Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4131831816920.0
YOR037W (CYC2)3663146524e-83
CAGL0I00990g3433326435e-82
Kwal_55.215613493066253e-79
ACR090C3663106124e-77
KLLA0E21901g3573035784e-72
Kwal_23.54713122591684e-13
KLLA0D04488g2962561561e-11
CAGL0E06424g2982191444e-10
ACR054C3062201355e-09
Scas_678.62992591285e-08
AFR439C3101681162e-06
CAGL0B02519g3121881152e-06
Kwal_47.181592871951142e-06
YKL150W (MCR1)3022221124e-06
Scas_692.63141871072e-05
Sklu_2184.23101971053e-05
YIL043C (CBR1)3221961045e-05
KLLA0F27621g2811111001e-04
Sklu_2260.23501171011e-04
ADL087W287198973e-04
Scas_704.4331693973e-04
KLLA0C16918g31086973e-04
YML087C312245956e-04
Kwal_33.1426030892880.004
YML125C31286850.010
CAGL0L00847g285199750.19
YOR384W (FRE5)694204710.65
Scas_657.678777710.66
Scas_594.9220124661.7
YPR070W (MED1)56647644.9
YDR284C (DPP1)289179627.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.41
         (318 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.41                                                           656   0.0  
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   255   4e-83
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   252   5e-82
Kwal_55.21561                                                         245   3e-79
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   240   4e-77
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   227   4e-72
Kwal_23.5471                                                           69   4e-13
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    65   1e-11
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    60   4e-10
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...    57   5e-09
Scas_678.6                                                             54   5e-08
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    49   2e-06
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    49   2e-06
Kwal_47.18159                                                          49   2e-06
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...    48   4e-06
Scas_692.6                                                             46   2e-05
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         45   3e-05
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    45   5e-05
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    43   1e-04
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            44   1e-04
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    42   3e-04
Scas_704.43                                                            42   3e-04
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...    42   3e-04
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    41   6e-04
Kwal_33.14260                                                          39   0.004
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...    37   0.010
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...    33   0.19 
YOR384W (FRE5) [5157] chr15 (1061560..1063644) Protein with simi...    32   0.65 
Scas_657.6                                                             32   0.66 
Scas_594.9                                                             30   1.7  
YPR070W (MED1) [5498] chr16 (685893..687593) Component of RNA po...    29   4.9  
YDR284C (DPP1) [1113] chr4 complement(1030542..1031411) Diacylgl...    28   7.0  

>Scas_699.41
          Length = 318

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MVARIPLFQLKSRILRYSIPTLVTVTGAVIVWKSLGIRTPSRTELSPTHFTPYKISYRQD 60
           MVARIPLFQLKSRILRYSIPTLVTVTGAVIVWKSLGIRTPSRTELSPTHFTPYKISYRQD
Sbjct: 1   MVARIPLFQLKSRILRYSIPTLVTVTGAVIVWKSLGIRTPSRTELSPTHFTPYKISYRQD 60

Query: 61  IDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLI 120
           IDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLI
Sbjct: 61  IDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLI 120

Query: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180
           PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF
Sbjct: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180

Query: 181 TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFF 240
           TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFF
Sbjct: 181 TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFF 240

Query: 241 ESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPV 300
           ESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPV
Sbjct: 241 ESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPV 300

Query: 301 GGILKQNGWPRENVFKFL 318
           GGILKQNGWPRENVFKFL
Sbjct: 301 GGILKQNGWPRENVFKFL 318

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  255 bits (652), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 195/314 (62%), Gaps = 41/314 (13%)

Query: 41  SRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIM 100
           ++ ELSP++F  YKIS+++DID+SH+LLE+TP   QK NIW  +    +WSVEIKQPE+M
Sbjct: 56  NKHELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVM 115

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTD-KNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIR 159
           VVRNYTP+PL F     ++  + D  N  GKL FY+K+Y NGEVARWLH LP    +EIR
Sbjct: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175

Query: 160 GPFIDYKFQE------------------------TDNTKF-----DVSMFTAGAGVVTAF 190
           GPFIDY+F                           +N++F     D+ MFTAG G+VTA 
Sbjct: 176 GPFIDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTAL 235

Query: 191 QLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESE---KGDD 247
           QLLL+ S    FRG+++LFH+  ++ +LGPL  I+  LQ  N  + +K FE++   K D 
Sbjct: 236 QLLLTESP---FRGTIKLFHTDKNIKQLGPLYPILLRLQASNR-VQLKIFETDRQTKQDV 291

Query: 248 IRTQLKSVSQLFPQ---FKPSQLGRSNLRQ-LALVCGPEGFIDTVAGASVDLEQGPVGGI 303
           +++  KS+++ +P       S +   N+   LALVCGPE +I +++G   DL QGPVGG+
Sbjct: 292 LKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGL 351

Query: 304 LKQNGWPRENVFKF 317
           L + GW  +NV+K 
Sbjct: 352 LSKEGWNSDNVYKL 365

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  252 bits (643), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 146/332 (43%), Positives = 199/332 (59%), Gaps = 40/332 (12%)

Query: 11  KSRILRYSIPTLVTVTGAVIVW------KSLGIRTPSRT-ELSPTHFTPYKISYRQDIDA 63
           K  I+ YSI   +    A + W      K   + T ++T ELSP  FT YKI+ R DID 
Sbjct: 26  KRSIIGYSI---ILSASAFVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDIDN 82

Query: 64  SHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLIPMT 123
            HYL+ELTP   Q  N+W+++ RN++WS+E+KQPEIMVVRNYTP+PL  ++ + +++P+ 
Sbjct: 83  CHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVRNYTPLPLQ-LKSNGNIVPL- 140

Query: 124 DKND---TGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQE----------- 169
           D ND   + KL+FY+K Y+NGEVARW+  LPV ST+E+RGPFIDYKF+            
Sbjct: 141 DLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANG 200

Query: 170 ---TDNTKF-DVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIM 225
               + T+  +V  F  G G+VTA Q +L+P  +  F  ++ LFHSC S+ ELG L  ++
Sbjct: 201 STLINKTQLSNVPFFAGGTGIVTALQPILNPYGQ--FNYNMTLFHSCKSIQELGCLYHLV 258

Query: 226 FSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFI 285
             L   N  I    FE+ KGD+I        QL P    S  G  NL   ++VCGPEG+I
Sbjct: 259 NGLAQQN-KITYHLFETSKGDNI----IDFKQLIPGPNTSNAG--NL-DTSIVCGPEGYI 310

Query: 286 DTVAGASVDLEQGPVGGILKQNGWPRENVFKF 317
            TVAGA  D  QGP+ G+L + GW   NV+K 
Sbjct: 311 TTVAGAKYDTSQGPIEGLLGEKGWDNSNVYKM 342

>Kwal_55.21561
          Length = 349

 Score =  245 bits (625), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 176/306 (57%), Gaps = 35/306 (11%)

Query: 41  SRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIM 100
           S  ELS  +FT Y+ISY Q ID+ H++LELTP  PQ TN+W  +  + +WSV++KQPEIM
Sbjct: 49  SNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIM 108

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           VVRNYTP+PL  V      +     N  GKL FYLK+Y  GEVARWL RLP    +E+RG
Sbjct: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168

Query: 161 PFIDYKFQETDNTK---------------------FDVSMFTAGAGVVTAFQLLLSPSSK 199
           P+IDY+F   DN +                     FD+S FTAG G+    QLLL   ++
Sbjct: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLL---TE 225

Query: 200 NDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLF 259
             FRG + LFHSC   +ELGPL  I+  L+ +N  +++ FFES KG DIR     V  L 
Sbjct: 226 FPFRGRIHLFHSCRQKSELGPLGPILDVLRENNR-VELNFFESSKGRDIRQISNEVLNLI 284

Query: 260 PQFKPSQLGRSNLRQ--------LALVCGPEGFIDTVAGASVDLEQGPVGGILKQNGWPR 311
               PSQ  +             L+L+CGP+ +I T++G   D  QGP+ G+L Q GW  
Sbjct: 285 D--SPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSN 342

Query: 312 ENVFKF 317
           +NVFK 
Sbjct: 343 QNVFKL 348

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  240 bits (612), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 181/310 (58%), Gaps = 35/310 (11%)

Query: 38  RTPSRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQP 97
           R     ELS  +FT YKISYR+DID  HYLLELTP   Q+ NIW       +W+VEIKQP
Sbjct: 61  RRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQP 120

Query: 98  EIMVVRNYTPVPLSFVQDHNDLIPMTD-KNDTGKLVFYLKQYSNGEVARWLHRLPVNSTV 156
           EIMVVR YTP+PL   +D   L  + D  N  GKL+ Y+K+Y +GEVARWL +LP    V
Sbjct: 121 EIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIV 180

Query: 157 EIRGPFIDYKFQETD-NTK---------------------FDVSMFTAGAGVVTAFQLLL 194
           E+RGP+ +++F E D +TK                     FD+++F AG G+VTA QLL 
Sbjct: 181 EVRGPYPEFEFPELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTGIVTALQLL- 239

Query: 195 SPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSL-QHDNGPIDMKFFESEKGDDIRTQLK 253
             ++++ F+G ++LF+SC S  +LGPL  ++    QHD   +D+  FESEKG+ +R  L 
Sbjct: 240 --TTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDR--VDLHVFESEKGESLRLGLS 295

Query: 254 SVSQL------FPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPVGGILKQN 307
            +S L      F +  P +        L+LVCGP+ +I  +AG    L QGPV G+L   
Sbjct: 296 KISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTK 355

Query: 308 GWPRENVFKF 317
           GW   NV+K 
Sbjct: 356 GWDNSNVYKL 365

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  227 bits (578), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 173/303 (57%), Gaps = 34/303 (11%)

Query: 44  ELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVR 103
           ELS  +F+ YKIS +  ID  HYL+ELTP   QK N+W+++  + +WSVE+KQPEIMVVR
Sbjct: 59  ELSRDYFSKYKISKKYSIDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVR 118

Query: 104 NYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFI 163
           +YTP+PL+  ++    +   ++N +G L FY+KQY  GEVARW++ LP+   +E+RGPF+
Sbjct: 119 SYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFV 178

Query: 164 DYKFQET-------------------DNTK---FDVSMFTAGAGVVTAFQLLLSPSSKND 201
           +Y+F +T                   DN K   FD+  FT G G+V   Q+ L+ S    
Sbjct: 179 EYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESP--- 235

Query: 202 FRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQ 261
           FRG +  +HSC SL ELGPL  I+  LQ DN  I++   ES +   I  Q     +  P 
Sbjct: 236 FRGKIGAYHSCKSLTELGPLNSILTKLQ-DNDRIELHTHESNR-ISIPLQSDPAMEGIPS 293

Query: 262 FKP-------SQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPVGGILKQNGWPRENV 314
             P       + L       L+LVCGP GFI TV+G   DL QGP+ GIL   GW   NV
Sbjct: 294 PYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDNSNV 353

Query: 315 FKF 317
           +K 
Sbjct: 354 YKL 356

>Kwal_23.5471
          Length = 312

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 120/259 (46%), Gaps = 24/259 (9%)

Query: 62  DASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPE-IMVVRNYTPVPLSFVQDHNDLI 120
           D SH       S PQ+  +   I  + + + +++ P+   V+R YTPV            
Sbjct: 75  DVSHDTRRFVFSLPQEDQVSGLITASALLA-KLQTPKGSNVIRPYTPV------------ 121

Query: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180
             +D +  G + F +K Y  G++   L     + TV  +GP I ++++   N+   +++ 
Sbjct: 122 --SDVSTKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKP--NSFDSITLI 177

Query: 181 TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGP-IDMKF 239
            AG+G+   +QLL   S   + +  + L +   + N++  LKK +  +Q      + + F
Sbjct: 178 GAGSGITPLYQLLHHISQNPEDKTKIHLLYGNKTPNDI-LLKKELEEVQAKYADQVKIHF 236

Query: 240 FESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVD-LEQG 298
           F  +       ++  +++   +F    + +++ +    VCGP  F+   +G  V   +QG
Sbjct: 237 FVDKAEGPFDGEIGFITK---EFLEKNVPKASEKNQVFVCGPPPFMQAYSGPKVSPKDQG 293

Query: 299 PVGGILKQNGWPRENVFKF 317
            + GILK  G+ +E VFKF
Sbjct: 294 ELTGILKDLGFSKEQVFKF 312

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 111/256 (43%), Gaps = 22/256 (8%)

Query: 64  SHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLIPMT 123
           SH     T + P+K  +   I  + I +  +      V+R YTPV              +
Sbjct: 61  SHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPYTPV--------------S 106

Query: 124 DKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMFTAG 183
           D    GK+   +K Y NG+    L  L  N TV  +GP   ++++   N+   +++  AG
Sbjct: 107 DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKP--NSYDSITLLGAG 164

Query: 184 AGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDN-GPIDMKFFES 242
            G+   +QL+   +   +    + L++   +  ++  LK  + +LQ      + + +F  
Sbjct: 165 TGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDI-LLKSELDNLQKKYPDQVKITYFVD 223

Query: 243 EKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVD-LEQGPVG 301
           +   +   +   +++    +   Q  + + +    VCGP  F+   +G  V   +QG + 
Sbjct: 224 KAEGNFEGETGFITK---DYLSHQAPKPSEKNQVFVCGPPPFMKAYSGPKVSPQDQGELT 280

Query: 302 GILKQNGWPRENVFKF 317
           GIL + G+ + NVFKF
Sbjct: 281 GILAELGYSKSNVFKF 296

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 100/219 (45%), Gaps = 21/219 (9%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           V+R YTPV              +D ++ G + F +K Y  G++   L +L    T+  +G
Sbjct: 99  VIRPYTPV--------------SDLSEKGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQG 144

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220
           P    K+Q   N+   +++   G G+   +QL+   +   + +  + LF+   + +++  
Sbjct: 145 PIP--KWQWKPNSFDTITLLGGGTGITPLYQLVHHITQNKEDKTKINLFYGSKTPSDI-L 201

Query: 221 LKKIMFSLQHDN-GPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVC 279
           LKK +  LQ      +++++F  +  DD      +   +   F          +    VC
Sbjct: 202 LKKELDDLQKKYPEQLNIQYFVDK--DDTGKFDGNKGFITKDFLAKNAPGPKEKTQVFVC 259

Query: 280 GPEGFIDTVAGASVD-LEQGPVGGILKQNGWPRENVFKF 317
           GP  F+D+++G     +EQG + G LK  G+ ++ VFKF
Sbjct: 260 GPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQDQVFKF 298

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 95/220 (43%), Gaps = 24/220 (10%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           V+R YTPV              +D    G     +K Y  G+    L  L  N TVE +G
Sbjct: 108 VIRPYTPV--------------SDNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKG 153

Query: 161 PFIDYKFQETDNTKFD-VSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELG 219
           P   +++   D   FD + +  AG G+   FQ++   +        V L +   +  ++ 
Sbjct: 154 PIQKWRW---DPNMFDSIVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNKTPQDIL 210

Query: 220 PLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLF-PQFKPSQLGRSNLRQLALV 278
             K++          + + +F  +   D + +   +++ F  Q  P+    S++     V
Sbjct: 211 LRKELEELASKYPDQVKVTYFVDKPEGDYKGEKGFITKDFLKQNLPTPGSNSHI----FV 266

Query: 279 CGPEGFIDTVAGASVD-LEQGPVGGILKQNGWPRENVFKF 317
           CGP  F+D  +G  V   +QG V G+L + G+ +++V+KF
Sbjct: 267 CGPPPFMDAFSGNKVSPSDQGQVTGVLSELGYTKDHVYKF 306

>Scas_678.6
          Length = 299

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 112/259 (43%), Gaps = 22/259 (8%)

Query: 62  DASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPV-PLSFVQDHNDLI 120
           D SH     T   P +  I      + I++  +      VVR YTPV PL          
Sbjct: 60  DESHDTKRFTFKLPSEDAITGLTLASAIFTKYVTAKGNNVVRPYTPVSPL---------- 109

Query: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180
              D+  T +LV  +K Y++G+++  L  L  N  V  +GP    K+Q   N+   +++ 
Sbjct: 110 ---DQQGTFELV--IKHYNDGKMSSHLFSLKPNDVVSFKGPI--KKWQWVPNSFKSITLL 162

Query: 181 TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKF- 239
            AG G    +QL    +   + +  + +F+   + +++  LKK    LQ +  P  +K  
Sbjct: 163 GAGTGTTPLYQLASHIARNPEDKTKINVFYGNKTSSDI-LLKKEWNELQ-EKYPDQVKVT 220

Query: 240 FESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVD-LEQG 298
           +  +K DD +     +  +  +F               +CGP  F+   +G      +QG
Sbjct: 221 YFVDKLDDGKENGVELGFISKEFIAKNAPGPKEDTHLFICGPPPFMKAYSGEKAKPTDQG 280

Query: 299 PVGGILKQNGWPRENVFKF 317
            + G+L++ G+ ++ VFKF
Sbjct: 281 ELTGLLQELGYSKDQVFKF 299

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 70/168 (41%), Gaps = 23/168 (13%)

Query: 28  AVIVWKSLGIRTPSRTELSPTHFTPYKISYRQDI--DASHYLLELTPSNPQKTNIWEQIP 85
           A+ V   L +   SRT + P  +TP ++  R  +  +A+ Y  +L  S          IP
Sbjct: 48  AMFVGARLLLAYRSRTSILPNEWTPLELEERIVLSKNAAIYRFKLRSSVETL-----DIP 102

Query: 86  RNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVAR 145
                + ++    +  VR YTP+   F + H D+I              +K Y +G+V++
Sbjct: 103 TGFHLAAKVMLDGVEEVRYYTPISNKFAEGHFDII--------------VKSYVDGKVSK 148

Query: 146 WLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL 193
           W   L    TVE +GP    +F    N    + M T G+ +     +L
Sbjct: 149 WFAGLQPGQTVEFKGPV--GRFSYVTNAYKKIGMVTGGSAITPMLSVL 194

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 79/188 (42%), Gaps = 22/188 (11%)

Query: 102 VRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGP 161
           VRNY P+   F + H DL+              +K Y +G+V+++   +    TV+ RGP
Sbjct: 121 VRNYNPISTRFEKGHIDLL--------------VKSYKDGKVSKYFASMKPGETVDFRGP 166

Query: 162 FIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPL 221
                ++   NT  ++ M   G+G+  A Q+L    +  +    + L + C    +   L
Sbjct: 167 VGSLVYKP--NTYKNIGMVCGGSGITPALQMLNDIITVPEDLTKLSLIY-CNETEKDILL 223

Query: 222 KKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVS-QLFPQFKPSQLGRSNLRQLALVCG 280
           K+ +  +       ++ +  S+       ++  +S +   +  P     S L    L+CG
Sbjct: 224 KEELDEMAEKYPHFNVHYIVSQPTGQWEGEVGHISKETMVKHLPHPADDSRL----LICG 279

Query: 281 PEGFIDTV 288
           PEGF   V
Sbjct: 280 PEGFTQKV 287

>Kwal_47.18159
          Length = 287

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 79/195 (40%), Gaps = 17/195 (8%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           ++R+YTP  L             D +  G     +K Y  G V++ +  L +   +++RG
Sbjct: 92  IMRSYTPTSL-------------DSDSVGFFELLIKSYEQGNVSKMIGELQIGDKIKVRG 138

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220
           P   Y +  T N   ++ M   G G+   +Q++ S  S    R  V + +   + +++  
Sbjct: 139 PKGFYTY--TPNMNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRTKVSIIYGSQTEDDILL 196

Query: 221 LKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCG 280
            K+I   ++ +     + +   +   D  T    V  +  +     L  +      LVCG
Sbjct: 197 KKEIDAIVESNPDQFKVHYLLDKPARDTWT--GGVGYVTAEVMKEHLPAAGDGVQLLVCG 254

Query: 281 PEGFIDTVAGASVDL 295
           P G + ++   +V L
Sbjct: 255 PPGMVSSIKRNAVAL 269

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 26/222 (11%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           VVR YTPV              +D +  G     +K Y  G++   L  L  N TV  +G
Sbjct: 102 VVRPYTPV--------------SDLSQKGHFQLVVKHYEGGKMTSHLFGLKPNDTVSFKG 147

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220
           P + +K+Q   N    +++  AG G+   +QL        + +  V L +   +  ++  
Sbjct: 148 PIMKWKWQP--NQFKSITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNKTPQDI-L 204

Query: 221 LKKIMFSLQH---DNGPIDMKFFESEKGDDIRTQLKSVSQLFPQ-FKPSQLGRSNLRQLA 276
           L+K + +L+    D   +     + +   D   ++  +S+ F Q   P     ++L    
Sbjct: 205 LRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKDFIQEHVPGPKESTHL---- 260

Query: 277 LVCGPEGFIDTVAGASVD-LEQGPVGGILKQNGWPRENVFKF 317
            VCGP  F++  +G      +QG + GIL   G+ ++ VFKF
Sbjct: 261 FVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKDQVFKF 302

>Scas_692.6
          Length = 314

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 80/187 (42%), Gaps = 30/187 (16%)

Query: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180
           P++ K DTG     +K Y++G+V+++   L    TVE +GP  +  +    N+   + + 
Sbjct: 128 PISSKLDTGHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHY--APNSSKALGIV 185

Query: 181 TAGAGVVTAFQLL------------LSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSL 228
             G+G+    Q+L            LS    ND    + L      ++E  P  ++ + +
Sbjct: 186 AGGSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYPHFEVHYVV 245

Query: 229 QHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTV 288
           ++ +        ES +GD      + + +  P++       S+  +L L+CGPE     V
Sbjct: 246 RNPS--------ESWEGDVGLVSKEQMEKYLPKY-------SDDHRL-LICGPEAMEKMV 289

Query: 289 AGASVDL 295
              + +L
Sbjct: 290 VKYAEEL 296

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 78/197 (39%), Gaps = 30/197 (15%)

Query: 121 PMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMF 180
           P+T + DTG     +K Y++G+V+++   L     VE +GP    +F    N+   + M 
Sbjct: 124 PITQRYDTGHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPV--GRFNYATNSSKAIGMI 181

Query: 181 TAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFF 240
             G+G+    Q+L    +  +    V L ++  + N++  L K       D  P     +
Sbjct: 182 AGGSGITPMLQVLSQIVTTPEDTTKVSLIYANETENDI--LLKDELDEMADKYPNFEVHY 239

Query: 241 ESEK------GDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVD 294
              K      GD        + +  P       G S+  +L L+CGP   I+ +   S +
Sbjct: 240 VLHKPSPGWTGDTGYVTKDQMQKYLP-------GPSDENRL-LICGPLAMINMLLNYSEE 291

Query: 295 LEQGPVGGILKQNGWPR 311
           L            GWPR
Sbjct: 292 L------------GWPR 296

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 77/196 (39%), Gaps = 18/196 (9%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           + R+YTP  L             D +  G     +K Y  G V++ +  L +  +++I+G
Sbjct: 126 ITRSYTPTSL-------------DGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKG 172

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220
           P  +Y ++   N +  + M   G G+   +Q++ + +   D   + ++    G+++E   
Sbjct: 173 PRGNYHYER--NCRSHLGMIAGGTGIAPMYQIMKAIAM--DPHDTTKVSLVFGNVHEEDI 228

Query: 221 LKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLA-LVC 279
           L K          P   K        D       V  +        L  + +  +  L+C
Sbjct: 229 LLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILIC 288

Query: 280 GPEGFIDTVAGASVDL 295
           GP   + +V  ++VDL
Sbjct: 289 GPPAMVASVRRSTVDL 304

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           ++R+YTP  L             D +  G     +K Y  G +++   +L +   +++RG
Sbjct: 87  ILRSYTPTSL-------------DSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRG 133

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHS 211
           P   Y +Q   N   ++ M   G G+   +Q++ S  + +  +  V L + 
Sbjct: 134 PKGFYHYQPNMNE--EIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYG 182

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 53/117 (45%), Gaps = 17/117 (14%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           +VR+YTP  L             D + TG     +K Y  G +++ +  L +   +++RG
Sbjct: 91  IVRSYTPTSL-------------DSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRG 137

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNE 217
           P   Y +  T N    ++M   G G+   +Q++ + S     +  V L +  G+++E
Sbjct: 138 PKGFYTY--TANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVY--GNVSE 190

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 83/198 (41%), Gaps = 22/198 (11%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           ++R+YTP  L             D + TG     +K Y  G +++ L  L +   +++RG
Sbjct: 91  MLRSYTPTSL-------------DSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRG 137

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNE--L 218
           P   Y ++   N   ++ M   G G+   +Q++ +  S    +  V L +   + ++  L
Sbjct: 138 PKGFYHYEP--NMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILL 195

Query: 219 GPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQ-LFPQFKPSQLGRSNLRQLAL 277
            P    M + + D   I     +  +G+    +L  +++ +  +  P+    + L    L
Sbjct: 196 KPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHLPAPSSSAQL----L 251

Query: 278 VCGPEGFIDTVAGASVDL 295
           +CGP   + +    +V L
Sbjct: 252 LCGPPPMVSSAKRIAVSL 269

>Scas_704.43
          Length = 316

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 15/93 (16%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           ++R+YTP  L             D    G     +K Y NG +++++  L +   + + G
Sbjct: 120 IMRSYTPTSL-------------DSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCG 166

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL 193
           P  +Y ++   N +  + M   G G+   FQ++
Sbjct: 167 PAGNYHYEP--NCRNKLGMIAGGTGIAPMFQIM 197

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 108 VPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKF 167
           +PL    +     P+++K +TG     +K Y++G+V+++   L    TV+ +GP   + +
Sbjct: 111 IPLEDKDEIRYYTPISNKFETGHFDIMVKSYADGQVSKYFASLRPGQTVDFKGPVGRFAY 170

Query: 168 QETDNTKFDVSMFTAGAGVVTAFQLL 193
           +   N+   + M   G+G+    Q+L
Sbjct: 171 EA--NSSKHIGMIAGGSGLTPMLQVL 194

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/245 (20%), Positives = 96/245 (39%), Gaps = 46/245 (18%)

Query: 83  QIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGE 142
            IP     +V +      +VR YTPV +   + H +L+              +K Y +G 
Sbjct: 102 HIPMGYHLAVRVTINGERLVRYYTPVNVPNTEGHLELV--------------VKTYKHGV 147

Query: 143 VARWLHRLPVNSTVEIRGPFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL--------- 193
           V+++  +L +   VE +GP  + ++ +  +T  ++ +   G+G+    Q+L         
Sbjct: 148 VSKYFDKLKIRQYVEFKGPLGELEYDQ--DTATELGIIAGGSGITPVLQVLQEIIPSPED 205

Query: 194 ---LSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRT 250
              +S    N+    + +      + +  P  K+ + +   NG  +        GD    
Sbjct: 206 LTHISLIYANETEDDILMKSQLDHMAKEYPHFKVHYVIHKPNGKWN--------GDVGYV 257

Query: 251 QLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPVGGILKQNGWP 310
            L+ + +  P  K ++  R       L+CGP    + V   + +L  G   G  K NG  
Sbjct: 258 TLEEMKRYLP--KQAEDHR------LLICGPPKMNEMVLNYAKEL--GWSNGFHKGNGTD 307

Query: 311 RENVF 315
           +  VF
Sbjct: 308 KVFVF 312

>Kwal_33.14260
          Length = 308

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 16/92 (17%)

Query: 102 VRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGP 161
           +R YTPV   +   + D+I              +K Y++G+V+++   L   S V+ +GP
Sbjct: 117 IRYYTPVSPQYQPGYFDII--------------VKSYADGQVSKYFAGLKAGSAVDFKGP 162

Query: 162 FIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL 193
               +F    N+   + M   G+G+    Q+L
Sbjct: 163 V--GRFNYVVNSYKQIGMIAGGSGITPMLQIL 192

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 108 VPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKF 167
           VP+   Q+     P++ K ++G L   +K Y +G+V+++   L    TV+ +GP     +
Sbjct: 113 VPIDGKQEVRYYNPISSKLESGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNY 172

Query: 168 QETDNTKFDVSMFTAGAGVVTAFQLL 193
           +   N+   + +   G+G+    Q+L
Sbjct: 173 EP--NSSKHLGIVAGGSGITPVLQIL 196

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 76/199 (38%), Gaps = 25/199 (12%)

Query: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160
           V R+YTP  L             D+   G     +K Y  G +++ +  + +   + I G
Sbjct: 90  VSRSYTPTSL-------------DEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISG 136

Query: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220
           P   Y++    N    ++M   G G+   FQ++ + +     +  V L +  G++ E   
Sbjct: 137 PRGFYEY--VPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLY--GNVLEEDI 192

Query: 221 LKKIMFSLQHDNGPIDMK---FFESEKGDDIRTQLKSVS-QLFPQFKPSQLGRSNLRQLA 276
           L K          P   K     +  + DD    +  V+  L  +  PS      L    
Sbjct: 193 LLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQL---- 248

Query: 277 LVCGPEGFIDTVAGASVDL 295
           LVCGP G + +V   +V L
Sbjct: 249 LVCGPPGMVSSVKRNAVAL 267

>YOR384W (FRE5) [5157] chr15 (1061560..1063644) Protein with
           similarity to Fre2p, subject to regulation by iron [2085
           bp, 694 aa]
          Length = 694

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 83/204 (40%), Gaps = 44/204 (21%)

Query: 111 SFVQDHNDLIPMTDKND-TGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQE 169
           S V+D   ++ +T KN  T KL  YL +       R          V   GP+     Q 
Sbjct: 480 SLVEDGELVVVITVKNGLTKKLQEYLLESEGYTEMR----------VLAEGPY----GQS 525

Query: 170 TDNTKFDVSMFTAG-AGVVTAFQLLLSPSSK---NDFRGSVRLFHSCGSLNELGPLKKIM 225
           T    F+  +F AG AGV     + +    +   ND    ++   S  +L+ L   +K +
Sbjct: 526 TRTHLFESLLFIAGGAGVPGPLSMAIKAGRQVKSNDSHQMIKFVWSVRNLDLLEVYRKEI 585

Query: 226 FSLQHDNGPIDMK-FFESEKGDDIRTQLKSVS------QLFPQFKPSQL----GRSNLRQ 274
             L+  N  ID K +F  E+ D+  T+  +++      +L    K +++    GR N+ +
Sbjct: 586 MVLKELN--IDTKIYFTGERKDESNTEEGAIANMSTEGRLLTTSKSAEMITDFGRPNIDE 643

Query: 275 ------------LALVCGPEGFID 286
                       L   CG EGF+D
Sbjct: 644 IIEEAVSGAKSLLVTCCGSEGFVD 667

>Scas_657.6
          Length = 787

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 65  HYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPL-----SFVQDHNDL 119
           H++L L   +    N WEQI  N    +++   +I+V R  T   L     SF+ D+ND 
Sbjct: 264 HHMLPLEGWSMYAENCWEQIEHNK--DLDLPTQQILVARFKTEEILNEAFNSFMIDYNDS 321

Query: 120 IPMTDKNDTGKLVFYLK 136
           I +   ND  KL+ +L+
Sbjct: 322 ISVV-INDKTKLITFLQ 337

>Scas_594.9
          Length = 220

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 50/124 (40%), Gaps = 12/124 (9%)

Query: 142 EVARWLHRLPVNSTVEIRGPFIDYKFQET-DNTKFD-VSMFTAGAGV----VTAFQLLLS 195
           ++  WL + P+N + E+    I Y      +N  FD +  F+ GAGV    VT F  LL 
Sbjct: 64  KILAWLKKDPINDSYELPDTTIKYLHDYVLENGPFDGIVGFSQGAGVAGYLVTDFNRLLG 123

Query: 196 PSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSV 255
            S   D +  ++ F S          K   F  Q+D  PI +         D  T+   V
Sbjct: 124 LSI--DEQPPLKFFMSFAGFR----FKPECFQAQYDMHPISIPSLHVYGDLDTITEPAKV 177

Query: 256 SQLF 259
             LF
Sbjct: 178 ESLF 181

>YPR070W (MED1) [5498] chr16 (685893..687593) Component of RNA
           polymerase II holoenzyme and mediator subcomplex [1701
           bp, 566 aa]
          Length = 566

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 244 KGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFIDTVAG 290
           +GD     L S+ +LF  +KP  +   N+ +L    G E F + ++ 
Sbjct: 3   EGDSYVETLDSMIELFKDYKPGSITLENITRLCQTLGLESFTEELSN 49

>YDR284C (DPP1) [1113] chr4 complement(1030542..1031411)
           Diacylglycerol pyrophosphate phosphatase [870 bp, 289
           aa]
          Length = 289

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 71/179 (39%), Gaps = 27/179 (15%)

Query: 53  YKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSF 112
           Y + Y+Q  +   Y+ +LT S+P  T   E++  N+++      P + ++     +  S 
Sbjct: 33  YPVYYQQPFERQFYINDLTISHPYATT--ERVNNNMLFVYSFVVPSLTIL-----IIGSI 85

Query: 113 VQDHNDLIPMTDKNDTG-KLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQETD 171
           + D   LI +   +  G  L ++   +    +  W+ RL        R  F+D + Q  +
Sbjct: 86  LADRRHLIFILYTSLLGLSLAWFSTSFFTNFIKNWIGRL--------RPDFLD-RCQPVE 136

Query: 172 NTKFDVSMFTAGAGVVT--------AFQLLLSPSSKNDFRGSVRL-FHSCGSLNELGPL 221
               D ++FTA     T         F+   S  S   F G   L F  CG L    PL
Sbjct: 137 GLPLD-TLFTAKDVCTTKNHERLLDGFRTTPSGHSSESFAGLGYLYFWLCGQLLTESPL 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,855,426
Number of extensions: 483091
Number of successful extensions: 1133
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1096
Number of HSP's successfully gapped: 37
Length of query: 318
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 216
Effective length of database: 13,065,073
Effective search space: 2822055768
Effective search space used: 2822055768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)