Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_696.3642642621350.0
YMR272C (SCS7)38438414340.0
CAGL0F03399g38038213950.0
KLLA0D01639g38138313370.0
Kwal_27.1033237837812761e-175
AAL183W37737812201e-167
CAGL0L03828g121521472e-11
Scas_666.12121571437e-11
Kwal_47.18167227671452e-10
KLLA0F27577g172561327e-09
YNL111C (CYB5)120571288e-09
Kwal_26.8461123571288e-09
Scas_571.1d609691343e-08
AFL223W165831254e-08
ADL085C273531233e-07
CAGL0K10736g593521227e-07
YML054C (CYB2)591521211e-06
KLLA0B14795g556471192e-06
KLLA0F23672g123571102e-06
KLLA0A12111g236501133e-06
KLLA0D02640g589971164e-06
Sklu_2258.5580471164e-06
CAGL0K03069g194491098e-06
Scas_571.2602481121e-05
Kwal_14.807578541084e-05
Kwal_23.2823560471084e-05
Sklu_2444.3564481075e-05
Kwal_26.804619853992e-04
CAGL0I00418g490107920.003
Scas_717.1418948860.007
KLLA0C05566g477106810.058
YMR073C20143760.17
AAR153C478105770.19
KLLA0E18535g14842730.27
KLLA0E19569g57348760.30
Sklu_2299.3480105720.85
AFL079W53854691.9
Kwal_26.875184842692.1
AAL078W59246672.9
Kwal_56.2400057361673.6
Sklu_2032.352252663.7
Sklu_2225.544733654.9
Kwal_14.1845288105645.8
Scas_563.649731647.2
Sklu_2361.388442647.7
Kwal_26.833143288637.8
Kwal_14.206444733638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_696.36
         (426 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_696.36                                                           827   0.0  
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   556   0.0  
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   541   0.0  
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   519   0.0  
Kwal_27.10332                                                         496   e-175
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   474   e-167
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    61   2e-11
Scas_666.12                                                            60   7e-11
Kwal_47.18167                                                          60   2e-10
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    55   7e-09
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    54   8e-09
Kwal_26.8461                                                           54   8e-09
Scas_571.1d                                                            56   3e-08
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    53   4e-08
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    52   3e-07
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    52   7e-07
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    51   1e-06
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    50   2e-06
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    47   2e-06
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    48   3e-06
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    49   4e-06
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        49   4e-06
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    47   8e-06
Scas_571.2                                                             48   1e-05
Kwal_14.807                                                            46   4e-05
Kwal_23.2823                                                           46   4e-05
Sklu_2444.3 , Contig c2444 10960-12654                                 46   5e-05
Kwal_26.8046                                                           43   2e-04
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    40   0.003
Scas_717.14                                                            38   0.007
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    36   0.058
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    34   0.17 
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    34   0.19 
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    33   0.27 
KLLA0E19569g complement(1730651..1732372) gi|21104522|dbj|BAB931...    34   0.30 
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         32   0.85 
AFL079W [3114] [Homologous to NOHBY] complement(290134..291750) ...    31   1.9  
Kwal_26.8751                                                           31   2.1  
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    30   2.9  
Kwal_56.24000                                                          30   3.6  
Sklu_2032.3 , Contig c2032 4286-5854                                   30   3.7  
Sklu_2225.5 YER136W, Contig c2225 5036-6379 reverse complement         30   4.9  
Kwal_14.1845                                                           29   5.8  
Scas_563.6                                                             29   7.2  
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            29   7.7  
Kwal_26.8331                                                           29   7.8  
Kwal_14.2064                                                           29   8.6  

>Scas_696.36
          Length = 426

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/426 (94%), Positives = 402/426 (94%)

Query: 1   MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK 60
           MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK
Sbjct: 1   MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK 60

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKIXXXXX 120
           DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKI     
Sbjct: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKIDQQTD 120

Query: 121 XXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY 180
                  IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY
Sbjct: 121 LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY 180

Query: 181 EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW 240
           EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW
Sbjct: 181 EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW 240

Query: 241 YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN 300
           YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN
Sbjct: 241 YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN 300

Query: 301 FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG 360
           FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG
Sbjct: 301 FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG 360

Query: 361 YICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWDKKFGTYLSPDSPL 420
           YICYDLCHYFLHHSKLPPFMR            NYQLGYGVTSWYWDKKFGTYLSPDSPL
Sbjct: 361 YICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWDKKFGTYLSPDSPL 420

Query: 421 SKMKYQ 426
           SKMKYQ
Sbjct: 421 SKMKYQ 426

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/384 (67%), Positives = 304/384 (79%), Gaps = 4/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+N SKTLELFSK  V +HNT  DCWVT  +RKIYDV++FL +HP GD+SIL +AGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 107 TELLKDEKIXXXXXXXXXXXX----IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           TE++KD  +                IGY+ATD E  +LLTNK+HKVEV+L+     FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
           TFVK+LP E+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP TKTAW++VP+AWLPVV YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLP YWA AGFAGG+FGY+CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426
           SW+WD+ FGTYL PD+PLSKMKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/382 (68%), Positives = 302/382 (79%), Gaps = 4/382 (1%)

Query: 46  QMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHA-GK 104
            ++++ SKTLELF +  +AKHN+++DCWV+ ++RKIYDVSK+L DHP+   ++ K   GK
Sbjct: 2   SVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61

Query: 105 DITELLKDEKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTF 164
             T++ + E              +GY+AT  EE+KLLTNK HKVEVKLN + NTFDSTTF
Sbjct: 62  HGTDISQME--LTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFDSTTF 118

Query: 165 VKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQES 224
           VKDLPTEDKLSI TDYE+D KKH FLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG+ S
Sbjct: 119 VKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGS 178

Query: 225 APLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYC 284
           APLFGNFLE FTKTAW++VP  W PVV Y I  A  N+N   A+ LF +G++VWT IEYC
Sbjct: 179 APLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238

Query: 285 MHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFAL 344
           +HRFLFHFDE LPEH+  +MIHFLLHGCHHYLPMD YRLVVPP LF+ LCAP YKLVFA 
Sbjct: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298

Query: 345 LPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSW 404
           LPYYWACAGFAGGM GYICYDLCHYFLHHSK+PPFMR            NYQLG+GVTSW
Sbjct: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSW 358

Query: 405 YWDKKFGTYLSPDSPLSKMKYQ 426
           +WDK FGTYL PD+PLSKMKY+
Sbjct: 359 FWDKVFGTYLGPDAPLSKMKYE 380

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 295/383 (77%), Gaps = 7/383 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MSS  S+ L L+SK  + KHN + DCWV++Y RKIY+V++FL +HP G + IL +AG DI
Sbjct: 1   MSS--SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58

Query: 107 TELLKD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           T+++KD    E              +GY+AT+ EE+KLLTNKDH VEV L +  N FDST
Sbjct: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNL-KGNNEFDST 117

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
            FVK+LPTEDKLSIATDY+ D KKH FLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYG+
Sbjct: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP +KT W++VP+ WLPVV YHI  A  N+N  FAI LF +GV+VWT IE
Sbjct: 178 GSAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFH D+RLPE  +A+ +HFLLHG HHYLPMD++RLV+PP LF+ LC PFYKLVF
Sbjct: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLPYYWACAGFAGGM GY+CYDL HYFLHHS+LPP+MR            NY+LG+GVT
Sbjct: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVT 357

Query: 403 SWYWDKKFGTYLSPDSPLSKMKY 425
           SW+WDK FGTYL  ++PLS MKY
Sbjct: 358 SWFWDKVFGTYLGENAPLSNMKY 380

>Kwal_27.10332
          Length = 378

 Score =  496 bits (1276), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/378 (60%), Positives = 286/378 (75%), Gaps = 7/378 (1%)

Query: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           +KTL L+S  QV +HN+ +DCWVT+ +RKIYDV+KFL DHP G   I+++AGKDITE++K
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62

Query: 112 DEKIXXXXXXXXXXX----XIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167
           D  +                +GY+AT  EE+KLL N  HKVEVKL +    +DST FV +
Sbjct: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119

Query: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227
           +P E+KLSI TDY +D  +H FLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+ SAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287
           FGNFLEP +KT+WY++PI WLPVV YHI  A +N+N LFA+ LF +G++VWT IEY MHR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347
           FLFH D  LP +  AY +HFLLHG HHYLPMD+YRLV+PP LF+ LC PFYKLVFALLPY
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWD 407
           YWACAGFAGGM GY+CYDL HYFLHH+KLP  ++            NY+LG+GVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 408 KKFGTYLSPDSPLSKMKY 425
           K FGTYL+ ++PLS+MK+
Sbjct: 360 KVFGTYLAENAPLSQMKF 377

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  474 bits (1220), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 278/378 (73%), Gaps = 8/378 (2%)

Query: 51  VSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELL 110
           VSKTL L+SK  + KH     CWV+V +RKIYDVS+FL +HP GD+ IL +AGKDIT +L
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61

Query: 111 KD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166
           KD    E              +GY+AT+ EE KLLTN+ H +EV    +    D+TTFVK
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV----TPENLDTTTFVK 117

Query: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226
           +LP E+ LS+ATD+  D  KH+FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYG+ SAP
Sbjct: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177

Query: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286
           LFGNFLEP +KT W++VP+ W PVV Y++  A +N+ A  A+  F  GV+VWT IEY +H
Sbjct: 178 LFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237

Query: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346
           RFLFHFD+ +PE N A+ +HFLLHG HHYLPMDKYRLV+PP LF+ LCAPFY+LVF++ P
Sbjct: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297

Query: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYW 406
            Y AC  FAGG+FGY+CYD+ HYFLHH KLPPFMR            NY+LG+GVTSWYW
Sbjct: 298 EYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 357

Query: 407 DKKFGTYLSPDSPLSKMK 424
           DK FGTYL+ +SP+S+ K
Sbjct: 358 DKVFGTYLASNSPVSRPK 375

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
           cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 61.2 bits (147), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           ++++  QV++HN E DCW+ + D  +YDVSKFL +HP GD+ I +H G D T
Sbjct: 3   KVYTYKQVSEHNKEGDCWIII-DGSVYDVSKFLDEHPGGDEIIFEHRGTDAT 53

>Scas_666.12
          Length = 121

 Score = 59.7 bits (143), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  Q+A+HN  +D W+ + + K+YDVSKFL +HP GD+ I + AG+D TE   D
Sbjct: 3   QVYSYQQIAEHNKPDDAWIII-EGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLD 58

>Kwal_47.18167
          Length = 227

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 41  TTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK 100
           T   +  +S  S  L   S D+VA H   +DCW++++  K+YDVS +L  HP G + +LK
Sbjct: 17  TPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLK 75

Query: 101 HAGKDIT 107
            AGKD T
Sbjct: 76  LAGKDAT 82

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
           Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           L + D+VA+H++  DCW TV   K+YD++ FL  HP G + +LK+AGKD T    D
Sbjct: 5   LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDD 59

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
           b5 [363 bp, 120 aa]
          Length = 120

 Score = 53.9 bits (128), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  +VA+HN  E+ W+ + D K+YDVS+F  +HP GD+ I+   G+D TE   D
Sbjct: 3   KVYSYQEVAEHNGPENFWIII-DDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD 58

>Kwal_26.8461
          Length = 123

 Score = 53.9 bits (128), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L+S  ++A+HNTE+D W+ + D K+YD +KF+ +HP G++ ++   G+D T    D
Sbjct: 3   KLYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFAD 58

>Scas_571.1d
          Length = 609

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 41  TTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK 100
           T  +N +   +S T    S D+V KHN+E DCW+ V + ++YD++ F+  HP G   I  
Sbjct: 78  TNIQNDVKLELSSTKSPISTDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKL 136

Query: 101 HAGKDITEL 109
           +AGKD++ +
Sbjct: 137 NAGKDVSAI 145

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 13/83 (15%)

Query: 30  FSIFRNTPAKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLL 89
            S+F + P + T  +            L++  ++A+HN+E D W+ + + K+YD +KF  
Sbjct: 28  LSLFTSPPTETTMPK------------LYTYQEIAEHNSENDLWLII-NGKVYDCTKFAE 74

Query: 90  DHPDGDKSILKHAGKDITELLKD 112
           +HP GD+ ++  AG+D TE   D
Sbjct: 75  EHPGGDEVLIDLAGQDATEPFAD 97

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           L   S ++V++H + +DCW  ++ R +YD++  L +HP G K +LK+AG+D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +V KHNT EDCWV V D  +YD++ F+  HP G   I  +AGKD+T +
Sbjct: 90  ISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +VAKHN  +DCWV V +  +YD+++FL +HP G   I  +AGKD+T +
Sbjct: 91  ISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +V  HN  +DCW+ V D ++YD++KFL  HP G   +++ AG+D TE
Sbjct: 85  EVKMHNRIDDCWI-VIDNEVYDITKFLSQHPGGVARLMEFAGRDATE 130

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
           Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
           singleton, hypothetical start
          Length = 123

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L +  +V++H T +D W+ + D K+YD +KF+ +HP GD+ ++   G+D T   +D
Sbjct: 3   KLLTYKEVSEHKTVDDLWMII-DGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFED 58

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 59  SKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           S  +V  HN  +DCW+ V D  +YD++ FL  HP G   +++ AG+D TE
Sbjct: 82  SVKEVKSHNRIDDCWI-VIDGDVYDITGFLSKHPGGVTRLMEFAGRDATE 130

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 6/97 (6%)

Query: 18  STFSLSSQFV--GSFSIFRNTPAKLTTRRNQMSSNVSK---TLELFSKDQVAKHNTEEDC 72
           S FS   + +  G+F +  +    L ++ N    N +K   T    S  +VAKH++ +DC
Sbjct: 45  SAFSFGKKVITGGAFLVAGSVGIALISQFNDSVENGAKVDMTKPKVSPTEVAKHSSPKDC 104

Query: 73  WVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           WV V +  +Y+++ F+  HP G   I  +AGKD+T++
Sbjct: 105 WV-VIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           VAKHN  +DCWV V D  +YD+++F+  HP G   I  +AGKD+T +
Sbjct: 86  VAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 34/49 (69%), Gaps = 2/49 (4%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSIL-KHAGKDITEL 109
           ++A+HNT EDCW TV + K+Y +S +L  HP G K ++ K +G+D T L
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVL 170

>Scas_571.2
          Length = 602

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           +VA+HNT  DCW+ V +  +YD++ F+  HP G   I  +AGKD+T +
Sbjct: 93  EVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>Kwal_14.807
          Length = 578

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           E     +VAKH+  +DCWV V +  +YD+S F+  HP G   I  +AGKD++ +
Sbjct: 77  ESIRPQEVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>Kwal_23.2823
          Length = 560

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +V  HN   DCW+ + D ++YDV+ F+  HP G + IL+ AG D TE
Sbjct: 85  EVMLHNKLNDCWIVLND-EVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           D+V  HN  +DCW+ V +  +YD+++F+  HP G   +++ AG+D TE
Sbjct: 91  DEVKLHNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>Kwal_26.8046
          Length = 198

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITEL 109
            +K Q+A+H   EDCW  V ++K+Y +S +L  HP G   ++K  AGKD T +
Sbjct: 123 INKAQLAQHKAPEDCWC-VINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 12/107 (11%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLE---LFSKD 61
           KV IY+ S F LS      SQ +   ++ +    K+   R+  S N    L     ++K+
Sbjct: 335 KVFIYLTSLFGLSYDLKTFSQNIIQQALIQQRQKKID--RDSKSVNWGPKLADLPAWTKE 392

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +  + N E D  V V    ++DVS ++ +HP G+K +    GKD T+
Sbjct: 393 EFLEKNRENDGLVIV-GGIVHDVSGYITEHPGGEKLLKNALGKDATK 438

>Scas_717.14
          Length = 189

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITEL 109
           + +H +  DCW T+Y  K+Y VS +L  HP G   I ++ AGKD T L
Sbjct: 118 LQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVL 164

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMS--SNVSKTLELFSKDQ 62
           KV+IY+ S F LS      SQ      + +    KL   R++++  S +SK L ++ KD+
Sbjct: 328 KVLIYLTSLFGLSYDLKKFSQNAIQQGLVQQQQKKLDRTRSKLNWGSPLSK-LPVWDKDE 386

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
             +   + +  + V    ++DVS ++ +HP G+  I    GKD T+
Sbjct: 387 FME-KLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATK 431

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKD 105
           V KH   ED    V + K+YD+S +L  HP G   ++KH   D
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVS-KTLELFSKDQV 63
           KV IY  S   L+      SQ      + +    KL   R++++       L ++ + + 
Sbjct: 327 KVFIYCASLVGLAYDLKKFSQNAIQQGLIQQKQKKLDNARSRLNWGTPLSQLPVWDRSEF 386

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            +  + E+  + V    ++DVS ++ +HP G+  I    GKD T 
Sbjct: 387 VR-ASRENSGLVVISGIVHDVSGYITEHPGGETLIQAALGKDATR 430

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 68  TEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
             +D +  V +RK+Y +  +L  HP G+  + + AGKD+T L
Sbjct: 79  ANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSL 120

>KLLA0E19569g complement(1730651..1732372)
           gi|21104522|dbj|BAB93118.1 Kluyveromyces lactis putative
           delta 8-sphingolipid desaturase, start by similarity
          Length = 573

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           D++AK  T     + +Y+  + ++ K++  HP GDKSI    G+D T+
Sbjct: 12  DRIAKGQT-----IVIYEDSVLNLDKWIKFHPGGDKSIYHMIGRDATD 54

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KV IY  S   L+      SQ      + +    KL   R++++     T L ++ K++ 
Sbjct: 328 KVFIYTSSLLGLAYNLKKFSQNAIQQGLVQQQQKKLDRSRSKLNWGTPLTQLPVWDKEEF 387

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            K + + +  + +    ++DVS ++ +HP G+  I   AGKD T+
Sbjct: 388 MK-SLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATK 431

>AFL079W [3114] [Homologous to NOHBY] complement(290134..291750)
           [1617 bp, 538 aa]
          Length = 538

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           + + SK +V +     +  + +Y   +  + K++  HP GDK+I    G+D T+
Sbjct: 1   MAVLSKSEVEERIANGEV-IVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDATD 53

>Kwal_26.8751
          Length = 848

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 251 VFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHF 292
           VFYH    + +I  L+ +++     YVW  +EYC  + L+ +
Sbjct: 79  VFYHRQFDYSHITKLYEVIV--TENYVWMALEYCPGKELYEY 118

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 63  VAKHNTEE-DCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           VA+ + EE +  +   +  I+DV+ F+ DHP G   ++   GKD T
Sbjct: 477 VARKDYEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASVGKDAT 522

>Kwal_56.24000
          Length = 573

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 51  VSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELL 110
           +SK LE   + ++     E    + +YD  +  + K++  HP GD +I    G+D T+ +
Sbjct: 1   MSKVLE---RSEIESRIREGQA-IVIYDGNVLRLDKWIKFHPGGDTAIHHMIGRDATDEM 56

Query: 111 K 111
           K
Sbjct: 57  K 57

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           E F+K   +++ T +   V + +  ++DV+ F+ DHP G   +    GKD T
Sbjct: 395 ENFAKLAQSEYRTNKRALVAI-EGIVHDVTPFIYDHPGGVTLVETSIGKDAT 445

>Sklu_2225.5 YER136W, Contig c2225 5036-6379 reverse complement
          Length = 447

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%)

Query: 181 EKDLKKHNFLDLNKPLLKQILF----GNFTKDF 209
           E DLK H  LDL+K  + ++ +    GN TKDF
Sbjct: 155 EDDLKTHQGLDLDKNTMDEVYYKFGLGNSTKDF 187

>Kwal_14.1845
          Length = 288

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KVII++ S   LS      SQ      + +    K+  +R  ++     T L ++ K Q 
Sbjct: 136 KVIIFLSSLVGLSYNLKKFSQNAIQQGLVQQQQKKIDRQRAHLNWGTPLTQLPVWDKQQF 195

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            + N + +  + +    ++DVS ++ +HP G+  I     KD T+
Sbjct: 196 ME-NIKTNPGLVIISGIVHDVSNYITEHPGGETLIKAALNKDATK 239

>Scas_563.6
          Length = 497

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 81  IYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           I+D+S ++ +HP G+  I +  GKD T   +
Sbjct: 421 IHDISNYIPEHPGGESLIKQALGKDATRAFQ 451

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 251 VFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHF 292
           VFYH    F +I  L+ +++      VW  +EYC  + L+ +
Sbjct: 79  VFYHRQFDFPHITKLYEVIV--TESKVWMALEYCPGKELYEY 118

>Kwal_26.8331
          Length = 432

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 6/88 (6%)

Query: 130 YMATDAEEEKLLTNKDHKVEV---KLNESTNTFDSTTFVKDLPTEDKLSIATDYEKDLKK 186
           Y+  +   EKLL  ++H  ++   K  +++N+F ++     +PT   L+   +Y  + KK
Sbjct: 327 YLIEEPAAEKLLREQEHTAQITNKKKAKASNSFLNSVDYVQIPTAINLAKYPEYFPEWKK 386

Query: 187 HNFLD---LNKPLLKQILFGNFTKDFYL 211
           H + +   L   ++ +  FG+  + FY+
Sbjct: 387 HGYAEVPFLGAQIVAKQGFGHSNESFYV 414

>Kwal_14.2064
          Length = 447

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 4/33 (12%)

Query: 181 EKDLKKHNFLDLNKPLLKQILF----GNFTKDF 209
           E D+K H  LDL+K  + ++ +    GN TKDF
Sbjct: 155 EDDIKTHQGLDLDKNTMDEVYYKFGLGNSTKDF 187

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.142    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,477,824
Number of extensions: 641848
Number of successful extensions: 2365
Number of sequences better than 10.0: 59
Number of HSP's gapped: 2394
Number of HSP's successfully gapped: 59
Length of query: 426
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 322
Effective length of database: 12,995,837
Effective search space: 4184659514
Effective search space used: 4184659514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)