Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.3926126112751e-180
YFR043C2372471811e-15
Sklu_2433.142502591626e-13
AFR248C3042721566e-12
KLLA0A01089g2332031301e-08
Kwal_47.192042502471025e-05
CAGL0C02079g265262820.017
KLLA0E20603g650105730.31
Sklu_2425.1655106652.9
Sklu_2425.111112111644.2
CAGL0F03047g74430634.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.39
         (261 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.39                                                           495   e-180
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...    74   1e-15
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                         67   6e-13
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...    65   6e-12
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...    55   1e-08
Kwal_47.19204                                                          44   5e-05
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...    36   0.017
KLLA0E20603g 1822412..1824364 highly similar to sp|P09435 Saccha...    33   0.31 
Sklu_2425.1 YBL075C, Contig c2425 293-2260 reverse complement          30   2.9  
Sklu_2425.11 YBL063W, Contig c2425 21817-25155                         29   4.2  
CAGL0F03047g complement(298906..301140) similar to sp|P32578 Sac...    29   4.6  

>Scas_699.39
          Length = 261

 Score =  495 bits (1275), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/261 (93%), Positives = 244/261 (93%)

Query: 1   MTAVGVPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQL 60
           MTAVGVPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQL
Sbjct: 1   MTAVGVPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQL 60

Query: 61  XXXXXXXXXXXXXXXXXCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSS 120
                            CLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSS
Sbjct: 61  DLYIDEFEDFEEFVYEYCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSS 120

Query: 121 SFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVGVPGI 180
           SFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVGVPGI
Sbjct: 121 SFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVGVPGI 180

Query: 181 KEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTHKDQEEAKSI 240
           KEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTHKDQEEAKSI
Sbjct: 181 KEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTHKDQEEAKSI 240

Query: 241 ATALAESIVVKQSADFSCPDI 261
           ATALAESIVVKQSADFSCPDI
Sbjct: 241 ATALAESIVVKQSADFSCPDI 261

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score = 74.3 bits (181), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 120/247 (48%), Gaps = 24/247 (9%)

Query: 7   PQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLXXXXXX 66
           PQNKILV+   +     L+ +FLQ  F     + +  SI+K   W+N+Y+++        
Sbjct: 6   PQNKILVL--SDHPHNFLKTQFLQDLFHC---SSTGISIVKDQTWENRYYKVHFDLYIDS 60

Query: 67  XXXXXXXXXXXCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVIG 126
                         E   LR+V+AGII+I D    +  +L+++    +   T   F+V+ 
Sbjct: 61  CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNT---FVVLA 117

Query: 127 NFEGDYEEEDIAQ----WRFPSESMTNDEDIIAEYVPLDKHF-RMEKNSLGDKVGVPGIK 181
           N   + E+++I +    W   S + TN    + E+V   +    +  N  G+K+G+  I+
Sbjct: 118 NVNEEVEQDEIDELNEIW---SNAFTN----VIEFVNWKRSKPTVNHNDYGEKLGLDRIQ 170

Query: 182 EKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTHKDQEEAKSIA 241
           E +D H+W  NC +Q   +I+   P    ++ +  II  L+ AR+ +++ ++  EA + A
Sbjct: 171 EIIDTHDW-LNCEVQPATKIREEIPN---EMPLEQIIRNLQSARLKYKSIENSSEADAFA 226

Query: 242 TALAESI 248
             +A+ +
Sbjct: 227 NEMADEL 233

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 123/259 (47%), Gaps = 42/259 (16%)

Query: 6   VPQNKILVVFN---KNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLXX 62
           +P+NKILVV +   +N++        +   F+  +  DS  SI+K + W+NKY++  +  
Sbjct: 16  IPRNKILVVCSAEIENKVS------IISSLFNTNV--DSGCSILKNLSWQNKYYKTNIDV 67

Query: 63  XXXXXXXXXXXXXXXCLDEMSELRSVIAGIIII-----DDTY-HFEDNKLVNKLQTDSGS 116
                             E ++LR V+AG+I++     + T+ HF D  ++N     S S
Sbjct: 68  YIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLD--IIN-----STS 120

Query: 117 ETSSSFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVG 176
           +    F +  N        D  +W    ES++++   IA  + L       KN+ GDK+G
Sbjct: 121 QNDEKFYIACNVSSKI---DAEEW----ESLSDN--YIAHGLELINWEESGKNAFGDKLG 171

Query: 177 VPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISA------IINQLRDARINFQT 230
           +  I+E +D HEW   C +   +  QPT    ++  D SA      ++ +L +AR  +Q+
Sbjct: 172 LERIREIIDTHEW-TQCELDVKE--QPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQS 228

Query: 231 HKDQEEAKSIATALAESIV 249
             +++EA+  A  ++E + 
Sbjct: 229 MNNKDEAEMFAQEISEELT 247

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 111/272 (40%), Gaps = 70/272 (25%)

Query: 6   VPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLXXXXX 65
           +P+NKIL++    +     Q E ++  F+  IE   SD I++ + W NKY+E+ L     
Sbjct: 73  LPRNKILILAPAGK---AYQAEVIRDLFN--IEASESDRIVRDVKWSNKYYEVDLDLYID 127

Query: 66  XXXXXXXXXXXXCLDEMSELRSVIAGIIII------DDTY-------HFEDNKLVNKLQT 112
                       C DE ++LR V+AGI ++       +T+       HF D +++     
Sbjct: 128 SYESLQTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFTDERVLVACDL 187

Query: 113 DSGSETSSSFMVIGNFEGDYEEEDIA--QWRFPSESMTNDEDIIAEYVPLDKHFRMEKNS 170
            S    +S        E   E  D+A  +WR   E  TN+                    
Sbjct: 188 SSAEHPAS-------LERALEVHDVALVRWR---ERGTNE-------------------- 217

Query: 171 LGDKVGVPGIKEKLDLHEWNPN---------CNIQKLDQIQPTHPPSNMDVDISAIINQL 221
           LG++ G   ++E LD+H W+             + +LD +Q        D+ + +++ ++
Sbjct: 218 LGEQQGRERVRELLDIHPWSERMLRMHASTAAALAELDPLQ-------ADIPLDSVVTRI 270

Query: 222 RDARINF----QTHKDQEEAKSIATALAESIV 249
           + AR  +      H   E A  IA  L E ++
Sbjct: 271 KQARERYLEITDVHAADEYAARIAHELTEQLL 302

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 89/203 (43%), Gaps = 20/203 (9%)

Query: 40  DSSDSIIKGIIWKNKYFELQLXXXXXXXXXXXXXXXXXCLDEMSELRSVIAGIIIIDDTY 99
           D ++SI + + WK KY+E  L                   DE  ELR VI+GII +   +
Sbjct: 32  DETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFV---F 88

Query: 100 HFEDNK----LVNKLQTDSGSETSSSFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIA 155
             ED+K     +  L  +   + ++ F +   F  +  EED        E    + D++ 
Sbjct: 89  KDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIEED--------ELYELNSDLLV 140

Query: 156 EYVPLDKHFRMEKNSLGDKVGVPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDIS 215
           +   +   F     S+ DKVG   IKE +D+H W  +    K +Q Q    P    +D+ 
Sbjct: 141 QNFEIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPETLKKNQGQINISP----IDLD 195

Query: 216 AIINQLRDARINFQTHKDQEEAK 238
           + + +L  A+  +QT  D +EA+
Sbjct: 196 SFMTKLEQAKERYQTFDDSKEAE 218

>Kwal_47.19204
          Length = 250

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 103/247 (41%), Gaps = 27/247 (10%)

Query: 8   QNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLXXXXXXX 67
           ++KI+V F+ N +    Q E +   F +  ++D    I   + W  KY+ +++       
Sbjct: 21  RDKIIVCFS-NYVHD--QAEVISDLFGISFKDDQR--IHHDLEWTTKYYSVKIDLYIDSF 75

Query: 68  XXXXXXXXXXCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVIGN 127
                     C  E  ELR V+AG++++      ED  L    Q       + SF V+  
Sbjct: 76  DSLRDWVQQFCNSECDELRDVLAGLVLVVPC-KVEDADLETFTQLADCMADAESFFVVLK 134

Query: 128 FEGDYEEEDIAQWRFPSESMTNDED--IIAEYVPLDKHFRMEKNSLGDKVGVPGIKEKLD 185
              +           PSE  T+  +  ++A  V +       +N  G+ +G   ++E +D
Sbjct: 135 ARSN-----------PSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIID 183

Query: 186 LHEWNPNCNIQKLDQIQPTH--PPSNMDVDISAIINQLRDARINFQTHKDQEE----AKS 239
            ++W     + KL Q   T     ++  + ++ I+ +L++AR  +      EE    A+ 
Sbjct: 184 TYDWQT--QLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARD 241

Query: 240 IATALAE 246
           +A  L+E
Sbjct: 242 VAHELSE 248

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 101/262 (38%), Gaps = 41/262 (15%)

Query: 1   MTAVGVPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQL 60
           +T   V  NK+LVVF       TL R+ L    D         +I+K + W  KY+ ++ 
Sbjct: 27  VTDAKVLPNKVLVVFEG---ESTLFRDQL---LDTVFGVQDQGNIVKQLSWDTKYYAVEY 80

Query: 61  XXXXXXXXXXXXXXXXXCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSS 120
                              D+  ELR ++  III+      +D K  N +  D     S 
Sbjct: 81  DLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGNSV 140

Query: 121 SFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHF---------RMEKNSL 171
           S + +                  + S    +D   E++ LD            R+EK + 
Sbjct: 141 SVISVN-----------------TNSARQVKDTYDEFLELDASSIEFINYHDDRVEKET- 182

Query: 172 GDKVGVPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTH 231
            +  G+  +KE +D H W  +C +  L   + T    N   D+  +I+ L+ A+I++Q  
Sbjct: 183 NECKGMARLKEIIDTHPW-TDCKVV-LKNKESTSDKVNKP-DLEYLIDTLKKAKIHYQKL 239

Query: 232 KD-----QEEAKSIATALAESI 248
            +      EEA+  A  +A  I
Sbjct: 240 SNGSDGFSEEAEQFALQMATDI 261

>KLLA0E20603g 1822412..1824364 highly similar to sp|P09435
           Saccharomyces cerevisiae YBL075c SSA3 heat shock protein
           of HSP70 family, cytosolic, start by similarity
          Length = 650

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 81  EMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVIGNFEGDYEEEDIAQW 140
           E+S +     G+  I+ T+  + N ++N    + G+  +S  + I N +G   +EDI + 
Sbjct: 458 ELSGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKTSK-ITITNDKGRLSKEDIERM 516

Query: 141 RFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVGVPGIKEKLD 185
              +E    +++  AE V           SL + VG  G KEK+D
Sbjct: 517 VSEAEKFKVEDEAEAERVQTRNSLEAYAFSLKNTVGESGFKEKVD 561

>Sklu_2425.1 YBL075C, Contig c2425 293-2260 reverse complement
          Length = 655

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 4/106 (3%)

Query: 91  GIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVIGNFEGDYEEEDIAQWRFPSESMTND 150
           G+  I+ T+  + N ++N    + G+  S+  + I N +G   +EDI +    +E    +
Sbjct: 468 GVPQIEVTFDIDANGILNVSAVEKGTGKSNK-ITITNDKGRLSKEDIEKMVSEAEKFKAE 526

Query: 151 EDIIAEYVPLDKHFRMEKNSLGDKVGVPGIKEKL---DLHEWNPNC 193
           ++  AE +           +L + +G  G KEK+   DL +    C
Sbjct: 527 DEKEAERIQTKNQLEAYAFNLKNTIGESGFKEKVGEDDLKKLQTAC 572

>Sklu_2425.11 YBL063W, Contig c2425 21817-25155
          Length = 1112

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 15/111 (13%)

Query: 94  IIDDTYH--FEDNKLVNKLQTDSGSETSSSFMVIGNFEGDYEEEDIAQWRFPS------- 144
           ++D + H  + ++KL   LQ   G +T +  +   +      EE ++   + +       
Sbjct: 361 LVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKN 420

Query: 145 -----ESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVGVPGIKEKLDLHEWN 190
                +SMT D   I EY+      R E  +   K G+   +EK DL+E N
Sbjct: 421 TPQINQSMTKD-SCITEYIHEIDRLRKELRATRTKDGIYITQEKYDLYESN 470

>CAGL0F03047g complement(298906..301140) similar to sp|P32578
           Saccharomyces cerevisiae YDR422c SIP1 multicopy
           suppressor of SNF1, hypothetical start
          Length = 744

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%)

Query: 179 GIKEKLDLHEWNPNCNIQKLDQIQPTHPPS 208
           G+K K+     NPN N+Q L+ I+P  PP+
Sbjct: 302 GVKRKI---LSNPNLNLQPLEPIRPNEPPT 328

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,538,839
Number of extensions: 375481
Number of successful extensions: 1174
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1164
Number of HSP's successfully gapped: 24
Length of query: 261
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 161
Effective length of database: 13,134,309
Effective search space: 2114623749
Effective search space used: 2114623749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)