Number of HSP's successfully gapped: 99
Length of query: 885
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 774
Effective length of database: 12,753,511
Effective search space: 9871217514
Effective search space used: 9871217514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)