Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_697.1769469428050.0
YHR131C8402366736e-77
Kwal_33.146297192306193e-70
YNL144C7402296195e-70
KLLA0E23056g8182266164e-69
CAGL0G06182g6812255631e-62
AFR049W7172315097e-55
Scas_654.225802594879e-53
CAGL0J05830g6072392533e-22
KLLA0A08206g23078860.016
ACR228C112933675.5
Scas_721.8868949676.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_697.17
         (694 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_697.17                                                          1085   0.0  
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   263   6e-77
Kwal_33.14629                                                         243   3e-70
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   243   5e-70
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   241   4e-69
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   221   1e-62
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   200   7e-55
Scas_654.22                                                           192   9e-53
CAGL0J05830g complement(552107..553930) some similarities with s...   102   3e-22
KLLA0A08206g 730940..731632 no similarity, hypothetical start          38   0.016
ACR228C [1275] [Homologous to ScYBL063W (KIP1) - SH] (758111..76...    30   5.5  
Scas_721.88                                                            30   6.0  

>Scas_697.17
          Length = 694

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/694 (78%), Positives = 548/694 (78%)

Query: 1   MSLLINTRNRDNTTPIHVQNIEXXXXXXXXXXXXAVEEVCXXXXXXXXXXXXXNHCLTDS 60
           MSLLINTRNRDNTTPIHVQNIE            AVEEVC             NHCLTDS
Sbjct: 1   MSLLINTRNRDNTTPIHVQNIESLKSPSSNSSLSAVEEVCTSTSTSNTTIGSSNHCLTDS 60

Query: 61  SQATTPIATHTSPLKPHINLLRDDPNEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTA 120
           SQATTPIATHTSPLKPHINLLRDDPNEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTA
Sbjct: 61  SQATTPIATHTSPLKPHINLLRDDPNEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTA 120

Query: 121 PCPINELPPSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESL 180
           PCPINELPPSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESL
Sbjct: 121 PCPINELPPSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESL 180

Query: 181 TSHIRNYXXXXXXXXXXXXXXXXXFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYK 240
           TSHIRNY                 FGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYK
Sbjct: 181 TSHIRNYSNDSSSSSPSKQRSTFSFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYK 240

Query: 241 SYSLQFAKFGLPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLEL 300
           SYSLQFAKFGLPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLEL
Sbjct: 241 SYSLQFAKFGLPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLEL 300

Query: 301 RALPDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEQSLIPDXXXXXXXXXXXXX 360
           RALPDY                                 DEQSLIPD             
Sbjct: 301 RALPDYRTVPRRRRRRRRHGMRRGTHRRRRTNYRNTTHRDEQSLIPDLLNLVISSNGNNN 360

Query: 361 XXXXXXXXXXXXXXXXMLGNKNSTSSFKSKLKNLFGCPSRTSTPRAKPRATKSSLNCVME 420
                           MLGNKNSTSSFKSKLKNLFGCPSRTSTPRAKPRATKSSLNCVME
Sbjct: 361 NTPSVVTRPRSSTSVSMLGNKNSTSSFKSKLKNLFGCPSRTSTPRAKPRATKSSLNCVME 420

Query: 421 VEDEMPPFNGESAKNTCPAVEGSTCLRSKRVRSSSTPNLITPPLSRRTTVSHERELNELH 480
           VEDEMPPFNGESAKNTCPAVEGSTCLRSKRVRSSSTPNLITPPLSRRTTVSHERELNELH
Sbjct: 421 VEDEMPPFNGESAKNTCPAVEGSTCLRSKRVRSSSTPNLITPPLSRRTTVSHERELNELH 480

Query: 481 QVLREYNESSADRLPTNVXXXXXXXXXXXXXXXXXXXXXXXVISHNSVYDEEGIFHYNET 540
           QVLREYNESSADRLPTNV                       VISHNSVYDEEGIFHYNET
Sbjct: 481 QVLREYNESSADRLPTNVEDEEAEDNEEEEDDDDDDDIDDDVISHNSVYDEEGIFHYNET 540

Query: 541 DEYEYSYAQXXXXXXXXXXXXXXXXXXXMSSVPYSSDEIKWTPPLKITPRRKYIRNSLRC 600
           DEYEYSYAQ                   MSSVPYSSDEIKWTPPLKITPRRKYIRNSLRC
Sbjct: 541 DEYEYSYAQSITTNSTSYRRRTSSLISTMSSVPYSSDEIKWTPPLKITPRRKYIRNSLRC 600

Query: 601 IVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVK 660
           IVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVK
Sbjct: 601 IVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVK 660

Query: 661 NHYLKAYVVGPAKFKRANPETLCNWNERTKREGR 694
           NHYLKAYVVGPAKFKRANPETLCNWNERTKREGR
Sbjct: 661 NHYLKAYVVGPAKFKRANPETLCNWNERTKREGR 694

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  263 bits (673), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 163/236 (69%), Gaps = 16/236 (6%)

Query: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146
           +  + ID  P  PP+Y+ +NPNK + FPI+  TAPCP + LPP Y PAV ELT++S+KLE
Sbjct: 72  DLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLE 131

Query: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYXXXXXXXXXXXXXXXX--- 203
            LSPY++S  R+W+N I+EINSTQLNFYHIDESLT HIRNY                   
Sbjct: 132 RLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVH 191

Query: 204 -------------XFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFG 250
                            R+  EF K DQE+I++R+KR++  YL+++ LYKS++LQ A+FG
Sbjct: 192 RSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFG 251

Query: 251 LPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           +P DY KK++VLR+ CESEQFLL F+H+DDMI W+MYL++GISV+LDLE+R  PDY
Sbjct: 252 IPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDY 307

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 18/110 (16%)

Query: 569 MSSVPYSSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNN 628
            S++PY +D+IKW P +K   RR+Y+R+SL+CI PF++  + +  ++  P +GP F+T+N
Sbjct: 682 FSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTFETSN 741

Query: 629 SPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRAN 678
                                 ++   L + KNH+LK ++VGP      N
Sbjct: 742 K------------------IHFSNRQSLQKQKNHFLKGFIVGPTALIELN 773

>Kwal_33.14629
          Length = 719

 Score =  243 bits (619), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 114/230 (49%), Positives = 153/230 (66%), Gaps = 14/230 (6%)

Query: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146
           +    ID  P  PP+Y   +P++R+ FP++E      +    P Y PAVE +T+VSMKLE
Sbjct: 73  DLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSL----PGYSPAVEAITVVSMKLE 128

Query: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYXXXXXXXXXXXXXXXXXF- 205
           WL PY  SP R+WKN +MEINSTQLNFY ID +LT  I+NY                 + 
Sbjct: 129 WLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYE 188

Query: 206 ---------GNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYK 256
                     ++ TY+FNK DQE I+ +I  NK  YL+++KL++SYSLQFAK+G+P DY 
Sbjct: 189 SHHSIFSSLSSKNTYQFNKADQECISKKISNNKSKYLTDNKLFRSYSLQFAKYGIPTDYN 248

Query: 257 KKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           +KT+VLR+RCE+EQF+L+F+HVDDMIMW MYL++GI V+LDL+ R LP Y
Sbjct: 249 RKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTY 298

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 83/156 (53%), Gaps = 10/156 (6%)

Query: 527 SVYDEEGIFHYNETDEYEYSYAQXXXXXXXXXXXXXXXXXXXMSSVPYSSDEIKWTPPLK 586
           S+Y EEGIFH +E D+Y Y   +                   +SS PY S ++KW PP K
Sbjct: 567 SIYQEEGIFHDSE-DDYYYVVDRNDAFRRRASSVTSN-----LSSTPYGSGDVKWHPPRK 620

Query: 587 ITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKKL 646
              RR+YIR+SLRCI P  +   W+  ++++P + P + TNN PI+G +  T  S + K 
Sbjct: 621 EMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPISGFVGGTGKSGKSKA 680

Query: 647 LAGCTSGSD----LNRVKNHYLKAYVVGPAKFKRAN 678
               +S SD    L + KNHY K Y+VGP    + N
Sbjct: 681 SPNKSSKSDKGVILQKCKNHYAKPYIVGPVGLLKTN 716

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  243 bits (619), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 114/229 (49%), Positives = 154/229 (67%), Gaps = 11/229 (4%)

Query: 89  LQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLEWL 148
           L CID  PV PP Y+  NP+K I +PI+EH  PC  +  PPSY P+VE  T+VSMK+E L
Sbjct: 89  LYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYTVVSMKMEKL 148

Query: 149 SPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNY-----------XXXXXXXXXX 197
           SP++ +  R W N I++INSTQ+NFY ID+SLT HI+NY                     
Sbjct: 149 SPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDMFDHSHHSKTASDRHHS 208

Query: 198 XXXXXXXFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYKK 257
                  F  ++TY+F+K D+E+I   I R++  +LS+++L+KSYSLQ AK GLPIDY  
Sbjct: 209 ARSLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDERLFKSYSLQCAKVGLPIDYSS 268

Query: 258 KTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           + +VLR+RCE +QFL+ F+HVD++I W MYLNMGIS++LDLELR +P Y
Sbjct: 269 RDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTY 317

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 15/115 (13%)

Query: 575 SSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGS 634
           SS++ KW P  ++  R++YI++SLRCI P  E+  W+  I+ KP   P F+TNN PI   
Sbjct: 635 SSNDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPI--- 691

Query: 635 LDSTCTSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRANPETLCNWNERT 689
                     ++ +G  S +DL  VKNHYLK Y+VG   F +   + L ++ +RT
Sbjct: 692 ----------RVYSGEDS-TDLMHVKNHYLKPYIVGSCGFLKTGSK-LFHFYDRT 734

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  241 bits (616), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 156/226 (69%), Gaps = 10/226 (4%)

Query: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146
           E+ Q +D+ P  PP+Y  +N N+RI +PI+E       + + P Y PAV+ +T++S+K E
Sbjct: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLD----DNVLPGYSPAVKAITVISLKQE 179

Query: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYXXX------XXXXXXXXXX 200
           WL+PY++S  R WKN IMEINSTQLNFYHI ESLTS+I+NY                   
Sbjct: 180 WLNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTR 239

Query: 201 XXXXFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYKKKTY 260
                 +++TY+FN++DQ+ I   I+ N+K YLSND L+KS+SLQ+ KFG+P DY KKT+
Sbjct: 240 FLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTF 299

Query: 261 VLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           VLRLRCE +QFL+NFAHVDDMI W++ L++GI V+LDL  R +P Y
Sbjct: 300 VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 87/159 (54%), Gaps = 12/159 (7%)

Query: 526 NSVYDEEGIFHYNETDEYEYSYAQXXXXXXXXXXXXXXXXXXXMSSVPYSSDEIKWTPPL 585
           +S+Y EEGIFH +  D+Y Y   +                   +S+ PY  DE+KW PP 
Sbjct: 667 SSIYHEEGIFH-DSDDDYIYVPTEIHRRRTSSITSN-------LSNTPYGGDEMKWNPPR 718

Query: 586 KITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKK 645
           K   RR+YIR+SLRCI P   + +W++ I + P+ GPK++TNN P++G + ++  S + K
Sbjct: 719 KEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFISNSDLSSKNK 778

Query: 646 L----LAGCTSGSDLNRVKNHYLKAYVVGPAKFKRANPE 680
                L        L+R KNHYL  Y++ P+   RA P+
Sbjct: 779 FSLKKLYNTQPALLLSRCKNHYLTPYIITPSGLVRAIPK 817

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  221 bits (563), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 149/225 (66%), Gaps = 6/225 (2%)

Query: 88  FLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLEW 147
           +L+ ID +P SPP+Y+E+N N+ + FPIWE   PC + E PP+Y P V  + IVS+KLEW
Sbjct: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110

Query: 148 LSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRN-YXXXXXXXXXXXXXXXXXFG 206
           LSP++ SP R+W+  IMEINSTQ+NFY ++      ++N Y                  G
Sbjct: 111 LSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILSLG 170

Query: 207 NRTTYEFNK-NDQE----QIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYKKKTYV 261
           N      NK  D E    ++  +++RN   YLS+ +LY+S++LQ+A+ G+P DY+K  + 
Sbjct: 171 NSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSAHA 230

Query: 262 LRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           LRLRCE+EQFL+ F +VDD+I W+MY+NMGISVALDL+ R LP+Y
Sbjct: 231 LRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 78/168 (46%), Gaps = 15/168 (8%)

Query: 527 SVYDEEGIFHYNETDEYEYSYAQXXXXXXXXXXXXXXXXXXXMSSVPYSSDEIKWTPPLK 586
           S+Y EEG+ H +E+D   Y Y Q                          +D++KW PP K
Sbjct: 520 SIYAEEGLVHESESD---YYYEQRRLTRSRAASTASNMISHA------DADDVKWMPPQK 570

Query: 587 ITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPI---AGSLDSTCTSYR 643
           I  RR+Y+++SLRCI  F+E ++W+  +V  PT  P FKTNN  +      +D       
Sbjct: 571 ILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKIDEKTVGNS 630

Query: 644 KKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRANPETLCNWNERTKR 691
           +  +   +      + KNH+L+ Y++ P  +    P T    NE  K+
Sbjct: 631 RNKIVNSSGDKSYWKTKNHFLQLYIIEPTGYI---PITALEANEARKK 675

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  200 bits (509), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 97/231 (41%), Positives = 141/231 (61%), Gaps = 15/231 (6%)

Query: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146
           + L  +  +P  PP Y  +NPN+RI +PI+E       NELP +Y PAV EL +VS+K E
Sbjct: 62  DVLAVLQPQPARPPPYYAVNPNRRIRYPIYERE---ETNELP-AYAPAVHELALVSVKQE 117

Query: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYXXXXXXXXX-XXXXXXXXF 205
           W SPY+ +  R+W+ L+ME+NSTQLNFYH+DE L   +R                    F
Sbjct: 118 WASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSF 177

Query: 206 G----------NRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDY 255
           G           R   + +   Q+ +  R +R+ + +L  ++LYKSYSLQ+A FG+P+DY
Sbjct: 178 GQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDY 237

Query: 256 KKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
            K+++VLRLRCE+EQFL+ F  VD +I W++ L++GI V+LDL+ R +P Y
Sbjct: 238 TKRSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAY 288

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 72/170 (42%), Gaps = 23/170 (13%)

Query: 526 NSVYDEEGIFHYN-------------------ETDEYEYSYAQXXXXXXXXXXXXXXXXX 566
            S+Y++EGI+H +                     D     YA                  
Sbjct: 540 TSIYEDEGIYHSDDDDDDDDDDDDDDDGAGSAAADTATQDYAARSRALDMEFRQRAHSAA 599

Query: 567 XXMSSVPY--SSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKF 624
             +S  PY  S    KW PP+K + RR+++R+S+RCI P  ++  W+  +VV P+AGP  
Sbjct: 600 SSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVVSPSAGPGS 659

Query: 625 KTNNSPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKF 674
            ++  P    L S     R+ L  G  S S     +  ++KAY+VGP   
Sbjct: 660 SSSGFPFDLGLGSKRLGSRRSLKRGSQSLSGTRAAR--FMKAYIVGPVGL 707

>Scas_654.22
          Length = 580

 Score =  192 bits (487), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 147/259 (56%), Gaps = 29/259 (11%)

Query: 67  IATHTSPLKPHINLLRDDPNEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINE 126
           I  H     P I    D  NEFL  ID  PV PP Y+ MNP+++I+FPI+E         
Sbjct: 69  IHEHKEFQPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQP 128

Query: 127 LPPSYKPAVEELTIVSMKLEWLSPYDVSPLR----TWKNLIMEINSTQLNFYHIDESLTS 182
            PPSY PAV+E+T+VSMKLEW SP  ++P+R     WK ++ME+NSTQLNFY +D  L S
Sbjct: 129 APPSYSPAVDEITLVSMKLEWESP--MAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQS 186

Query: 183 HIRNYXXXXXXXXXXXXXXXXXFG---NR----TTYEFNKNDQEQIAFRIKRNKKLYLSN 235
            ++                   FG   NR    T   + K+D E+I   I+RNK  YL +
Sbjct: 187 QLKK--------TIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHD 238

Query: 236 DKLYKSYSLQFAKFGLPIDYKKKT--------YVLRLRCESEQFLLNFAHVDDMIMWTMY 287
             L KSYSLQF + G P D   K           LRLRCE++QFLL F  +D +IM  ++
Sbjct: 239 ANLVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVH 298

Query: 288 LNMGISVALDLELRALPDY 306
           ++MGISV+LDL++R LP Y
Sbjct: 299 IDMGISVSLDLQIRELPTY 317

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 59/113 (52%), Gaps = 13/113 (11%)

Query: 575 SSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGS 634
           S D+ KW+P  K T RR+Y+R+SLRCI    E   W+  +V  PT  P F+TNN P+   
Sbjct: 478 SDDDYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLF-- 535

Query: 635 LDSTCTSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRANPETLCNWNE 687
                      +  G  + +  +  KNHYLKA+VVG  +  +A  +    WNE
Sbjct: 536 -----------IGKGPHASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDAWNE 577

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 103/239 (43%), Gaps = 67/239 (28%)

Query: 129 PSYKPAVEELTIVSMKLEWLSPYDVSPLRTWKNLIMEINSTQLNFY-------------- 174
           P Y PAVE+      KLEW SP  VS    W ++++ INSTQLN Y              
Sbjct: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSL 100

Query: 175 -------------HIDESLTSHIRNYXXXXXXXXXXXXXXXXXFGNRTTYEFNKNDQEQI 221
                         + E  T   +NY                      T  +    Q+ +
Sbjct: 101 SYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGF------TNSYQNMPQDAL 154

Query: 222 AFRIKRNKK---LYLSNDKLY-----------------KSYSLQFAKFGLPI-DYKKKTY 260
             R KR+ +   +Y +N + Y                 KSYSLQ AK G+P  + +KK Y
Sbjct: 155 GARKKRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVY 214

Query: 261 V-------------LRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306
           +             LRLR E +QFL+ F H+DDMIMW+MYL+MGI+V+ DL  R  P+Y
Sbjct: 215 IDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNY 273

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 578 EIKWTPPLKITPRRKYIRNSLRCIVPFIEETNW-IDNIVVKPTAGPKFKTNN 628
           + KW P  K   R++YIR+SLRCI P   +  W  + I VK  AG + K  N
Sbjct: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVK--AGLRNKMYN 585

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 15/78 (19%)

Query: 229 KKLYLSNDKLY----------KSYSLQFAKFGLPIDYKKKTYVLRLRCESEQFLLNFAHV 278
           K LYL  DK            K YSLQ  + GL  D  +    LR+RCE EQFLL     
Sbjct: 135 KGLYLEKDKSLNLIQWNRDPIKKYSLQDCRIGLNTDMSR---CLRIRCEREQFLLRVP-- 189

Query: 279 DDMIMWTMYLNMGISVAL 296
           DD  + +++  +  +  L
Sbjct: 190 DDASVTSLFAKIACAAEL 207

>ACR228C [1275] [Homologous to ScYBL063W (KIP1) - SH] (758111..761500)
            [3390 bp, 1129 aa]
          Length = 1129

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 101  NYNEMNPNKRINFPIWEHTAPCPINELPPSYKP 133
            N N+ + N R + PI EH     INELPP Y P
Sbjct: 985  NINKPDANVRTSVPI-EHELNSAINELPPLYMP 1016

>Scas_721.88
          Length = 689

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 646 LLAGCTSGSDLNRVKNHYLKAY------VVGPAKFK-RANPETLCNWNE 687
           L+AGCT+ S+L  +  + LK Y      V G  K+K   NPE L  W++
Sbjct: 11  LIAGCTTASELVGLSPNKLKEYHDNIVTVDGIKKWKCLGNPEILVEWSQ 59

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,879,377
Number of extensions: 797244
Number of successful extensions: 2074
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2106
Number of HSP's successfully gapped: 30
Length of query: 694
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 585
Effective length of database: 12,822,747
Effective search space: 7501306995
Effective search space used: 7501306995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)