Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.3861261228680.0
CAGL0M08668g65768512071e-158
Scas_615.1267441411811e-154
YDR266C63965611771e-154
Sklu_1676.265047010791e-139
Kwal_55.200006176569921e-127
KLLA0E16698g6566199751e-123
AER391C6326709571e-121
KLLA0B03454g472165830.059
Kwal_27.1072322987780.15
CAGL0I08877g344105770.27
KLLA0C08041g57465770.29
Sklu_2385.939478760.34
CAGL0B05049g147058760.49
AGL289C24148730.65
Scas_721.1001137144731.2
YDR516C (EMI2)500188721.3
CAGL0K02145g31736711.5
Scas_672.226348701.7
Scas_720.8946972702.0
YLR247C155683702.6
CAGL0G03553g21045672.9
YER130C44336693.0
Scas_573.91502110693.3
Scas_602.954756683.3
Scas_592.263345683.6
KLLA0E16720g30546673.7
Kwal_47.1724140356674.2
YCR066W (RAD18)48765674.5
KLLA0C17072g47456674.7
YOL054W40647656.9
KLLA0C08756g42753657.1
YJL056C (ZAP1)880100667.7
Sklu_2432.9147553667.8
Sklu_2423.864752658.3
Scas_712.3486167658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.38
         (612 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.38                                                          1109   0.0  
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   469   e-158
Scas_615.12                                                           459   e-154
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   457   e-154
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            420   e-139
Kwal_55.20000                                                         386   e-127
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   380   e-123
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   373   e-121
KLLA0B03454g complement(314015..315433) some similarities with s...    37   0.059
Kwal_27.10723                                                          35   0.15 
CAGL0I08877g complement(862359..863393) similar to sp|P53292 Sac...    34   0.27 
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    34   0.29 
Sklu_2385.9 YLR107W, Contig c2385 14207-15391 reverse complement       34   0.34 
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    34   0.49 
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    33   0.65 
Scas_721.100                                                           33   1.2  
YDR516C (EMI2) [1329] chr4 complement(1474962..1476464) Protein ...    32   1.3  
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    32   1.5  
Scas_672.2                                                             32   1.7  
Scas_720.89                                                            32   2.0  
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    32   2.6  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    30   2.9  
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    31   3.0  
Scas_573.9                                                             31   3.3  
Scas_602.9                                                             31   3.3  
Scas_592.2                                                             31   3.6  
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    30   3.7  
Kwal_47.17241                                                          30   4.2  
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    30   4.5  
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    30   4.7  
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    30   6.9  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    30   7.1  
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    30   7.7  
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              30   7.8  
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       30   8.3  
Scas_712.3                                                             30   8.3  

>Scas_699.38
          Length = 612

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/612 (88%), Positives = 539/612 (88%)

Query: 1   MSTIKPRRNFRRTQGGSNTTTTDNKKKQHSHRHEEINDDDENVCVICANPIKFAAWSPCN 60
           MSTIKPRRNFRRTQGGSNTTTTDNKKKQHSHRHEEINDDDENVCVICANPIKFAAWSPCN
Sbjct: 1   MSTIKPRRNFRRTQGGSNTTTTDNKKKQHSHRHEEINDDDENVCVICANPIKFAAWSPCN 60

Query: 61  HKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNSNMWQTDLINTKY 120
           HKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNSNMWQTDLINTKY
Sbjct: 61  HKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNSNMWQTDLINTKY 120

Query: 121 GIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNKTICMI 180
           GIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNKTICMI
Sbjct: 121 GIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNKTICMI 180

Query: 181 CADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMSHMREK 240
           CADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMSHMREK
Sbjct: 181 CADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMSHMREK 240

Query: 241 HERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQAHILQ 300
           HERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQAHILQ
Sbjct: 241 HERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQAHILQ 300

Query: 301 EHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFTXXXXXXXXXXXXXXXXXXXXXXXXX 360
           EHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFT                         
Sbjct: 301 EHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFTSQHSFSDSSLPSLNSVNSTNANNSS 360

Query: 361 QEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSYKNLFQTPQSDVHL 420
           QEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSYKNLFQTPQSDVHL
Sbjct: 361 QEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSYKNLFQTPQSDVHL 420

Query: 421 LIHNLSELYPMNSLKYKELDSIYRAQEXXXXXXXXXXXXYNDPXXXXXMVNAVWGXXXXX 480
           LIHNLSELYPMNSLKYKELDSIYRAQE            YNDP     MVNAVWG     
Sbjct: 421 LIHNLSELYPMNSLKYKELDSIYRAQEKKLSKKPQLPSLYNDPSSSSSMVNAVWGNSNNN 480

Query: 481 XXXXXXXXXXXXPLNLPSLTSTPSNLNGTRPXXXXXXXXXXXXXXRNDNASSNSRISNLP 540
                       PLNLPSLTSTPSNLNGTRP              RNDNASSNSRISNLP
Sbjct: 481 RNVSSLRTNTNRPLNLPSLTSTPSNLNGTRPLHVSHSTSSLTSKSRNDNASSNSRISNLP 540

Query: 541 SLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGK 600
           SLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGK
Sbjct: 541 SLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGK 600

Query: 601 RKQKQLLFHIGI 612
           RKQKQLLFHIGI
Sbjct: 601 RKQKQLLFHIGI 612

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  469 bits (1207), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 291/685 (42%), Positives = 383/685 (55%), Gaps = 115/685 (16%)

Query: 5   KPR-RNFRRTQ-GGSNTTTTDN---------------------KKKQHSHRHEEIN---- 37
           KP+ RNFRRTQ GG +   + N                     KK     + EE N    
Sbjct: 11  KPKNRNFRRTQTGGRSNGESGNGRKAKKITGNPDFLQKEIKSGKKSNIEKKVEEFNAREE 70

Query: 38  DDDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEK 97
           DDD  +C+ICA  + +A+ SPCNH TCH CSFRQ AL++KKSCLICRT+  N+ + FT+ 
Sbjct: 71  DDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTE--NDRLTFTDN 128

Query: 98  LNSQAYE--DFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNA 155
           +++Q  E  DF+ +       + K+GI FTSD+V   TL+L K+ C +C   D E  ++ 
Sbjct: 129 IDAQYSEITDFSGS-------DDKFGIDFTSDEVKNATLDLLKYACPLC--PDNEQHVST 179

Query: 156 TDYKSFKKLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKG 215
           T    +KK NEHLK  HN + IC+ICA +  SFP E+KIYT NQLKNH+++G +++GFKG
Sbjct: 180 T----YKKYNEHLKSAHN-RMICLICAGNKHSFPREMKIYTANQLKNHHSRG-DSEGFKG 233

Query: 216 HPMCKFCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYIC 275
           HPMC FC+ KRFYS DEL  HMR  HE+CHICD+IDH  PQ+FK+Y+QLF HF+ SHY+C
Sbjct: 234 HPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVC 293

Query: 276 TFQTCLDDKFIVFKDDMELQAHILQEHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFT 335
           T Q+CLDDKF+VFKDDMELQAHIL+EHGD++RGKPKFFQSELSTFIS PS+VI + +++ 
Sbjct: 294 TVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFISAPSQVIRERDSYN 353

Query: 336 XXXXXXXXXXXXXXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAA 395
                                     EV +LR++ERAKHYL++S E FQ F  LN+ Y +
Sbjct: 354 YDMGSVGSSNIEESSNP---------EVNRLRMNERAKHYLNSSLEGFQKFETLNENYDS 404

Query: 396 NKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEXXXXXXXX 455
           + LTA+QL+  YK LF    +D++LL+HNLS LYP NS K+K+LD IY+  E        
Sbjct: 405 SVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNA 464

Query: 456 XXXXYNDPXXXXXMVNAVWGXXXXXXXXXXXXXXXXXPLNLPSLTSTPSNLN-------- 507
                +D      +    WG                    LPSL    S+ +        
Sbjct: 465 LPSLLDD--HIQTVPGGAWGSSTGRSKSHSSIKNLN---QLPSLGGVSSSFDPFKNPNKA 519

Query: 508 ----GTR--------------PXXXXXXXXXXXXXXRNDNASSNSRISNLPSLPT----- 544
               G R              P               N  +++ +   +  S P+     
Sbjct: 520 PVYKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSNSSS 579

Query: 545 ------------PKP--KVYIPPVRQTVIPDPNSWGRRG---PQQTNGDVLEGISNLNMN 587
                       P P  KVYIPPV + VIPDP  WG++G   PQ T    L  + +LN+N
Sbjct: 580 KNKLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQKGEPAPQLTEEQQL--LESLNLN 637

Query: 588 GNSSSQTTRGSGKRKQKQLLFHIGI 612
           GNS S+        KQKQLLFHIG+
Sbjct: 638 GNSKSKKK-----GKQKQLLFHIGV 657

>Scas_615.12
          Length = 674

 Score =  459 bits (1181), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 296/414 (71%), Gaps = 19/414 (4%)

Query: 43  VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQA 102
           +C+ICA+ + +A+ SPCNH TCHKCSF+Q +L++KK+CLICRT+  N+ +IFTE +N+  
Sbjct: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTE--NDKLIFTENINAN- 127

Query: 103 YEDFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFK 162
           Y D N   +Q    N KYGI FTS++VA  TLNL K+ CSVC     ++ +   D+ S+K
Sbjct: 128 YTDSNLGHYQ---FNEKYGIVFTSEEVATATLNLLKYTCSVC--PANKDGIEREDFGSYK 182

Query: 163 KLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFC 222
           K NEHL+ +HN K +C ICA ++  FPSEL +YT NQL+NH +KG+ ++GFKGHP+C FC
Sbjct: 183 KYNEHLRSKHN-KCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGN-SEGFKGHPLCAFC 240

Query: 223 SNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLD 282
           S +RFY  DEL  HMR KHE+CHICDKIDHN+PQ+FK+YDQLF HFKN HYICT QTCLD
Sbjct: 241 SGQRFYGDDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLD 300

Query: 283 DKFIVFKDDMELQAHILQEHGDLIRGKPKFFQSELSTFISTPSRVITDDNAF-------- 334
           +KFIVFKD++ELQAHIL+EHGDLIRGKPK FQSELSTF+S PSRV+ D +A         
Sbjct: 301 NKFIVFKDELELQAHILKEHGDLIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMDSRP 360

Query: 335 -TXXXXXXXXXXXXXXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQY 393
                                       E++QLRL+ERAK+YL+NS E +  FI  N +Y
Sbjct: 361 SLFSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEY 420

Query: 394 AANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQE 447
               LT   LL+SYK +F TPQS+V+LLI+N+++LYP NS K+KEL++IY AQE
Sbjct: 421 DKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQE 474

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 52/76 (68%), Gaps = 1/76 (1%)

Query: 538 NLPSLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNS-SSQTTR 596
           NLP LPTPKPKVYIPP+R+T IPDP  WG  G    + D L  +   + NG+S S+Q   
Sbjct: 599 NLPQLPTPKPKVYIPPLRKTTIPDPKQWGGGGQNVPSTDNLPSLPIHHSNGSSQSNQQKG 658

Query: 597 GSGKRKQKQLLFHIGI 612
             GK+KQKQLLFHIGI
Sbjct: 659 KRGKQKQKQLLFHIGI 674

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  457 bits (1177), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 278/656 (42%), Positives = 370/656 (56%), Gaps = 72/656 (10%)

Query: 4   IKPRRNFRRTQGGSNTTTTDNKKKQHSHRHEEIN---------------DDDENVCVICA 48
           + P RNFRRTQG  N T   N +K    + ++ N               D++  +CVICA
Sbjct: 9   VTPTRNFRRTQGPQNNTKPHNDRKNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICA 68

Query: 49  NPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNS 108
             + + + +PC+HKTCH C FRQ AL++KKSCLICRT+  N  ++FT++++    + +N 
Sbjct: 69  RKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTE--NEEVMFTDRIDGDISDKYNF 126

Query: 109 NMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHL 168
                   N KYGI FTS++VA ETLNL KF C +   E         D+ SFKK NEHL
Sbjct: 127 CEK-----NEKYGINFTSEEVATETLNLLKFFCPLSKDEQ------VCDFGSFKKYNEHL 175

Query: 169 KLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFY 228
           K EHN + IC+ICA H  +FP EL+I+T NQL+NH  KG+ ++GFKGHPMC FCS KRFY
Sbjct: 176 KSEHN-RMICLICATHKHAFPCELEIFTQNQLRNHQTKGN-SEGFKGHPMCAFCSGKRFY 233

Query: 229 SQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVF 288
           S DEL  HMR +HE+CHICDK++  +PQ+FK+Y+QLF HFK+SHY+CT QTCLD+KF+VF
Sbjct: 234 SDDELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVF 293

Query: 289 KDDMELQAHILQEHGDLIRGKPKFFQSELSTFISTPSRVITDDNAFTXXXXXXXXXXXXX 348
           KD++ELQAHILQEHG++++GKPKFFQSELSTFIS PSRVI + + +              
Sbjct: 294 KDELELQAHILQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDY--DLPSISSLPGSS 351

Query: 349 XXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSYK 408
                        E  +LRL ERAK+YL+NS EDF  F + N+ Y+  +L+A +LL SYK
Sbjct: 352 SGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYK 411

Query: 409 NLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEXXXXXXXXXXXXYNDPXXXXX 468
            LF  P +DV+LLIHNL+E +P NS KY  L++IY  +E             +D      
Sbjct: 412 LLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMS 471

Query: 469 MVNAVWGXXXXXXXXXXXXXXXXXPLNLPSLTS---------TPSNLNGTRPXXXXXXXX 519
           +    WG                   NLP+L S         T    N  RP        
Sbjct: 472 IGRGHWGGTNDGGSAGAALGVRNIK-NLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTT 530

Query: 520 XXXXXXRNDN--------------ASSNSRISN----LPSL-----PTPKPKVYIPPVRQ 556
                 R                  SS++ ++N    L SL     P PKPKV IP + +
Sbjct: 531 PQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNR 590

Query: 557 TVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGKRKQKQLLFHIGI 612
             I DP  WG++   Q + +V + +  LN      + +     K KQKQLLFHIG+
Sbjct: 591 PQIADPKQWGKKSSTQ-DTNVHDNLRELN------TTSGGNKKKGKQKQLLFHIGV 639

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  420 bits (1079), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 216/470 (45%), Positives = 300/470 (63%), Gaps = 45/470 (9%)

Query: 5   KPRRNFRRTQGG-------SNTTTTDNKK-------------KQHSHRHEEINDDDENVC 44
           K +RNFRRTQ         +N++ ++  K              Q S   + + +DD  +C
Sbjct: 8   KQQRNFRRTQDSQAPRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNLEEDDGEIC 67

Query: 45  VICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYE 104
           +ICANP K+ A S C+H TCHKC+FRQ AL+ KK CLICRT+  N  +IFT+K + Q + 
Sbjct: 68  IICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTE--NEQLIFTDKFDHQ-FA 124

Query: 105 DFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKL 164
           DF    +     + +YGI FTS+ V   TL L K+ C    + DK       D++SFKK 
Sbjct: 125 DFTPRDFAK--TSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADK-------DFESFKKY 175

Query: 165 NEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSN 224
           NEHLK  HN KTICMICA++  +FPSELKI+T NQL+NH ++G ++ GFKGHPMC FC+ 
Sbjct: 176 NEHLKTSHN-KTICMICANNKKAFPSELKIFTPNQLRNHQSRG-DSHGFKGHPMCGFCTG 233

Query: 225 KRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDK 284
           +RFYS DEL  HMR++HERCHICD+ID  NPQ+FKNYDQLF HF+NSHY+CT QTCL+ K
Sbjct: 234 QRFYSDDELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESK 293

Query: 285 FIVFKDDMELQAHILQEHGDL-------IRGKPKFFQSELSTFISTPSRVITDDNAFTXX 337
           F+VF+DD++LQAHIL+EH  +       I    + FQSELSTF +TP+R + + + F   
Sbjct: 294 FVVFRDDIDLQAHILKEHRTILANDKGNIPVAGRRFQSELSTFSATPARAVHERDTF--- 350

Query: 338 XXXXXXXXXXXXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANK 397
                                   EVK++R++ERA+HYL+ S  +F+ F+ +N+ Y  N 
Sbjct: 351 -DTPALRSSSAARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNT 409

Query: 398 LTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQE 447
           L+A  +  +Y+ LF +P +DV LLI++ S ++P NS K+K+L +IY A++
Sbjct: 410 LSAEDVFTAYQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQ 459

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 41/81 (50%), Gaps = 15/81 (18%)

Query: 539 LPSLP-TPKPKVYIPPVRQTVIPDPNSWG------RRGPQQTNGDVLEGISNLNMNGNSS 591
            P LP   K K   P V +  IP+P  WG      R+  QQ        I + N + +S 
Sbjct: 578 FPPLPKAQKKKFRAPLVNEPNIPNPQQWGVSSSSLRQEQQQ--------IGSSNASTDSL 629

Query: 592 SQTTRGSGKRKQKQLLFHIGI 612
           S + +  GK+KQKQLLFHIGI
Sbjct: 630 STSGKKRGKQKQKQLLFHIGI 650

>Kwal_55.20000
          Length = 617

 Score =  386 bits (992), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 245/656 (37%), Positives = 357/656 (54%), Gaps = 96/656 (14%)

Query: 7   RRNFRRTQG---------GSNTTTTDNKK-KQHSHRHEEINDDDENVCVICANPIKFAAW 56
           +R+FRRTQG         G NT ++  +   Q +    E+++DD  +C+ICA  + +   
Sbjct: 8   KRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDD--ICIICAEKLTYVTL 65

Query: 57  SPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNS-NMWQTDL 115
           SPCNH TC++C+FRQ AL++KKSCL+CRT+ D   +IF+   N+  ++DF+  N+ +T  
Sbjct: 66  SPCNHVTCNRCTFRQRALYNKKSCLVCRTESD--LVIFSADRNA-VFDDFDEKNLVET-- 120

Query: 116 INTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNK 175
            N   G+ FTS DVA +TL L  + C              T++++FKK N HLK EHN K
Sbjct: 121 -NVDLGVSFTSQDVASKTLGLLIYSCPF-------GDTGGTNHENFKKYNAHLKNEHN-K 171

Query: 176 TICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMS 235
           T+CMICA H  +FPSEL+IYT +QL+ H +KG +++GFKGHPMC FCS +RFYS DEL  
Sbjct: 172 TLCMICASHKKAFPSELRIYTPSQLRIHQSKG-DSEGFKGHPMCGFCSGQRFYSDDELNV 230

Query: 236 HMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQ 295
           HMR++HE+CHICD+ + N+PQ+FK+YDQLF HFK  HY+C  Q+CLD KF+VF+DD++LQ
Sbjct: 231 HMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQ 290

Query: 296 AHILQEHGDLIRG--------KPKFFQSELSTFISTPSRVITDDNAFTXXXXXXXXXXXX 347
           AHIL+EHG ++R           + +QS+LSTF   PSR  +  +               
Sbjct: 291 AHILKEHGGILRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDV-------------- 336

Query: 348 XXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLLNSY 407
                         EVK+LR++ERA+HYL  SH DF+ F+ +N  Y    +TA  +L++Y
Sbjct: 337 RDNTAKNNSSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAY 396

Query: 408 KNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEXXXXXXXX--XXXXYNDPXX 465
           + LF++P++ V LL+++ SEL+P +S  +++L  IY   +               N    
Sbjct: 397 EGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLL 456

Query: 466 XXXMVNAVWGXXXXXXXXXXXXXXXXXPLNLPSL-----------TSTPSN--LNGTRPX 512
              + +  WG                   N PSL           T  PS+  +N  +P 
Sbjct: 457 PGSVASGSWGRSTGSNKAARQ-------YNFPSLKKPASPQPPIITKKPSSTKVNNVQPK 509

Query: 513 XXXXXXXXXXXX-----------XRNDNASSNSRI--SNLPSLPTPKPKVYIPP-VRQTV 558
                                   +  +ASS+  +     P LP  + + +  P V +  
Sbjct: 510 AKAVPVTRKPSSNESSFKPTYLDGKQKSASSSPALDREKFPPLPKSQARKFRAPLVNEAS 569

Query: 559 IPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSG--KRKQKQLLFHIGI 612
           IP+P+ WG+   + T G        L M  ++S+Q    SG  K KQKQLLFHIGI
Sbjct: 570 IPNPSQWGKSSNESTGG--------LRMQSSNSTQELISSGKKKNKQKQLLFHIGI 617

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  380 bits (975), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 230/619 (37%), Positives = 323/619 (52%), Gaps = 87/619 (14%)

Query: 37  NDDDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTE 96
           +DD  NVC+ICA  +   A SPCNH TCHKC  RQ AL++KK CL CR++ ++  +IFT+
Sbjct: 82  DDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVED--IIFTD 139

Query: 97  KLNSQAYEDFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNAT 156
           K+  + YE  +    + +  N K GI+FTS +V  + +NL K++                
Sbjct: 140 KIK-ETYEHLDKKA-KLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDAN--------K 189

Query: 157 DYKSFKKLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGH 216
           D+ SFKKLNE L+ EHN KTICMICA H  +FP ELK+ T  QLK H ++G   DGFKGH
Sbjct: 190 DFGSFKKLNEFLRQEHN-KTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGH 248

Query: 217 PMCKFCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICT 276
           PMC FCS KRFYS DEL  HM+  HERCHICD++D + PQ+FKNY+ LF HFK++HY+CT
Sbjct: 249 PMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCT 308

Query: 277 FQTCLDDKFIVFKDDMELQAHILQEH----GD------LIRGKPKFFQSELSTFISTPSR 326
             +CLD KF+VF D+++L+AHI++EH    GD      LI    K F+S+++TF S P+R
Sbjct: 309 VPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTR 367

Query: 327 VITDDNAFTXXXXXXXXXXXXXXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTF 386
           +I   N                            ++VK+ R+++RA+HYL NS  DFQ+F
Sbjct: 368 IIDAQN--------------------EESNSANSRDVKRRRMEQRARHYLGNSEPDFQSF 407

Query: 387 INLNKQYAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQ 446
           + +N  +  N+++A +L + Y++LF+    D+ LLI++LSELY   S K+K L +IY   
Sbjct: 408 LIINDLFNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGI 467

Query: 447 EXXXXXXXXXXXXYNDPXXXXXMVNAVWGXXXXXXXXXXXXXXXXXPL------------ 494
                          D      +V   WG                 P             
Sbjct: 468 MKKKENAGKFKPLVADSSSSVNVVYGKWGKKSSSGVGGSNVKFTSLPAVSEPIFSSKASY 527

Query: 495 -----NLPSLTSTPSNLNGTRPXXXXXXXXXXXXXXRNDNASSNSRI------------- 536
                N  S  S+P   +G                 ++   SS   +             
Sbjct: 528 TNLRKNGSSSPSSPVIRSGLTSNSSSSTSLNYAKKNQSPPGSSTVVVNSQPNVTAIKSPN 587

Query: 537 -SNLPSLPTPKPKVYIPPVRQTVIPDPNSWGRRGPQQTNGDV-LEGISN-LNMNGNSSSQ 593
            ++ P L   K K   PPV+QT IP+P++WG+  PQ  N  + L+ + N L  +G+    
Sbjct: 588 PTSFPKLQATKKKFVAPPVKQTTIPNPSTWGK--PQNDNDSINLDSLDNALPASGSKKKS 645

Query: 594 TTRGSGKRKQKQLLFHIGI 612
                     KQLLFHIGI
Sbjct: 646 KQ--------KQLLFHIGI 656

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  373 bits (957), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 238/670 (35%), Positives = 347/670 (51%), Gaps = 108/670 (16%)

Query: 8   RNFRRTQG---GSNTTTTDNKKKQHSHR------------------HEEINDDDEN---- 42
           RNFRRTQG    +  T  D+     S R                  H    D +E+    
Sbjct: 6   RNFRRTQGRKPQTAQTQADSADWNGSGRWRKSSGYASGGGSSAGPPHSPCGDTEEDNGEM 65

Query: 43  VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQA 102
            C+ICA+ +++ A SPCNH TCHKC+FRQ AL++KK+CL+CRT+ +   +IFT+++ ++ 
Sbjct: 66  TCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHE--YLIFTDQIKAE- 122

Query: 103 YEDFNSNMWQTDLI--NTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKS 160
               ++     D++  + +YGI+FTS +    TL+L K+ C    + +        D  S
Sbjct: 123 ----HARFGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPE-------FDLDS 171

Query: 161 FKKLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCK 220
           FK  NEHLK EH  ++IC ICA H   FP+E+K  T NQLK HN  G ++ GF GHP+C 
Sbjct: 172 FKNYNEHLKNEHK-RSICTICARHRKQFPAEMKTLTPNQLKIHNTIG-DSKGFTGHPLCG 229

Query: 221 FCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTC 280
           FCS KRFYS DEL  HMRE+HE+CHICD++D   PQ+FK+YDQLF HFK+SHYIC  ++C
Sbjct: 230 FCSGKRFYSDDELYIHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSC 289

Query: 281 LDDKFIVFKDDMELQAHILQEHGDLIRGKP-------KFFQSELST-FISTPSRVITDDN 332
           LD KF+VF DD++LQAH+L+EH +++  K        + ++SELS+ F    SR + + +
Sbjct: 290 LDSKFVVFADDLDLQAHMLKEHPNIMGNKSTISLTAGRRYRSELSSGFTPNVSRAVHETS 349

Query: 333 AFTXXXXXXXXXXXXXXXXXXXXXXXXXQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQ 392
           +                            E+K+ RL+ERA+HYL+ S  + + F  +N  
Sbjct: 350 S---------SNALALGPSVSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINND 400

Query: 393 YAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEXXXXX 452
           Y  N ++A  +   Y  LF+ P++D HLL+ N ++ +P  SLKYKEL++IY+A++     
Sbjct: 401 YNNNVISATSVQRRYDQLFRNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRER 460

Query: 453 XXXXXXXYNDPXXXXXMVNAVWGXXXXXXXXXXXXXXXXXPLNLPSLTST---------- 502
                    +P     +V A WG                   N PSL+S           
Sbjct: 461 QAKFPSLSTNPWYSAPVVGAAWGKNGGKSSSSR---------NFPSLSSALTDSYQNVTP 511

Query: 503 -PSNLNGTRPXXXXXXXXXXXX-XXRNDN-------------ASSNSRISNLPSLPTPKP 547
            P      RP               RN N             + + S  +  P L +P  
Sbjct: 512 QPKKPVPYRPTSPVASSSTQVQNTKRNSNYTPTYLKSKTKGESRAQSNAALFPPLSSPDT 571

Query: 548 KVY-IPPVRQTVIPDPNSWG--RRGPQQTNGDVLEGISNLNMNGNSSSQTT--RGSGKRK 602
           K +  PPV +  +PDP  WG  +R P ++          L+M+   S+  T  +  GK+K
Sbjct: 572 KKFRAPPVNE--LPDPKQWGKSKREPSRS-------AEALDMSPIESALPTSGKSKGKQK 622

Query: 603 QKQLLFHIGI 612
           QKQLLFH+G+
Sbjct: 623 QKQLLFHVGL 632

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 68/165 (41%), Gaps = 33/165 (20%)

Query: 164 LNEHLKLEHNNKTI-CMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFC 222
           LN H+    ++K   C IC            + T  QLK H  + + T  F  H   + C
Sbjct: 152 LNRHMFSHTDDKPFTCSICGK---------GVTTRQQLKRH--EITHTKSF--HCSYEGC 198

Query: 223 SNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSH-------YIC 275
            N+ FY   +L SH+   HE+   C    H N  F + Y +L +H    H       Y C
Sbjct: 199 -NESFYKHPQLRSHILSVHEKKLTC---PHCNKTFQRPY-RLKNHIDKHHNPESTGMYQC 253

Query: 276 TFQTCLDDKFIVFKDDMELQAHILQEHGDL---IRGKPKFFQSEL 317
            F +C D    VF     LQ HI Q H  L   I GKP   +S L
Sbjct: 254 DFLSCTD----VFSTWSSLQQHIKQCHPKLPCPICGKPCVAESGL 294

>Kwal_27.10723
          Length = 229

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 18/87 (20%)

Query: 15  GGSNTTTTDNKKKQHSHRHEEINDDDENV-------------CVICANPIKFAAWSPCNH 61
           GGSN+ + D + +  S +  EI+DD+                C IC  P + A  +PC H
Sbjct: 123 GGSNSNS-DLENEAKSQQVVEISDDEAVASPRPQHKRALDYKCPICFEPPEAALVTPCGH 181

Query: 62  KTCHKCSFRQLALFDKKS----CLICR 84
             C +C F+ +     +S    C +CR
Sbjct: 182 VFCTECLFQMVNSSRGQSRAGHCALCR 208

>CAGL0I08877g complement(862359..863393) similar to sp|P53292
           Saccharomyces cerevisiae YGR165w, hypothetical start
          Length = 344

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 7/105 (6%)

Query: 57  SPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNSNMWQTDLI 116
           +P N +       RQL  F   S   C+T++     + +E+L +Q Y D  +N   T  +
Sbjct: 118 APHNKRLEDVSERRQLQPFP--SNPHCKTNY-----MVSEELKAQIYNDIETNGLSTQQV 170

Query: 117 NTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSF 161
           +  YG+K    +   + + + K    +  I     VM+ T YK F
Sbjct: 171 SHNYGLKIPRVEAIVKLMKVEKKWEKLNRISPDLKVMSETLYKMF 215

>KLLA0C08041g complement(705516..707240)
          gi|24741192|emb|CAD56154.1 Kluyveromyces lactis
          CCr4/NOT complex/transcription factor subunit, start by
          similarity
          Length = 574

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 36 INDDDENVCVICANPI----KFAAWSPCNHKTCHKC--SFRQLALFDKKSCLICRTDFDN 89
          ++DD+E++C +C  P+    K     PC ++ C  C  + RQ    + + C  CR  +D+
Sbjct: 30 LSDDEEDLCPLCIEPLDVMDKHFKPCPCGYQICQFCYNNIRQNPELNGR-CPACRRKYDD 88

Query: 90 NSMIF 94
           S+ +
Sbjct: 89 ESVEY 93

>Sklu_2385.9 YLR107W, Contig c2385 14207-15391 reverse complement
          Length = 394

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 11  RRTQGGSNTTTTDNKKKQHSHRHEEINDDDENVCVICANPIKFAAWSP------CNHKTC 64
           RR +GG  TTT  +KK     + +E+    E++ V      K  A SP      C + +C
Sbjct: 89  RRVRGGQGTTTVLSKKADVIKKLKEML-LAEDLLVQNGYITKLYAMSPEESVSSCLYISC 147

Query: 65  HKCS--FRQLALFDKKSC 80
           H+CS  F++  + +K  C
Sbjct: 148 HRCSTKFKKDEIMEKTMC 165

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 44   CVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMI-FTEKLNS 100
            C IC  PI   A   C H  C  C F  L   ++K+C +C+    N  +  FT KL S
Sbjct: 1164 CSICLQPITNGAMVNCGHLFCTSCIFSWLK--NRKTCPLCKHPTSNCEVYNFTFKLES 1219

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 4/48 (8%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQL----ALFDKKSCLICRTDF 87
           C IC +P + A  +PC H  C  C F+ +           C +CR D 
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDV 220

>Scas_721.100
          Length = 1137

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 10/144 (6%)

Query: 44   CVICAN---PIKFAAWSPCNHKTCHKCSFRQLALFDKKS----CLICRTDFDNNSMIFTE 96
            C IC     P+    ++ C H  C  C          K+    C  CR   ++N ++  E
Sbjct: 884  CSICTTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQINSNRLLTVE 943

Query: 97   KLNSQAY--EDFNSNMWQTDLINTKYGIKFTSDDVAKETLNL-SKFICSVCIIEDKENVM 153
            K+ ++ +  + + +N+    L      ++   D  A E + + S+F   + I+ED+    
Sbjct: 944  KIEAETFKLKHYENNLKPAKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEA 1003

Query: 154  NATDYKSFKKLNEHLKLEHNNKTI 177
              TD     K +  L L+  +  +
Sbjct: 1004 FPTDVAKIYKFDGRLSLKERSTVL 1027

>YDR516C (EMI2) [1329] chr4 complement(1474962..1476464) Protein
           possibly required for full induction of IME1 during
           early meiosis [1503 bp, 500 aa]
          Length = 500

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 19/188 (10%)

Query: 93  IFTEKLNSQAYEDFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENV 152
           ++ E+L+ Q     N      D + T     +TS         +S+ +   CI     N 
Sbjct: 198 LYQEQLDIQGLSMINVVALTNDTVGTFLSHCYTSGSRPSSAGEISEPVIG-CIFGTGTNG 256

Query: 153 MNATDYKSFKKLNEHLK--LEHNNKTICMICADHHF-SFPSELK-IYTTNQLKNHNNKGS 208
               D ++ KKL + L+  L H  KT   +C +  + SF +ELK +  T    + + K S
Sbjct: 257 CYMEDIENIKKLPDELRTRLLHEGKT--QMCINIEWGSFDNELKHLSATKYDIDIDQKFS 314

Query: 209 ETDGFKGHPMCKFCSNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHF 268
              G+  H   K  S    Y  + L + + + H R  I  +        ++NYDQL H  
Sbjct: 315 PNPGY--HLFEKRISG--MYLGELLRNILVDLHARGLILGQ--------YRNYDQLPHRL 362

Query: 269 KNSHYICT 276
           K    +C+
Sbjct: 363 KTPFQLCS 370

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 6/36 (16%)

Query: 219 CKFCSNKRFYSQDELMSHMR-----EKHERCHICDK 249
           C+FC ++RF  Q+ L  H+R     EK   CHIC+K
Sbjct: 266 CEFC-DRRFKRQEHLKRHIRSLHMGEKPYECHICNK 300

>Scas_672.2
          Length = 263

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 4/48 (8%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQL---ALFDKKS-CLICRTDF 87
           C IC +P + A  +PC H  C  C F+ +     + K   C +CR + 
Sbjct: 197 CPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEV 244

>Scas_720.89
          Length = 469

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNS--- 100
           C IC + +K    +PC+H  C  C  R+  L D   C +C  +    SM+ +E L +   
Sbjct: 28  CHICKDFLKVPVLTPCSHTFCSLC-IREY-LKDNSKCPLCLNEL-RESMLRSEFLVNEIV 84

Query: 101 QAYEDFNSNMWQ 112
           Q+Y+   S++ +
Sbjct: 85  QSYQSLRSDLLE 96

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 8/83 (9%)

Query: 8    RNFRRTQGGSNTTTTDNKK------KQHSHRHEEINDDDENVCVICANPIKFAAWSPCNH 61
            R   ++ GG+     +N +      K  S   + +ND+    C IC   ++  A   C H
Sbjct: 1197 RTINKSLGGTLDAKINNIESRLIYLKNLSRLKDTLNDNQILSCSICLGEVEIGAIIKCGH 1256

Query: 62   KTCHKCSFRQLALFDKKSCLICR 84
              C  C    L    K  C IC+
Sbjct: 1257 YFCKSCILTWLRAHSK--CPICK 1277

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQL--ALFDKKS--CLICR 84
           C IC  P   A  +PC H  C +C F+ +  +   +K   C +CR
Sbjct: 146 CPICFEPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCR 190

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 6/36 (16%)

Query: 219 CKFCSNKRFYSQDELMSHMR-----EKHERCHICDK 249
           C+FC ++RF  Q+ L  H+R     EK   CHIC+K
Sbjct: 391 CEFC-DRRFKRQEHLKRHVRSLHMCEKPFTCHICNK 425

>Scas_573.9
          Length = 1502

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 47/110 (42%), Gaps = 14/110 (12%)

Query: 11   RRTQGGSNTTTTDNK--KKQHSHRHEEINDDDENVCVICANPIKFAAWSPCNHKTCHKCS 68
            R  +   NTT +  K  K   S R E I ++    C IC   I   +   C H  C +C 
Sbjct: 1157 RTIEKNINTTESRIKYLKGLQSLR-ESIENNKSFKCSICLQDISLGSMLKCGHFFCKRCI 1215

Query: 69   FRQLALFDKKSCLICRTDFDNNSMIF-----TEKL---NSQAYEDFNSNM 110
               L   +KK+C +C+      S I+      EKL    SQ  ED N+N+
Sbjct: 1216 TSWLK--NKKNCPMCKM-VTTASEIYNFKFKEEKLEGDTSQMNEDLNNNI 1262

>Scas_602.9
          Length = 547

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 13/56 (23%)

Query: 219 CKFCSNKRFYSQDELMSHMR-----EKHERCHICDKIDHNNPQFFKNYDQLFHHFK 269
           C +C  +RF  Q+ L  H+R     EK   CHIC+K        F   D L  H K
Sbjct: 497 CDYCE-RRFKRQEHLKRHVRSLHIGEKPYACHICNK-------NFSRSDNLTQHIK 544

>Scas_592.2
          Length = 633

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 44  CVIC-ANPIKFAAWSPCN-HKTCHKCSFRQLALFDKKSCLICRTD 86
           CV+C  NP     W PC     C+ C    LA+ D K C+ CR D
Sbjct: 577 CVVCKINPRNVVLW-PCRCFALCNDCRV-SLAVRDYKKCVCCRAD 619

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 39  DDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICR 84
           +D   CV+C N +   + +PC H  C  C        +++ C +CR
Sbjct: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEW--TLERQECPLCR 293

>Kwal_47.17241
          Length = 403

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 25/56 (44%), Gaps = 13/56 (23%)

Query: 219 CKFCSNKRFYSQDELMSHMR-----EKHERCHICDKIDHNNPQFFKNYDQLFHHFK 269
           C FC ++RF  Q+ L  H+R     EK   CHIC K        F   D L  H K
Sbjct: 348 CDFC-DRRFKRQEHLKRHVRSLHMGEKPFDCHICGKK-------FSRSDNLNQHIK 395

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAY 103
           C IC + +K    +PC H  C  C   +  L ++ +C +C  +F   S++ +E L S+  
Sbjct: 28  CHICKDFLKVPVLTPCGHTFCSLCI--RTHLNNQPNCPLCLFEF-RESLLRSEFLVSEII 84

Query: 104 EDFNS 108
           + + S
Sbjct: 85  QSYTS 89

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 13/56 (23%)

Query: 219 CKFCSNKRFYSQDELMSHMR-----EKHERCHICDKIDHNNPQFFKNYDQLFHHFK 269
           C++C ++RF  Q+ L  H+R     EK   CH+C K        F   D L  H K
Sbjct: 420 CEYC-DRRFKRQEHLKRHIRSLHICEKPYGCHLCGKK-------FSRSDNLSQHLK 467

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
          for normal resistance to NaCl and for normal mating
          efficiency of MATa cells, contains a C3HC4-type zinc
          finger [1221 bp, 406 aa]
          Length = 406

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 43 VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKK--SCLICRTDF 87
          VC IC + +     +PC H  C+ C     A   +K  +C  CR+D 
Sbjct: 29 VCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>KLLA0C08756g complement(765847..767130) weakly similar to
          sp|P10862 Saccharomyces cerevisiae YCR066w RAD18 DNA
          repair protein singleton, start by similarity
          Length = 427

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 44 CVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTE 96
          C IC + +K +  +PC H  C  C  + L    K  C +C +D    SM+  E
Sbjct: 32 CHICKDFLKASVLTPCGHSFCSICIRKYLQKESK--CPLCLSDL-TESMLQKE 81

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 20/100 (20%)

Query: 158 YKSFKKLNEHLKLEH----NNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGF 213
           + S ++LN+HL+  H     ++  C+   D H +FP   K+     LK H    S+   +
Sbjct: 716 FSSAQELNDHLEAVHLTRGKSEYQCLW-HDCHRTFPQRQKL--IRHLKVH----SKYKPY 768

Query: 214 KGHPMCKFCSNKRFYSQDELMSHMR----EKHERCHICDK 249
           K    CK C  + F S++ L+ H R    EK  +CHIC+K
Sbjct: 769 K----CKTCK-RCFSSEETLVQHTRTHSGEKPYKCHICNK 803

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 34   EEINDDDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTD 86
            EE  + +E  C +C N I   +   C H  C+ C    L   +  +C +C+T+
Sbjct: 1155 EEHKEGEELSCAVCFNEIFVGSVVKCGHFFCYSCIHTWLK--EHNTCPLCKTN 1205

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 44  CVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFT 95
           C +C+   K  A   C H  C +C   +LA   +K C  C   F  N ++  
Sbjct: 595 CSLCSKNWKNTAIKSCGHVFCEECCKERLAARMRK-CPTCNKGFSANDLLVV 645

>Scas_712.3
          Length = 486

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 65/167 (38%), Gaps = 31/167 (18%)

Query: 41  ENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNS 100
           E V  I     K A   P +      C +     FD ++ ++ RT +D      + + N 
Sbjct: 242 EQVSDISKLEGKLADDIPSSFPMAINCEYGS---FDNENAVLPRTKYDLQIDAESPRPNQ 298

Query: 101 QAYEDFNSNMWQTDLINT------KYGIKFTSDDVAKETLNLSKFICSVC----IIED-- 148
           QAYE  +S  +  ++I        K G+ F   DV K  LN + +I        + ED  
Sbjct: 299 QAYEKMSSGYYLGEVIRLVLVDYHKQGLIFKDQDVTK--LN-TPYIMDTSFPARVEEDPF 355

Query: 149 -----------KENVMNAT--DYKSFKKLNEHLKLEHNNKTICMICA 182
                      KE  +NAT  + K  ++L E + L      +C I A
Sbjct: 356 ENLENTDELLQKELGINATVQERKLIRRLCELVGLRAARLGVCAISA 402

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,543,406
Number of extensions: 930963
Number of successful extensions: 3330
Number of sequences better than 10.0: 68
Number of HSP's gapped: 3355
Number of HSP's successfully gapped: 79
Length of query: 612
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 504
Effective length of database: 12,857,365
Effective search space: 6480111960
Effective search space used: 6480111960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)