Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_696.3732232215660.0
CAGL0F03443g3122917067e-92
YMR274C (RCE1)3153246875e-89
KLLA0D01705g3212924537e-54
Kwal_27.103143152734451e-52
AAL186W3192863928e-45
Sklu_2432.9147572662.8
YBR161W (CSH1)37646628.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_696.37
         (322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_696.37                                                           607   0.0  
CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   276   7e-92
YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   269   5e-89
KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   179   7e-54
Kwal_27.10314                                                         176   1e-52
AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   155   8e-45
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              30   2.8  
YBR161W (CSH1) [346] chr2 (561591..562721) Protein with high sim...    28   8.4  

>Scas_696.37
          Length = 322

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/322 (92%), Positives = 299/322 (92%)

Query: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60
           MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV
Sbjct: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60

Query: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGHWXXXXXXXXXXXGIWVVTLLYV 120
           PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGHW           GIWVVTLLYV
Sbjct: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGHWDISSYYYDIISGIWVVTLLYV 120

Query: 121 GPLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPI 180
           GPLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPI
Sbjct: 121 GPLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPI 180

Query: 181 ESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIF 240
           ESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIF
Sbjct: 181 ESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIF 240

Query: 241 LRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSXXXXXXX 300
           LRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKS       
Sbjct: 241 LRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSYIFLLFL 300

Query: 301 XXXXXKANIDTLIYSREYSIDV 322
                KANIDTLIYSREYSIDV
Sbjct: 301 GIYLFKANIDTLIYSREYSIDV 322

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  276 bits (706), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 193/291 (66%), Gaps = 9/291 (3%)

Query: 2   LNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVP 61
           +N+  FC+   IS+SYVAV+Y +SK    YP   RDDP VIKRR++ VLM++  N  +VP
Sbjct: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPA-RRDDPRVIKRRLKNVLMVSILNTAIVP 59

Query: 62  FLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGHWXXXXXXXXXXXGIWVVTLLYVG 121
            L  +I          +S   A +N+GI+PG+++ G              + +V LLY+G
Sbjct: 60  LLHSIIV-------PQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKNLCLVMLLYIG 112

Query: 122 PLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIE 181
           PL D+ L+Y+  K  ++   +++EF NI+ LRNYIFAPITEE+FYTS+LLNTYL L P +
Sbjct: 113 PLTDMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRK 172

Query: 182 SLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFL 241
              L TLLWQPSLFF +AHIHHAY +   G+ +  +I++NT+ Q  YT +FGAFTNF+FL
Sbjct: 173 P-KLTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFL 231

Query: 242 RTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNK 292
           RTGGNLW+C+  HSFCN+MGFP  S L  +FT+I+  K    + L++ WNK
Sbjct: 232 RTGGNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNK 282

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  269 bits (687), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 191/324 (58%), Gaps = 11/324 (3%)

Query: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60
           ML F  F VL YISISYV  +YA+S+         RD+P  IK R++K+ ++   N+ LV
Sbjct: 1   MLQFSTFLVLLYISISYVLPLYATSQPEGS----KRDNPRTIKSRMQKLTIMLISNLFLV 56

Query: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYR--DGHWXXXXXXXXXXXGIWVVTLL 118
           PFLQ  +     ST S IS   A + LGI+PG+Y      W            + ++  L
Sbjct: 57  PFLQSQL----SSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTL 112

Query: 119 YVGPLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLC 178
           Y GP++D  L+++     ++  D+  EF NI+  RN+IFAPITEEIFYTSMLL TYL L 
Sbjct: 113 YCGPVLDFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLI 172

Query: 179 PIESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNF 238
           P   LS + L WQPSLFFGLAH HHAY   + G    ++IL+ T  Q  YTTLFG  T F
Sbjct: 173 PHSQLSYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKF 232

Query: 239 IFLRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSXXXXX 298
           +F+RTGGNLW C+  H+ CNIMGFPG SRL+LHFT++++  G    KL++ WNK      
Sbjct: 233 VFVRTGGNLWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGR-ISKLVSIWNKCYFALL 291

Query: 299 XXXXXXXKANIDTLIYSREYSIDV 322
                  K  + TL+ +  Y I +
Sbjct: 292 VLGLISLKDTLQTLVGTPGYRITL 315

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  179 bits (453), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 159/292 (54%), Gaps = 27/292 (9%)

Query: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60
           M + PA  V  YIS+SYV  ++  S+D  ++ +  RDDP VIK R++ V+ L+AF++  +
Sbjct: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKI-RRDDPKVIKARMKAVIALSAFHLTTI 59

Query: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGH-----WXXXXXXXXXXXGIWVV 115
           P L   +K +        S+   ++  G++PG   +       W            + + 
Sbjct: 60  PLL---LKYMNGD-----SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLA 111

Query: 116 TLLYVGPLMDLFLFYVFTKGKTLYVDYKD-------EFSNIYCLRNYIFAPITEEIFYTS 168
            +LY  PL+D  L Y F   K+    YKD       EFS I+ LR+YIF PITEE+FYTS
Sbjct: 112 IVLYSTPLLDSLLHYCFLPDKS----YKDIISDICCEFSTIWGLRDYIFGPITEELFYTS 167

Query: 169 MLLNTYLMLCPIESLSLKTL-LWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFG 227
           M+L  YL L          L L  P+LF G+AH+HHA+  +  G  NL  I+  T++Q  
Sbjct: 168 MMLVAYLRLGDSSQYDANYLTLIVPNLF-GIAHVHHAFEQYSLGIMNLANIIFITLLQMS 226

Query: 228 YTTLFGAFTNFIFLRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVK 279
           YT LFG+FTN++FL + GNLW+C+  H+FCN MG P  +  S  + ++   K
Sbjct: 227 YTWLFGSFTNYLFLNSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEK 278

>Kwal_27.10314
          Length = 315

 Score =  176 bits (445), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 158/273 (57%), Gaps = 13/273 (4%)

Query: 7   FCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVPFLQCL 66
           F +  Y+SISYVA I+  S+   Q+    RDDP VIK R+R+V ++T+ N++LVP+LQ  
Sbjct: 6   FLISLYVSISYVAAIHMWSQPIGQFQA-RRDDPRVIKSRMRRVGLITSINLLLVPWLQST 64

Query: 67  IKNLRDSTDSSISVIGAIMNLGIVPGHYRDG--HWXXXXXXXXXXXGIWVVTLLYVGPLM 124
                  +   I+ + A + LGI+P  Y+    ++            + +V +LY GPL+
Sbjct: 65  F------SAREITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLL 118

Query: 125 DLFLFYVFTKGKTL---YVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIE 181
           D  L+Y+      +   + D K E  +I+ LRNY+F P TEE+FYT ML+N +L L   +
Sbjct: 119 DNVLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFL-LTSTD 177

Query: 182 SLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFL 241
            ++ K +L  P LFFGLAH+HHA+     G  + + I + T+IQ  YTTLFG FTNF++L
Sbjct: 178 PVTYKAILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYL 237

Query: 242 RTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTM 274
           RTG N W C   H+F N MG P  S L   F +
Sbjct: 238 RTGQNFWCCFAIHAFANYMGLPKMSALCEQFDL 270

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  155 bits (392), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 143/286 (50%), Gaps = 16/286 (5%)

Query: 12  YISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVPFLQCLIKNLR 71
           Y + SYVA +Y      R Y    R+DP  I   ++ V      N++++P+LQ      R
Sbjct: 12  YAATSYVAALYVFPGR-RIYGHASRNDPKAIWYGMKAVGCGVLANLLIIPWLQS-----R 65

Query: 72  DSTDSSISVIGAIMNLGIVPG---HYRDGHWXXXXXXXXXXXGIWVVTLLYVGPLMDLFL 128
            ++D   S +     LG+VPG   H+R  HW            + ++  LY   L+D   
Sbjct: 66  LASDG-FSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGSLYAADLLDSAA 124

Query: 129 FYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIESLSLKTL 188
           +Y+     +  VD  D  S    LRNY+F PITEE+ YTSM+L  Y +L P  ++S   L
Sbjct: 125 YYLLVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQP--TISRAML 182

Query: 189 LWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFLRTGGNLW 248
           L    +FFG+AH+HHA     TG +    + + +  Q  YTTLFG FTN+I+  T GNLW
Sbjct: 183 LLATPMFFGVAHVHHARQLLATGHRP-AQVALTSSFQILYTTLFGTFTNYIYYHTAGNLW 241

Query: 249 ACMFAHSFCNIMGFPGRSR---LSLHFTMIEEVKGDWRRKLIAAWN 291
           AC+  H+ CN + FP  S          +   ++  W+ +L+ AW 
Sbjct: 242 ACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWG 287

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 161 TEEIFYTSMLLNTYLMLCPIESLSLKTLLWQPSLFFGLAHIHHAYG-SFRTGDQNLITIL 219
           T+   YT  +L   + L PI+ L+   L +Q      +      YG  +  G+   +   
Sbjct: 240 TQAARYTKQVLTERVELPPIDGLNTSLLPYQKQSVHWMLQKEGYYGIPYSAGNDEELRQF 299

Query: 220 MNTIIQFGYTTL 231
           +NT + +GY TL
Sbjct: 300 LNTHVSYGYETL 311

>YBR161W (CSH1) [346] chr2 (561591..562721) Protein with high
           similarity to S. cerevisiae Sur1p, which is required for
           the synthesis of mannosylated sphingolipids, member of
           the glycosyltransferase sugar-binding region containing
           DXD motif containing family [1131 bp, 376 aa]
          Length = 376

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 206 GSFRTGDQNLITILMNTIIQ-------FGYTTLFGAFTNFIFLRTG 244
            S+ TGD N +  L N I+        FG+  L+G FT + +L +G
Sbjct: 257 SSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSG 302

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.143    0.455 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,462,139
Number of extensions: 372894
Number of successful extensions: 908
Number of sequences better than 10.0: 12
Number of HSP's gapped: 893
Number of HSP's successfully gapped: 12
Length of query: 322
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 220
Effective length of database: 13,065,073
Effective search space: 2874316060
Effective search space used: 2874316060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)