Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4031131115330.0
YOR036W (PEP12)2882936775e-88
Sklu_1710.22792706652e-86
CAGL0I01012g2822856611e-85
Kwal_55.215572712635843e-74
KLLA0E21857g2752535366e-67
ACR092C2742555296e-66
KLLA0C13233g2621061682e-13
YOL018C (TLG2)397891508e-11
Scas_607.2417921501e-10
CAGL0G08932g3671071436e-10
Sklu_2256.2377901428e-10
CAGL0G04807g245871409e-10
YOR106W (VAM3)283951373e-09
AFL232W301921373e-09
Kwal_34.16287362891349e-09
Kwal_26.8414260771292e-08
Sklu_2407.11276841293e-08
Scas_697.44281701284e-08
KLLA0A10681g364781285e-08
Sklu_2338.5307981205e-07
Kwal_26.7532303891134e-06
AFR210C329931107e-06
Scas_721.106377571021e-04
AEL026C349691001e-04
YLR026C (SED5)34057992e-04
CAGL0D01914g33557992e-04
KLLA0F17798g31793973e-04
Scas_720.3231084850.011
CAGL0L00561g264110820.023
YMR183C (SSO2)29589770.10
Sklu_2436.1621166710.45
CAGL0E06160g28275700.79
Kwal_55.21786327101691.1
KLLA0F12166g152860701.1
Kwal_27.10255329109681.4
Scas_333.329882662.2
KLLA0F07777g26080652.8
KLLA0C03740g29859643.7
ABR006W9786604.1
Scas_717.78285105635.9
Kwal_56.2425928871619.2
CAGL0K06501g22567609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.40
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.40                                                           595   0.0  
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   265   5e-88
Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         260   2e-86
CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   259   1e-85
Kwal_55.21557                                                         229   3e-74
KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   211   6e-67
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   208   6e-66
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    69   2e-13
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    62   8e-11
Scas_607.2                                                             62   1e-10
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    60   6e-10
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         59   8e-10
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    59   9e-10
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    57   3e-09
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    57   3e-09
Kwal_34.16287                                                          56   9e-09
Kwal_26.8414                                                           54   2e-08
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      54   3e-08
Scas_697.44                                                            54   4e-08
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    54   5e-08
Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement         51   5e-07
Kwal_26.7532                                                           48   4e-06
AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH] (811271..81...    47   7e-06
Scas_721.106                                                           44   1e-04
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    43   1e-04
YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin ...    43   2e-04
CAGL0D01914g 201005..202012 highly similar to sp|Q01590 Saccharo...    43   2e-04
KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces...    42   3e-04
Scas_720.32                                                            37   0.011
CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces cer...    36   0.023
YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin ...    34   0.10 
Sklu_2436.16 YDR468C, Contig c2436 36704-37339 reverse complement      32   0.45 
CAGL0E06160g complement(619255..620103) highly similar to sp|P32...    32   0.79 
Kwal_55.21786                                                          31   1.1  
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    32   1.1  
Kwal_27.10255                                                          31   1.4  
Scas_333.3                                                             30   2.2  
KLLA0F07777g complement(733753..734535) some similarities with s...    30   2.8  
KLLA0C03740g 341104..342000 similar to sgd|S0005453 Saccharomyce...    29   3.7  
ABR006W [597] [Homologous to ScYKL006C-A (SFT1) - SH] complement...    28   4.1  
Scas_717.78                                                            29   5.9  
Kwal_56.24259                                                          28   9.2  
CAGL0K06501g complement(639611..640288) similar to tr|Q03322 Sac...    28   9.8  

>Scas_699.40
          Length = 311

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/311 (95%), Positives = 296/311 (95%)

Query: 1   MQNPFLDLENQTIIDSDTDEQVGGDPSDPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQ 60
           MQNPFLDLENQTIIDSDTDEQVGGDPSDPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQ
Sbjct: 1   MQNPFLDLENQTIIDSDTDEQVGGDPSDPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQ 60

Query: 61  IGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPNE 120
           IGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPNE
Sbjct: 61  IGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPNE 120

Query: 121 LDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDSN 180
           LDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDSN
Sbjct: 121 LDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDSN 180

Query: 181 KAALSXXXXXXXXXXXXXXXHVEIIREPINNEEFAYQQNLIQERDREITNIEQGITELNE 240
           KAALS               HVEIIREPINNEEFAYQQNLIQERDREITNIEQGITELNE
Sbjct: 181 KAALSQEQDRQEQLQQQQQQHVEIIREPINNEEFAYQQNLIQERDREITNIEQGITELNE 240

Query: 241 IFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSV 300
           IFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSV
Sbjct: 241 IFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSV 300

Query: 301 MLFFLILVVFI 311
           MLFFLILVVFI
Sbjct: 301 MLFFLILVVFI 311

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  265 bits (677), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 204/293 (69%), Gaps = 12/293 (4%)

Query: 19  DEQVGGDPSDPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTG 78
           DE  GGD  + + ++   F DSPEFQ+LKE + A+LFEINGQI TLQQFT++L++ +  G
Sbjct: 4   DEFFGGD--NEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRG 61

Query: 79  QIRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRY 138
            +  KVVE + KR+   I  +  L+K+ N  V+++D+++   LDK QII REKLVRDV Y
Sbjct: 62  DVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSY 121

Query: 139 SINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDSNKAALSXXXXXXXXXXXXX 198
           S  EFQ  Q+++TQ++K +N++ K +L           + +N AAL              
Sbjct: 122 SFQEFQGIQRQFTQVMKQVNERAKESL--------EASEMANDAALLDEEQRQNSSKSTR 173

Query: 199 XXHVEII--REPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMV 256
               +I+  R+PINNEEFAYQQNLI++RD+EI+NIE+GITELNE+FKDLG+VVQQQG++V
Sbjct: 174 IPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLV 233

Query: 257 DNIEANLYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILVV 309
           DNIEAN+Y+  DNTQ+AS EL +A R QK +++W +YLL+ L VML F+ L++
Sbjct: 234 DNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRVYLLIVLLVMLLFIFLIM 286

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  260 bits (665), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 132/270 (48%), Positives = 184/270 (68%), Gaps = 19/270 (7%)

Query: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96
           F DSPEF+     I A+LFE+NG + TLQQF  +LQN  + G + TK VEN+ K+A +  
Sbjct: 14  FVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSYT 73

Query: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156
           +N+++L K  N++V ++D+++   LD+ Q+I REKL RDV+YS+  FQ  Q E+ +  K 
Sbjct: 74  NNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAKTTKL 133

Query: 157 INDKNKSALLQ-----DQSVKNYTDDDSNKAALSXXXXXXXXXXXXXXXHVEIIREPINN 211
           IN+K KSAL++     D+ ++   +D   +                    V I REPINN
Sbjct: 134 INNKAKSALVKEEQGLDEVLREELEDQHQQQQQQK--------------SVVIEREPINN 179

Query: 212 EEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQ 271
           EEFAYQQNLI+ERD EI+NIE+GI+ELN IF+DLGA+VQQQG +VDNIE N+YSV ++TQ
Sbjct: 180 EEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQ 239

Query: 272 MASKELNRARRSQKVSTKWCLYLLVALSVM 301
            A++ELN+A +SQ+ S+KWCLY+L  LSV 
Sbjct: 240 SAARELNKAMKSQRRSSKWCLYMLAVLSVF 269

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  259 bits (661), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 192/285 (67%), Gaps = 26/285 (9%)

Query: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQI--RTKVVENVIKRAST 94
           F+D P F+ LK+ I ++LFE+NG++ TL+QFT SL   L    I     VV+N+ K+A T
Sbjct: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72

Query: 95  NIHNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLV 154
           NI  VN L+K  N+ V+ ID+++ +ELDK QII R+KL+RD R+SI E Q  Q+++++++
Sbjct: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132

Query: 155 KSIN---------DKNKSALLQDQSVKNYTDDDSNKAALSXXXXXXXXXXXXXXXHVEII 205
           KSIN         ++N +ALLQ+    + T++D+                     +  I 
Sbjct: 133 KSINAEARGKLNEEQNWTALLQEDEESHQTNNDN---------------TAQRQVNFVIE 177

Query: 206 REPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYS 265
           REPINNEEFAYQQ LIQERD EITNIE+GITELN IFKDLGAV+  QG+MVDNIEAN+YS
Sbjct: 178 REPINNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYS 237

Query: 266 VHDNTQMASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILVVF 310
             +NT  AS+ELN+A R QK S+++CLY L+ L VML  +IL+V 
Sbjct: 238 AVENTAGASQELNKANRMQKRSSRYCLYFLMILVVMLILMILIVI 282

>Kwal_55.21557
          Length = 271

 Score =  229 bits (584), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 171/263 (65%), Gaps = 17/263 (6%)

Query: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96
           F D+P+F+   + I   LFE+NG + TLQQF  +LQ +   G  R+K++ N+ K++  +I
Sbjct: 14  FSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQKNQSQGNTRSKMIANLDKKSVYHI 73

Query: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156
           + +  L+K  N +V +I+ ++  ELD+ Q+I R+KL RDV+YS+ EFQE QKE+T   K 
Sbjct: 74  NAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEFQEAQKEFTSTSKV 133

Query: 157 INDKNKSALLQDQSVKNYTDDDSNKAALSXXXXXXXXXXXXXXXHVEIIREPINNEEFAY 216
           +N + K AL +D+  +   D+  N  +                  + I RE INNEEFAY
Sbjct: 134 MNAQAKQALAEDEETRE--DNVINSKS---------------QEQITIEREAINNEEFAY 176

Query: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276
           QQ LIQERD EI +IE GI ELN+IF DLG +VQQQG +VDNIE+N+Y+V +NTQ  ++E
Sbjct: 177 QQRLIQERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQSGARE 236

Query: 277 LNRARRSQKVSTKWCLYLLVALS 299
           L +A RSQ+ S+ WC+ +L+ +S
Sbjct: 237 LTKAMRSQRSSSIWCIRMLIIVS 259

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  211 bits (536), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 111/253 (43%), Positives = 163/253 (64%), Gaps = 10/253 (3%)

Query: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96
           ++DSPEF+   ++I   LFE+NG + T+  F ++L+ ++  G+  TKV++N+ K+    I
Sbjct: 11  YRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNINKKTVELI 70

Query: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156
                L+   N+ + +++ L+ + LDK  +I REKL RD ++S+ EF++ Q+ + ++ K 
Sbjct: 71  DKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVTKR 130

Query: 157 INDKNKSALLQDQSVKNYTDDDSNKAALSXXXXXXXXXXXXXXXHVEIIREPINNEEFAY 216
           IND  K AL          +D+    +L                 V I REPINNEEFAY
Sbjct: 131 INDMAKVAL----------EDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180

Query: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276
           QQ+LI+ERD+EI+NIEQGITELN IFKDLG +VQQQG +VD+IEANLY+V DNT+ A+ E
Sbjct: 181 QQHLIRERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAANE 240

Query: 277 LNRARRSQKVSTK 289
           L+RA RS + S+K
Sbjct: 241 LSRAMRSGRSSSK 253

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  208 bits (529), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 157/255 (61%), Gaps = 13/255 (5%)

Query: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96
           + D+P+F+     I + LFE+NGQ+GT Q F   L+++ + G+  T VVEN+  R+   I
Sbjct: 14  YSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVENISNRSMEVI 73

Query: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156
           H V+ L+K  N +V  I+++  NELD+ Q+  REKL RD+R S+ EFQ  Q E+  + K 
Sbjct: 74  HKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRCQSEFAGIRKQ 133

Query: 157 INDKNKSALLQDQSVKNYTDDDSNKAALSXXXXXXXXXXXXXXXHVEIIREPINNEEFAY 216
           IN++ K +L             S +   +               H+ I REPINNEEFAY
Sbjct: 134 INEQAKISL-------------SEQQEEAAGAAALEEEAAQQQHHIVIEREPINNEEFAY 180

Query: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276
           QQ LI++RD EI NIE+GI ELNE+F+DLG++VQQQ  +VD+IE N+Y+   +T  AS E
Sbjct: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240

Query: 277 LNRARRSQKVSTKWC 291
           L+RA R Q+ S +WC
Sbjct: 241 LSRALRYQRRSNRWC 255

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 1/106 (0%)

Query: 206 REPI-NNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLY 264
           +EP+ N +E  +   +  ER ++I+ I   + E+N IFK LG++VQ+QG  VD I  N+ 
Sbjct: 156 QEPLLNQDELDFHTIIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENVT 215

Query: 265 SVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILVVF 310
            + +N Q A+KEL++A   Q+   +    LLVA+ V+    ++ + 
Sbjct: 216 GLSNNLQKANKELHKANEYQRKKNRCGTILLVAIVVITLITLIAIL 261

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 1/89 (1%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           ++ERD EIT + +G+ E++ IF+++  +V  QG +VD I+ NL +     + A KELN+A
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

Query: 281 RRSQKVSTKWCLYLLVALSVM-LFFLILV 308
              QK + K  + LL+ L V+ LFF +++
Sbjct: 307 THYQKRTQKCKVILLLTLCVIALFFFVML 335

>Scas_607.2
          Length = 417

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 59/92 (64%), Gaps = 1/92 (1%)

Query: 218 QNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           Q  +Q+RD EIT + +G+ E++ IF+++  ++  QG +VD I+ NL +     + A+KEL
Sbjct: 242 QQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTVVDRIDYNLQNTTIQLKEANKEL 301

Query: 278 NRARRSQKVSTKWCLYLLVALSVM-LFFLILV 308
            +A   QK + K  + LL++L V+ LFF +++
Sbjct: 302 GQATVYQKRTQKCKIILLLSLCVIALFFFVML 333

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 203 EIIREPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEAN 262
           E  R+ +   +     N +  RD EIT + QG+ E++ IF+++ +++  QG ++D I+ N
Sbjct: 220 EYSRQTLQRRQATSSDNYLHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYN 279

Query: 263 LYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSV--MLFFLIL 307
           L +     + A  ELN+A   QK + K  + LL+ L V  ++FF++L
Sbjct: 280 LENTVIELKSAQNELNKATTYQKRTQKCKIILLLTLCVIALIFFILL 326

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 57/90 (63%), Gaps = 1/90 (1%)

Query: 220 LIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNR 279
            +Q+R+ EIT + +G+ E++ IF+++  ++  QG +VD I+ NL +     + A KEL+R
Sbjct: 244 FLQQREEEITELARGVLEVSTIFREMQNLIIDQGTVVDRIDYNLENTVIELKQAQKELDR 303

Query: 280 ARRSQKVSTKWCLYLLVALS-VMLFFLILV 308
           A   QK + K  + LL++L  V LFF +++
Sbjct: 304 ATHYQKRTQKCKVILLLSLVIVALFFFVML 333

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 52/87 (59%)

Query: 209 INNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHD 268
           IN++E  +   + ++R R+I+ I   + E+N IFK LG +V++QG  VD ++ N+ +  +
Sbjct: 144 INDDELDFHTIVQEDRSRQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENIANFDN 203

Query: 269 NTQMASKELNRARRSQKVSTKWCLYLL 295
           N   A+++LNRA   Q+   +  L  L
Sbjct: 204 NMHRANEQLNRADEHQRQRNRCGLMTL 230

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 55/95 (57%)

Query: 216 YQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASK 275
           +Q  + QER ++I  I   + E+N IF  LG++V++QG  V  I+ N+  +HDN Q A+K
Sbjct: 188 FQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANK 247

Query: 276 ELNRARRSQKVSTKWCLYLLVALSVMLFFLILVVF 310
           +L RA + Q+   K     L+ + V+   ++L V 
Sbjct: 248 QLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVL 282

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 3/92 (3%)

Query: 207 EPINNEEFAYQQNLIQE-RDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYS 265
           E +  EE  +  +LIQE R +EI+NI   + ++N IFK LG +VQ+QG  VD I++N+  
Sbjct: 197 EHVPQEELDFH-SLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQVDTIDSNING 255

Query: 266 VHDNTQMASKELNRARRSQKVSTKWCLYLLVA 297
           +  N Q A++ L +A R Q+   K C  L + 
Sbjct: 256 LTSNLQGANQHLRKAERYQRQRNK-CGTLTLC 286

>Kwal_34.16287
          Length = 362

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 58/89 (65%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           +Q+R++EIT + +G+ E++ IF+++  +V  QG ++D I+ NL +     + A +EL+RA
Sbjct: 230 LQQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRIDYNLENTVLELKGAQRELDRA 289

Query: 281 RRSQKVSTKWCLYLLVALSVMLFFLILVV 309
              Q  S K  + LL++L V+  F+++++
Sbjct: 290 TVYQTRSQKCKVILLLSLVVIALFIVVML 318

>Kwal_26.8414
          Length = 260

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%)

Query: 209 INNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHD 268
           ++ +E  +   + QER  EI+ I   + E+N IF  LG +V++QG  VDNI+ N+  +  
Sbjct: 158 VSQDELNFHTLVQQERSEEISRIHSAVQEVNAIFHQLGTLVREQGDDVDNIDNNISGLAG 217

Query: 269 NTQMASKELNRARRSQK 285
           N Q A+++L +A +SQ+
Sbjct: 218 NLQRANEQLGKADQSQR 234

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%)

Query: 209 INNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHD 268
           ++ +E  +   + QER +EI+ I   + E+N IF  LG +VQ+QG  VD I+ N+  + +
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 269 NTQMASKELNRARRSQKVSTKWCL 292
           N Q A+ +L  A R Q+   +  +
Sbjct: 234 NLQKANDQLANAERYQRKKNRCGM 257

>Scas_697.44
          Length = 281

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%)

Query: 216 YQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASK 275
           +Q  + QER ++I+ I   + E+N IF  LG++VQ+QG  VD I+ N+  +  N Q A +
Sbjct: 186 FQTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNISQLSGNMQKADE 245

Query: 276 ELNRARRSQK 285
           +L RA  +Q+
Sbjct: 246 QLRRADENQR 255

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%)

Query: 218 QNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           Q  +Q+RD EIT + +G+ E++ IF+++ +++  QG +VD I+ NL +     + A KEL
Sbjct: 232 QQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVIELKQAQKEL 291

Query: 278 NRARRSQKVSTKWCLYLL 295
           ++A   QK S K  + L 
Sbjct: 292 DKATHYQKRSQKCKIILF 309

>Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement
          Length = 307

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 212 EEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQ 271
           EE A     +QER+R +  IE  I E+  +F+ L  +VQ+QG  +  I+AN+  +  N  
Sbjct: 210 EEQAANNTYLQERNRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDLNIS 269

Query: 272 MASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILVV 309
            A +EL   +   +VS+   L + +   + +FFL+ V+
Sbjct: 270 GAQREL--IKYFDRVSSNRWLAVKIFAVLFVFFLVWVL 305

>Kwal_26.7532
          Length = 303

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           +QER R +  IE  I E+  +F+ L  +VQ+QG ++  I+AN+  +  N   A +EL   
Sbjct: 215 LQERSRAVETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVEDIDLNISGAQREL--L 272

Query: 281 RRSQKVSTKWCLYLLVALSVMLFFLILVV 309
           +   +VS+   L + +   + +FFL+ V+
Sbjct: 273 KYFDRVSSNRWLAVKIFAVLFVFFLVWVL 301

>AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH]
           (811271..812260) [990 bp, 329 aa]
          Length = 329

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 218 QNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           Q  +QER R +  IE  I E+  +F+ L  +VQ+QG  +  I+AN+  +  N   A +EL
Sbjct: 238 QQYLQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDINIAGAQREL 297

Query: 278 NRARRSQKVST-KWCLYLLVALSVMLFFLILVV 309
              +   ++S+ +W    + A+ +  FFL+ V+
Sbjct: 298 --LKYFDRISSNRWMAVKIFAI-LFAFFLVWVI 327

>Scas_721.106
          Length = 377

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           +QER+R +  IE  I E+  +F+ L ++VQ+QG ++  I+AN+  V  N   A +EL
Sbjct: 289 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVEDVDLNITGAQREL 345

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 46/69 (66%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           +++RD EIT + +G+ +++ IF+++  ++  QG +VD I+ NL + + + + A +EL++A
Sbjct: 236 LEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTNIDLKQAQRELDQA 295

Query: 281 RRSQKVSTK 289
              QK + K
Sbjct: 296 VGYQKRTQK 304

>YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin
           homolog (t-SNARE) required in ER to Golgi transport,
           found on Golgi membrane which receives transport
           vesicles [1023 bp, 340 aa]
          Length = 340

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           +QER+R +  IE  I E+  +F+ L ++VQ+QG ++  I+AN+  +  N   A +EL
Sbjct: 252 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQREL 308

>CAGL0D01914g 201005..202012 highly similar to sp|Q01590
           Saccharomyces cerevisiae YLR026c SED5, start by
           similarity
          Length = 335

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           +QER+R +  IE  I E+  +F+ L ++VQ+QG ++  I+AN+  V  N   A +EL
Sbjct: 247 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDEVDLNITGAQREL 303

>KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces
           cerevisiae YLR026c SED5 syntaxin (T-SNARE) singleton,
           start by similarity
          Length = 317

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 218 QNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKEL 277
           Q  +QER   I  IE  I E+  +F+ L  +VQ+QG  +  I+ N+  +  N   A +EL
Sbjct: 226 QRYLQERSNAIETIESTIQEVGNLFQQLAHMVQEQGETIQRIDDNVGDIEMNIHGAQREL 285

Query: 278 NRARRSQKVS-TKWCLYLLVALSVMLFFLILVV 309
              +    +S  +W    + A+ + +FFL+ V+
Sbjct: 286 --LKYFDNISNNRWMAVKIFAI-IFVFFLLWVL 315

>Scas_720.32
          Length = 310

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMA----SKE 276
           +Q+R +E+  +E+ + ELN++F D+  +V +Q   VD I+ N+     + +      +K 
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 277 LNRARRSQKVSTKWCLYLLVALSV 300
           ++ ARR+++   +  +   +A ++
Sbjct: 272 VDSARRARRNKIRCYIIAFIAFAI 295

>CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces
           cerevisiae YMR183c SSO2 syntaxin or sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1, hypothetical
           start
          Length = 264

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 206 REPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEAN--- 262
           R  ++NE+     N ++ R +EI N+E+ + +L  +FK++  +V QQ   +D I+ N   
Sbjct: 150 RYLLSNEDAKMALNEVEHRMKEIKNLEKRMNDLAILFKEMEELVVQQEEPIDKIDTNVEK 209

Query: 263 ----LYSVHDNTQMASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILV 308
               L S   +T+ A     + R+++K+      Y+   L + +F  ++V
Sbjct: 210 VVVDLESGITHTEQAIHIAEQKRKNKKLLISIIFYVCAILLLSIFVAVIV 259

>YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin
           homolog (t-SNARE) involved in vesicle transport from
           Golgi to plasma membrane [888 bp, 295 aa]
          Length = 295

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           +Q R +E+  +E+ + EL ++F D+  +V +Q   VD I+ N+     + +      N+A
Sbjct: 197 VQARHQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGHTNKA 256

Query: 281 RRSQKVSTKWCLYLLVALSVMLFFLILVV 309
            +S + + K  +  L+     + F+I  +
Sbjct: 257 VKSARKARKNKIRCLI-----ICFIIFAI 280

>Sklu_2436.16 YDR468C, Contig c2436 36704-37339 reverse complement
          Length = 211

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276
           QQ +IQE+D  +  I Q +  L+     +G  ++ QGLM+D ++  +  V         +
Sbjct: 118 QQQMIQEQDTHLDTIHQTMQSLHLQASTMGQELEDQGLMLDEMDQGMDGVM-------GK 170

Query: 277 LNRARR 282
           L+R RR
Sbjct: 171 LSRGRR 176

>CAGL0E06160g complement(619255..620103) highly similar to sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1 or sp|P39926
           Saccharomyces cerevisiae YMR183c SSO2, start by
           similarity
          Length = 282

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRA 280
           +Q R +E+  +E+ + EL ++F D+  +V +Q   ++ I+ ++     + +      N+A
Sbjct: 185 VQARHQELMQLEKTMAELAQLFNDMEEMVVEQQENIEVIDKHVEEAQQDVEQGVGHTNKA 244

Query: 281 RRSQKVSTK---WCL 292
            +S + + +   WC 
Sbjct: 245 VKSARAARRKKLWCW 259

>Kwal_55.21786
          Length = 327

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 11/101 (10%)

Query: 215 AYQQNLIQERDREITNIEQ------GITEL-NEIFKDLGAVVQQQGLMVDNIEANLYSVH 267
           A   NL+  + +E+ N+E+       I+ L NEI   L +  Q    ++DN +     V 
Sbjct: 230 AEHDNLLNIKTQELQNVEKLSRTMIEISSLQNEITSQLKSQTQNIFTLLDNHD----DVE 285

Query: 268 DNTQMASKELNRARRSQKVSTKWCLYLLVALSVMLFFLILV 308
            + Q  +K+L +A++    S +  +YL V   +++ FL L+
Sbjct: 286 LDVQQGNKQLKKAQKRSGKSARLIIYLSVLFGILILFLDLI 326

>KLLA0F12166g complement(1116715..1121301) weakly similar to
           sgd|S0004237 Saccharomyces cerevisiae YLR247c,
           hypothetical start
          Length = 1528

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 28  DPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVEN 87
           D SDF+  P++++ E + +   +     E+  +I TLQ+   SLQ  L++GQ++ ++ E+
Sbjct: 703 DISDFNYHPWRENDELKDMDAILATMKDEVLDRIHTLQRENYSLQ--LESGQVKMEIDED 760

>Kwal_27.10255
          Length = 329

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 15/109 (13%)

Query: 80  IRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPN----ELDKVQIIQREKLVRD 135
           I   V EN + R  T +H V  L+K   D       L+PN     ++ V   Q   ++R 
Sbjct: 200 IGLSVHENGLLRDGTTMHQVAELIKSFGD------RLNPNFTLLGINCVSYNQSHDILRS 253

Query: 136 VRYSINE-----FQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDS 179
           +   + E     +  + + Y  + K  N KN   L  +Q VK+Y D  +
Sbjct: 254 LHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSGA 302

>Scas_333.3
          Length = 298

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 6/82 (7%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMA----SKE 276
           +Q R +E+  +E+ + EL ++F D+  +V +Q   +D I+ N+     + +      +K 
Sbjct: 200 VQARHQELLQLEKSMAELTQLFNDMEQLVIEQQETIDVIDQNVEEAQQDVEQGIGHTNKA 259

Query: 277 LNRARRSQKVSTKWCLYLLVAL 298
           +  ARR+++   K   Y++  L
Sbjct: 260 VESARRARR--NKIRCYIICFL 279

>KLLA0F07777g complement(733753..734535) some similarities with
           sp|P31377 Saccharomyces cerevisiae YAL014c FUN34
           hypothetical protein singleton, hypothetical start
          Length = 260

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query: 230 NIEQGIT-ELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRARRSQKVST 288
           N  QGI+ E+N+       V QQ   ++ +IE  +     + Q A + LN    + +   
Sbjct: 189 NRTQGISIEIND------EVEQQNEHLLTDIERQVDRSESHLQRAGRRLNAYEATAR--E 240

Query: 289 KWCLYLLVALSVMLFFLILV 308
           K   +L+V LS++LF L+++
Sbjct: 241 KGPCFLIVILSIILFLLVII 260

>KLLA0C03740g 341104..342000 similar to sgd|S0005453 Saccharomyces
           cerevisiae YOL093w, start by similarity
          Length = 298

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 118 PNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTD 176
           P   + +   Q +K+ R  R     F+ET+ EY Q+ K    +N++ L + + +K YTD
Sbjct: 33  PPPPEGISKSQWKKICRKKR-----FEETRAEYAQIRKE--KRNRAKLARREKLKEYTD 84

>ABR006W [597] [Homologous to ScYKL006C-A (SFT1) - SH]
           complement(405391..405426,405491..405748) [294 bp, 97
           aa]
          Length = 97

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/86 (19%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 225 DREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKELNRARRSQ 284
           DR +  +   ++    + +D+G        ++D I+ +  ++  N + +S  L+RA    
Sbjct: 14  DRRLDELSNKLSTFRSLNRDIGNQAAADNTLIDEIQNSFGALFVNIRNSSSRLSRA---- 69

Query: 285 KVSTKWCLYLLVALSVMLFFLILVVF 310
            +     ++ +V LS+++ F++  VF
Sbjct: 70  -ILAGNSVWKMVGLSLLILFVLYNVF 94

>Scas_717.78
          Length = 285

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 51/105 (48%), Gaps = 11/105 (10%)

Query: 210 NNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDN 269
           N E F  QQ  + E+D  + ++   +   + I  D+   V  Q    + +  +L ++ DN
Sbjct: 187 NQELFIQQQQKLMEQDSHLDHLSGSVQRSHGISLDINNEVTNQN---EELLTDLENLVDN 243

Query: 270 TQMASKELNRARRSQKVSTKWC-----LYLLVALSVMLFFLILVV 309
              + + L RA+R  ++  K        + +V L ++LFFL++++
Sbjct: 244 ---SGRGLERAKRRLEIFEKTARDNGPCFTIVVLIIILFFLLVIL 285

>Kwal_56.24259
          Length = 288

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 221 IQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVH-------DNTQMA 273
           +Q R +E+  +E+ + EL ++F D+  +V +Q   ++ I+ N+            +T  A
Sbjct: 192 VQARHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKNVEEAQQDVEQGVGHTNKA 251

Query: 274 SKELNRARRSQ 284
            K   RARR++
Sbjct: 252 VKSARRARRNK 262

>CAGL0K06501g complement(639611..640288) similar to tr|Q03322
           Saccharomyces cerevisiae YDR468c t-SNARE activity,
           hypothetical start
          Length = 225

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 216 YQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASK 275
           +Q+ +++E+D ++ +I Q +  L+   + +G  ++ QG ++D+++  + +V       + 
Sbjct: 131 FQEQMLREQDTQLDDIHQTMKNLHLQAETMGQELEDQGQLLDDMDQGMDTV-------AG 183

Query: 276 ELNRARR 282
           +L R RR
Sbjct: 184 KLARGRR 190

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,239,241
Number of extensions: 375065
Number of successful extensions: 2328
Number of sequences better than 10.0: 168
Number of HSP's gapped: 2287
Number of HSP's successfully gapped: 185
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 61 (28.1 bits)