Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_691.528428415290.0
YJR096W28228111661e-163
CAGL0C04543g28728211311e-157
Sklu_2334.128628210961e-152
Kwal_47.1821929328310791e-149
KLLA0F03256g28528210101e-139
Kwal_47.188932892676702e-87
ABL209C3102676462e-83
Kwal_33.132763022885574e-70
Sklu_1971.33293084246e-50
YOR120W (GCY1)3122924053e-47
CAGL0I01122g3262944046e-47
KLLA0B14707g3102873957e-46
KLLA0D10109g3092683843e-44
Scas_714.73222943854e-44
YHR104W (GRE3)3273083837e-44
CAGL0A02816g3102863773e-43
Sklu_1828.23122863774e-43
Scas_688.123263283705e-42
Kwal_55.215363293083681e-41
CAGL0I01100g3102883619e-41
YDR368W (YPR1)3122763592e-40
KLLA0E21714g3293103575e-40
Kwal_47.180843092763565e-40
AER401W3132873512e-39
Kwal_55.214263082763488e-39
Scas_676.43132913452e-38
Sklu_2408.83222773287e-36
ACL107C3542853263e-35
Scas_319.11951963058e-34
Kwal_56.226113212803001e-31
KLLA0F05775g3092882981e-31
Sklu_1571.23222822842e-29
YBR149W (ARA1)3442932833e-29
YDL124W3122882814e-29
Scas_704.93092852771e-28
KLLA0F02728g3302812782e-28
Scas_518.43382952782e-28
Sklu_2438.123122972666e-27
Sklu_2324.33152992666e-27
Kwal_33.13274108982386e-25
Kwal_47.192783142972482e-24
CAGL0J09394g3112892448e-24
KLLA0B05291g127701171e-07
Scas_664.53433071213e-07
Scas_568.73433071142e-06
Sklu_2082.33382941098e-06
Scas_687.33443091001e-04
Sklu_2405.1342302992e-04
CAGL0E05214g346295982e-04
YPL088W342305982e-04
CAGL0E05192g345294910.002
Scas_719.39345296890.003
ABR094W359157880.004
CAGL0E05236g344294830.015
Kwal_26.8377338152760.12
YPR127W345114730.27
KLLA0B05302g5145660.28
YJR155W (AAD10)28861690.88
CAGL0J04818g654157681.2
YFL057C (AAD16)15278642.0
KLLA0B09658g34299652.8
CAGL0D04840g19667642.9
YDL243C (AAD4)32961643.3
YNL331C (AAD14)37661626.9
YMR041C335136618.2
Sklu_2241.31590136628.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_691.5
         (284 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_691.5                                                            593   0.0  
YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific a...   453   e-163
CAGL0C04543g 434137..435000 highly similar to sp|P47137 Saccharo...   440   e-157
Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement        426   e-152
Kwal_47.18219                                                         420   e-149
KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces c...   393   e-139
Kwal_47.18893                                                         262   2e-87
ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933...   253   2e-83
Kwal_33.13276                                                         219   4e-70
Sklu_1971.3 YHR104W, Contig c1971 5146-6135                           167   6e-50
YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase...   160   3e-47
CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomy...   160   6e-47
KLLA0B14707g complement(1291951..1292883) similar to sp|P14065 S...   156   7e-46
KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces c...   152   3e-44
Scas_714.7                                                            152   4e-44
YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase ...   152   7e-44
CAGL0A02816g 292159..293091 highly similar to tr|Q12458 Saccharo...   149   3e-43
Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement        149   4e-43
Scas_688.12                                                           147   5e-42
Kwal_55.21536                                                         146   1e-41
CAGL0I01100g complement(91693..92625) highly similar to sp|P1406...   143   9e-41
YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldeh...   142   2e-40
KLLA0E21714g complement(1929294..1930283) gi|1351442|sp|P49378|X...   142   5e-40
Kwal_47.18084                                                         141   5e-40
AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W (...   139   2e-39
Kwal_55.21426                                                         138   8e-39
Scas_676.4                                                            137   2e-38
Sklu_2408.8 , Contig c2408 19753-20721 reverse complement             130   7e-36
ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH] (152564..153...   130   3e-35
Scas_319.1                                                            122   8e-34
Kwal_56.22611                                                         120   1e-31
KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyce...   119   1e-31
Sklu_1571.2 YBR149W, Contig c1571 1437-2405                           114   2e-29
YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of NADP+-depe...   113   3e-29
YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent ...   112   4e-29
Scas_704.9                                                            111   1e-28
KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces c...   111   2e-28
Scas_518.4                                                            111   2e-28
Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement     107   6e-27
Sklu_2324.3 , Contig c2324 5024-5971 reverse complement               107   6e-27
Kwal_33.13274                                                          96   6e-25
Kwal_47.19278                                                         100   2e-24
CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces c...    99   8e-24
KLLA0B05291g 478251..478634 some similarities with sp|Q12458 Sac...    50   1e-07
Scas_664.5                                                             51   3e-07
Scas_568.7                                                             49   2e-06
Sklu_2082.3 , Contig c2082 6775-7791                                   47   8e-06
Scas_687.3                                                             43   1e-04
Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement          43   2e-04
CAGL0E05214g complement(508038..509078) highly similar to tr|Q02...    42   2e-04
YPL088W (YPL088W) [5356] chr16 (381960..382988) Putative aryl al...    42   2e-04
CAGL0E05192g complement(506594..507631) highly similar to tr|Q02...    40   0.002
Scas_719.39                                                            39   0.003
ABR094W [685] [Homologous to ScYMR041C - SH] complement(555931.....    39   0.004
CAGL0E05236g complement(509478..510512) highly similar to tr|Q02...    37   0.015
Kwal_26.8377                                                           34   0.12 
YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with sim...    33   0.27 
KLLA0B05302g 478541..478696 similar to sp|P14065 Saccharomyces c...    30   0.28 
YJR155W (AAD10) [3046] chr10 (727320..728186) Putative aryl alco...    31   0.88 
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    31   1.2  
YFL057C (AAD16) [1627] chr6 complement(14305..14763) Predicted a...    29   2.0  
KLLA0B09658g complement(837873..838901) similar to sgd|S0006331 ...    30   2.8  
CAGL0D04840g 471574..472164 no similarity, hypothetical start          29   2.9  
YDL243C (AAD4) [634] chr4 complement(17577..18566) Putative aryl...    29   3.3  
YNL331C (AAD14) [4284] chr14 complement(16118..17248) Putative a...    28   6.9  
YMR041C (YMR041C) [4005] chr13 complement(350965..351972) Member...    28   8.2  
Sklu_2241.3 YML059C, Contig c2241 1211-5983 reverse complement         28   8.5  

>Scas_691.5
          Length = 284

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/284 (100%), Positives = 284/284 (100%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE
Sbjct: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL
Sbjct: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120

Query: 121 EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVM 180
           EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVM
Sbjct: 121 EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVM 180

Query: 181 RSELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLP 240
           RSELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLP
Sbjct: 181 RSELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLP 240

Query: 241 KTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           KTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP
Sbjct: 241 KTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284

>YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific
           aldo/keto reductase, may play a general role in reducing
           pentose sugars [849 bp, 282 aa]
          Length = 282

 Score =  453 bits (1166), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 244/281 (86%)

Query: 4   VPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGIL 63
           VPK+Y  +NG +IPSIALGTYDIP+S TA+IVYE +K GYRHFDTAVLYGNE +VG+GI+
Sbjct: 2   VPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGII 61

Query: 64  QWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGR 123
           +W+ EDP  +KR ++FYTTKLWNSQNGY +A+ AI++CL +V GLQYID+LLIHSPLEG 
Sbjct: 62  KWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGS 121

Query: 124 TKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSE 183
             RLETWRAMQEAV+ GLVK+IGVSNYG++H++ELL W  L  KPVVNQIEISPW+MR E
Sbjct: 122 KLRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQE 181

Query: 184 LADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTK 243
           LADYCKS GLVVEAFAPL HGYK+ + DL++V KEV R+  QVLIRWSLQHGYLPLPKTK
Sbjct: 182 LADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTK 241

Query: 244 TVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           TVKRLE NL AYNF+L+ EQM+ +DHPDAYEPTDWECTDAP
Sbjct: 242 TVKRLEGNLAAYNFELSDEQMKFLDHPDAYEPTDWECTDAP 282

>CAGL0C04543g 434137..435000 highly similar to sp|P47137
           Saccharomyces cerevisiae YJR096w, hypothetical start
          Length = 287

 Score =  440 bits (1131), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 201/282 (71%), Positives = 237/282 (84%)

Query: 3   SVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGI 62
            VPKYY   +G +IPS+ALGTYDIP S+TAK+V EALK GYRHFDTAVLYGNE +VG+GI
Sbjct: 6   DVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGI 65

Query: 63  LQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEG 122
           + WI ED   NKR DVFYTTKLWNSQNGY++A+ AIKEC+ KV GL YIDMLLIHSPL G
Sbjct: 66  VNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSG 125

Query: 123 RTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRS 182
           + +RLETW+AMQEAV+ G+VK+IGVSNYG+ H+EELL W+ L  KPVVNQIEISPWVMR 
Sbjct: 126 QRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISPWVMRQ 185

Query: 183 ELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKT 242
           ELADYCKSV LVVEA+AP+ HGYK++D  L  +SKE G +  Q+LIRWSLQHGYLPLPKT
Sbjct: 186 ELADYCKSVNLVVEAYAPMAHGYKMNDPGLREISKETGMNPGQLLIRWSLQHGYLPLPKT 245

Query: 243 KTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           KTV RL  NL+ YN +LT +Q++ +DHP+AY+PTDWECTDAP
Sbjct: 246 KTVARLASNLDVYNHKLTLDQVKRMDHPEAYDPTDWECTDAP 287

>Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement
          Length = 286

 Score =  426 bits (1096), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 234/282 (82%)

Query: 3   SVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGI 62
           ++PK Y  ++G  +PSI LGTYD+P + T++IVYEALK GYRH DTAVLYGNE +VGEGI
Sbjct: 5   AIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGI 64

Query: 63  LQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEG 122
           L+W++E+P  NKR DVFY TKLWNSQNGY+ A+ AI+EC  KV GL YID+LLIHSPL G
Sbjct: 65  LKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSG 124

Query: 123 RTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRS 182
             KRLET++AMQEAV+ G+V++IGVSNYG  H++ELL W  L  KP VNQIEISPW+MR 
Sbjct: 125 SRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQ 184

Query: 183 ELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKT 242
           ELADYCKS GL+VEA+APLTHGYK++  +++RV+KE G ++ QVLIRWSLQHGY+PLPKT
Sbjct: 185 ELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKT 244

Query: 243 KTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           K+VKRL  NL+ YN +LT EQM  +D PDAYEPTDWECTDAP
Sbjct: 245 KSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286

>Kwal_47.18219
          Length = 293

 Score =  420 bits (1079), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 239/283 (84%)

Query: 2   TSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEG 61
           T+VPK Y  ++G  +PSI LGTYDIP++ T+++VY+ALK+GYRH DTAVLYGNEH+VG+G
Sbjct: 11  TTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG 70

Query: 62  ILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLE 121
           I +W++EDP+ NKR DVFYTTKLWNSQNGY  A+ AIKEC+ KV  L YID+LLIHSPL 
Sbjct: 71  IQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS 130

Query: 122 GRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMR 181
           G  +RLET++AMQEAV+ G+V++IGVSNYG+ H++ELL W+ L  KPVVNQIEISPW+MR
Sbjct: 131 GTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMR 190

Query: 182 SELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPK 241
            +LADYCKS GLVVEAF+PLTHGYKL   D++ V+KE G    +VLIRWSLQHGY+PLPK
Sbjct: 191 QDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPK 250

Query: 242 TKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           +++V+RL+ N++AY+F+L+ EQ+  +D P AYEPTDWECTDAP
Sbjct: 251 SRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECTDAP 293

>KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces
           cerevisiae YJR096w, start by similarity
          Length = 285

 Score =  393 bits (1010), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 228/282 (80%)

Query: 3   SVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGI 62
           SVPK Y  ++G  IPS+ LGTY++P + TA +V++AL+ GYRHFDTAVLYGNE++VG+GI
Sbjct: 4   SVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGI 63

Query: 63  LQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEG 122
            +W+ E+P +NKR DVFYTTKLW+SQ+GY +A+ AI  CL +V  L YID+LLIHSPL G
Sbjct: 64  KKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGG 123

Query: 123 RTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRS 182
           +  RLET+ AMQEAV++G V++IGVSNYG QH+EELL WE+L  KPVVNQIEISPW MR 
Sbjct: 124 KKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWCMRQ 183

Query: 183 ELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKT 242
           ELAD+CK  G++VEA+APLTHG KL D DLV+V+ EVG    Q LIRWSLQ GY+PLPKT
Sbjct: 184 ELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEVGCDVGQALIRWSLQKGYIPLPKT 243

Query: 243 KTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284
           ++V RL  NL+ ++F+ TT+QM  +D P AYEPTDWECT+AP
Sbjct: 244 QSVSRLASNLDVFSFEWTTDQMDQLDKPYAYEPTDWECTNAP 285

>Kwal_47.18893
          Length = 289

 Score =  262 bits (670), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 181/267 (67%), Gaps = 3/267 (1%)

Query: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68
           T  NG +IP +ALG Y+ P+  T   V+ ALK+GYRH D A LYGNE +VG GI ++++E
Sbjct: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69

Query: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE 128
            P  + RS++FYTTK+    +GY +A+ +I + L  V  ++YID+LLIH+P+    +RL 
Sbjct: 70  TPNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128

Query: 129 TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELADYC 188
           TW+A+QEA   G V+ IGVSNY  +H+EEL  WE L ++P+VNQ E++PW+ R EL +YC
Sbjct: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188

Query: 189 KSVGLVVEAFAPLTHGYKLHDADLVRVSKEV--GRSTVQVLIRWSLQHGYLPLPKTKTVK 246
           +  G+V+EAF+PLT G K  D  L  + K     ++  Q+LIRWSLQ G++PLPK+   K
Sbjct: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248

Query: 247 RLEENLEAYNFQLTTEQMQLIDHPDAY 273
           R   NL+A +F+++ + M+ + H D Y
Sbjct: 249 RQISNLQALDFEISDKDMKALTHDDTY 275

>ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933
           bp, 310 aa]
          Length = 310

 Score =  253 bits (646), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 175/267 (65%), Gaps = 1/267 (0%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWI 66
           +   ++G QIPS+ LG Y + +     +VYEAL+ GYR FD+A  Y NE  V  GI  W+
Sbjct: 12  FRRLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWL 71

Query: 67  QEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKR 126
           +  P + +R DV++TTK+    +GY   + ++++ L     L YID++L+H+P+  RT+R
Sbjct: 72  KHAPGR-RREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRR 130

Query: 127 LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELAD 186
           L TW+A++EAV  G V++IGVSNYG+QH+ ELL WE L I+PVVNQ+EI+PW+ R EL  
Sbjct: 131 LGTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQ 190

Query: 187 YCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVK 246
           YC+   + V+AF+PL  G +L D  L +V+ +  +   Q+L+RWS+Q G++ LPK    +
Sbjct: 191 YCRENNIAVQAFSPLMRGKRLDDPILQKVAHQYDKGVAQILVRWSIQMGFIVLPKAAKKE 250

Query: 247 RLEENLEAYNFQLTTEQMQLIDHPDAY 273
           RL  N + ++F+L+ E M  + H D Y
Sbjct: 251 RLAPNFDIWDFELSAETMSELTHSDDY 277

>Kwal_33.13276
          Length = 302

 Score =  219 bits (557), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 179/288 (62%), Gaps = 17/288 (5%)

Query: 8   YTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQ 67
           Y  NNG QIP I  G Y+IP+  TA +VY ALK GYRH DTAVLY N+ +  +G+ +++ 
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLD 72

Query: 68  EDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHG-LQYIDMLLIHSPLEGRTKR 126
           E  +   R ++++TTKLW+SQ G  + + A++E  A V   + Y+D+LL+HSP  G  +R
Sbjct: 73  ETGEA--RENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRR 130

Query: 127 LETWRAMQEAV-ESGL----VKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMR 181
           LETW  +++AV E G     +K+IGVSN+G  H+EELL+  +  +KPV++Q+E+ PW+ R
Sbjct: 131 LETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELLKVAK--VKPVLDQLELHPWLPR 188

Query: 182 SELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPK 241
            EL  Y K   +  EA++PLT GY+L D +L+ +  + G +   +L+RWS   G++ L K
Sbjct: 189 VELRKYLKEKDIFAEAYSPLTQGYRLQDPELLALEAKTGINKAVILLRWSFLQGFVVLVK 248

Query: 242 TKTVKRLEENL-------EAYNFQLTTEQMQLIDHPDAYEPTDWECTD 282
           +   +R+ +NL       +++  ++  +  + +D P+A +   W   D
Sbjct: 249 SSNPERIRQNLAVLPSENDSWKVEIDEQLWKTLDKPEAKDVATWGQKD 296

>Sklu_1971.3 YHR104W, Contig c1971 5146-6135
          Length = 329

 Score =  167 bits (424), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 162/308 (52%), Gaps = 48/308 (15%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           M+++ K  T NNG ++P I LG + IP  + A  VYEA+K GYR FD A  YGNE +VG+
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           GI + I E     KR D+F  +KLWNS +     + A+K+ L  + GL Y+D+  IH PL
Sbjct: 61  GIKKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDI-GLDYLDLFYIHFPL 117

Query: 121 EGR----------------------------TKRLETWRAMQEAVESGLVKNIGVSNYGR 152
             +                               ++T+RA+++ V+ GL+K+IG+SN+  
Sbjct: 118 AFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNG 177

Query: 153 QHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDAD 211
             V++LL+  R  IKPV  QIE  P++ +  L  YCK+VG+ V A++      +   D++
Sbjct: 178 SLVQDLLRGAR--IKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSE 235

Query: 212 LVRVSKEVGR-------------STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQ 258
           L + +  + R             ST QVL+RW+ Q G   +PK+   +RL ENL   N  
Sbjct: 236 LAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENL-TINDS 294

Query: 259 LTTEQMQL 266
           LT    +L
Sbjct: 295 LTLSDKEL 302

>YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase,
           induced by galactose, has strong similarity to
           crystallin protein of vertebrate eye lens [939 bp, 312
           aa]
          Length = 312

 Score =  160 bits (405), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 157/292 (53%), Gaps = 39/292 (13%)

Query: 6   KYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQW 65
           K  + N G QIP I LGT+   ++   K V  ALK GYRH DTA +Y NE QVG+ I   
Sbjct: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68

Query: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP------ 119
                    R ++F TTKLW +Q  +H+ + A+ + L ++ GL Y+D+ L+H P      
Sbjct: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120

Query: 120 -------LEGRTKR-------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELL 159
                  L   TK+             ++TW  MQE  ++G  K +GVSN+   ++++LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 160 QWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSK 217
             +   + P  NQ+EI P + + EL ++CKS G+VVEA++PL  T    L +  ++ ++K
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 218 EVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
           +       V+I W +Q GY+ LPK+    R++ N +   F L+TE  + I++
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290

>CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomyces
           cerevisiae YHR104w GRE3 aldose reductase, start by
           similarity
          Length = 326

 Score =  160 bits (404), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 155/294 (52%), Gaps = 50/294 (17%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           M+SV    T NNG ++P + LG + IP  + A+ VY+A+K GYR FD A  YGNE +VG+
Sbjct: 1   MSSV---VTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQ 57

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           GI + I E     KR DVF  +KLWNS +     + A+K  L+ + GL Y+D+  IH P+
Sbjct: 58  GIRKAIDEGVV--KREDVFVVSKLWNSFHHPDHVKMALKRTLSDM-GLDYLDLFYIHFPI 114

Query: 121 ----------------------------EGRTKRLETWRAMQEAVESGLVKNIGVSNYGR 152
                                       E     ++T+RA+++ VE GL+K+IG+SN+  
Sbjct: 115 AFKYVPFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSG 174

Query: 153 QHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEA---FAP-----LTHG 204
             V++LL+  +  IKPV  Q+E  P++ +  L +YCK  G+ V A   F P     L H 
Sbjct: 175 SLVQDLLR--QCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHP 232

Query: 205 YK------LHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENL 252
                    H   + +++     +T QVL+RW+ Q G   +PK+   +RL++NL
Sbjct: 233 LAKNTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNL 286

>KLLA0B14707g complement(1291951..1292883) similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 galactose-induced
           protein of aldo/keto reductase family, start by
           similarity
          Length = 310

 Score =  156 bits (395), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 146/287 (50%), Gaps = 39/287 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP + LGT+  P+      V  AL+ GYRH DTA +YGNE  VG+GI       
Sbjct: 12  LNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRD----- 66

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL--------- 120
                R ++F TTKLW +Q      + A+   L ++ GL Y+D+ LIH P+         
Sbjct: 67  -SGVPREEIFVTTKLWGTQQ--RDPEAALDLSLQRL-GLDYVDLYLIHWPVPLNASSITD 122

Query: 121 ----------EGRT-------KRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                     +G+          ++TW  MQ   +SG  K IGVSN+  +++E LL    
Sbjct: 123 GNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANP 182

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221
             I P  NQIEI P + ++EL DYCKS G+++EA++PL  +    L D  +  ++ +   
Sbjct: 183 DFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNA 242

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268
               +LI W    GY+ LPK+   +R++ NL+     L+TE ++ I+
Sbjct: 243 EPANILISWGASRGYVVLPKSVNPQRIKTNLKL--LDLSTEDLEKIN 287

>KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 galactose-induced protein of
           aldo/keto reductase family, start by similarity
          Length = 309

 Score =  152 bits (384), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 133/268 (49%), Gaps = 35/268 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP +  GT+    +     V  ALK GYRH D A +YGNE  VG+GI       
Sbjct: 13  LNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRD----- 67

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLE----GRTK 125
                R ++F TTKLWN+Q       +A+ E L ++ GL Y+D+ LIH P+     G  +
Sbjct: 68  -SGIPREEIFVTTKLWNTQQ--RDPASALDESLERL-GLDYVDLFLIHWPVPLKPVGGPE 123

Query: 126 RL--------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLT 165
            L                    +TW  MQ   ++G  + +GVSN+  +++E+LL      
Sbjct: 124 NLLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDV 183

Query: 166 IKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGRST 223
           + P VNQ EI P + ++EL +YCKS G+VVEA+ PL  +    L D  +  ++ +     
Sbjct: 184 LVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKP 243

Query: 224 VQVLIRWSLQHGYLPLPKTKTVKRLEEN 251
             VLI W +  GY  LPK+ T  R+  N
Sbjct: 244 ANVLINWGISRGYCVLPKSFTPARIASN 271

>Scas_714.7
          Length = 322

 Score =  152 bits (385), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 162/294 (55%), Gaps = 46/294 (15%)

Query: 8   YTFNNGNQIPSIALGTYDIPQSITAKIVYEA----LKAGYRHFDTAVLYGNEHQVGEGIL 63
           +  N G  I ++ LGT+   QS      YEA    LKAGYRH DTA +YGNE QVG+ I 
Sbjct: 21  FKLNTGATISAVGLGTW---QSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76

Query: 64  QWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP--LE 121
                +     R ++F TTKLW++Q  +H     + + L ++ GL Y+D+ L+H P  L 
Sbjct: 77  -----NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLN 128

Query: 122 GRT---------------KR---------LETWRAMQEAVESGLVKNIGVSNYGRQHVEE 157
            R+               KR         ++TW  MQE  ++G  + +GVSN+   ++++
Sbjct: 129 PRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKK 188

Query: 158 LLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRV 215
           +L      + P VNQ+EI P + + EL ++C S G+++EA++PL  T+   L +  L+ +
Sbjct: 189 VLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINL 248

Query: 216 SKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
           +K+ G  T Q++I W +Q GY+ LPK+   +R++ N +    +L+ E+M+ I++
Sbjct: 249 AKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINN 300

>YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase
           with NADPH specificity, induced by osmotic stress, plays
           roles in methylglyoxal and arabinose catabolism and may
           play a general role in reducing pentose sugars [984 bp,
           327 aa]
          Length = 327

 Score =  152 bits (383), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 160/308 (51%), Gaps = 49/308 (15%)

Query: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68
           T NNG ++P + LG + I + + A  +YEA+K GYR FD A  YGNE +VGEGI + I E
Sbjct: 6   TLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISE 65

Query: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL-------- 120
                 R D+F  +KLWN+ +     + A+K+ L+ + GL Y+D+  IH P+        
Sbjct: 66  GLVS--RKDIFVVSKLWNNFHHPDHVKLALKKTLSDM-GLDYLDLYYIHFPIAFKYVPFE 122

Query: 121 --------------------EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQ 160
                               E     ++T+RA++E V+ GL+K+IGVSN+    +++LL+
Sbjct: 123 EKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLR 182

Query: 161 WERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLVR----- 214
             R  IKPV  QIE  P++ +  L ++CK   + V A++      +   D  L +     
Sbjct: 183 GCR--IKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTL 240

Query: 215 ----VSKEV-----GRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEA-YNFQLTTEQM 264
               V K+V     G +T QVL+RW+ Q G   +PK+   +RL  NLE    F LT +++
Sbjct: 241 FENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL 300

Query: 265 QLIDHPDA 272
           + I   +A
Sbjct: 301 KDISALNA 308

>CAGL0A02816g 292159..293091 highly similar to tr|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 310

 Score =  149 bits (377), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 146/286 (51%), Gaps = 39/286 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G +IP + LGT+    +     V  ALK GYRH D A +YGNE QVG  I       
Sbjct: 12  LNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVGRAIKD----- 66

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL--------- 120
                R ++F TTKLW ++  +     A+   L ++ GL Y+D+ L+H P+         
Sbjct: 67  -SGVPRQEIFITTKLWGTE--HRNPAKALDSSLKRL-GLDYVDLYLMHWPVALKAHGSEE 122

Query: 121 ----------EGRTK-------RLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                     +G+T         ++TW  MQE  ++G  K IGVSN+   +++ L    +
Sbjct: 123 KDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSPK 182

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHGYK--LHDADLVRVSKEVGR 221
               P  NQ+EI P   ++EL +YCKS  +++EA++P        L + +L +++++   
Sbjct: 183 FNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYNI 242

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
           ST Q++I WS+Q GY+ LPK+   +R+E NL+     L  E M+ I
Sbjct: 243 STAQLIISWSVQRGYVVLPKSVHAERIEANLKV--LTLKDEDMETI 286

>Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement
          Length = 312

 Score =  149 bits (377), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 146/286 (51%), Gaps = 39/286 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP + LGT+          V  A+K GYRH D+A +YGNE  VG+ I       
Sbjct: 14  LNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD----- 68

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE- 128
                R+++F TTKLW +Q      + A+   L ++ GL Y+D+ LIH P+  +T  ++ 
Sbjct: 69  -SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIKD 124

Query: 129 -------------------------TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                                    TW  +QE   +G  K +GVSN+   +++ELL    
Sbjct: 125 DDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYK-LHDADLVRVSKEVGR 221
             + P  NQ+E+ P + + EL ++ KS G+V+EA++PL ++G   L +  ++ V+K+ G 
Sbjct: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
              QVLI W +Q GY+ LPK+   KR+E N +   F L+ E +  I
Sbjct: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDRI 288

>Scas_688.12
          Length = 326

 Score =  147 bits (370), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 105/328 (32%), Positives = 163/328 (49%), Gaps = 52/328 (15%)

Query: 4   VPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGIL 63
           +PK  T NNG ++P + LG + IP  I A  VYEA+KAGYR FD A  Y NE +VG+G+ 
Sbjct: 1   MPKLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLK 60

Query: 64  QWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL--- 120
           + +  D    KR D+F  +KLWN+ +     +  +K  L  + GL Y+D+  IH P+   
Sbjct: 61  RAM--DDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDL-GLDYLDLYYIHFPIAFK 117

Query: 121 -------------------------EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHV 155
                                    E     L+T+RA++E    GL+K+IG+SN+    V
Sbjct: 118 FVPMEERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLV 177

Query: 156 EELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVV---EAFAPLTHGY------- 205
            ++L+    +IKPV  QIE  P++ + +L +YCK   + V    +F P +          
Sbjct: 178 ADILRG--CSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAK 235

Query: 206 ---KLHDADLV-RVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEA-YNFQLT 260
               L D  ++ +++++   ST +VL+RW+ Q G   +PK+   KRL  NL    N  LT
Sbjct: 236 NTPPLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLT 295

Query: 261 TEQMQLIDHPDA----YEPTDWECTDAP 284
            E ++ I   +      +P DW  +  P
Sbjct: 296 EEDLKSISGLNQNLRFNDPWDWNNSKFP 323

>Kwal_55.21536
          Length = 329

 Score =  146 bits (368), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 158/308 (51%), Gaps = 48/308 (15%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           MT   +    NNG Q+P + LG + IP  + A  VYEA+K GYR FD A  YGNE +VG+
Sbjct: 1   MTYTSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           GI + I E     KR D+F  +KLWNS +     + A+K  L  +  L+Y+D+  IH PL
Sbjct: 61  GIHKAIDEGIV--KREDLFVVSKLWNSYHDPKNVKKALKRTLEDME-LEYLDLFYIHFPL 117

Query: 121 EGR------------------TKR----------LETWRAMQEAVESGLVKNIGVSNYGR 152
             +                   K+          ++T+RA++E V+ GL+K+IG+SN+  
Sbjct: 118 AFKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRG 177

Query: 153 QHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDAD 211
             + +LL     TIKPV  QIE  P++ + +L +YC    + V A++      +   D++
Sbjct: 178 ILIHDLLAGA--TIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSE 235

Query: 212 LV-------------RVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQ 258
           L              +++   G S+ QVL+RW+ Q     +PK+   +RL +NL+  N +
Sbjct: 236 LAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQI-NEK 294

Query: 259 LTTEQMQL 266
           LT  + +L
Sbjct: 295 LTLTEAEL 302

>CAGL0I01100g complement(91693..92625) highly similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 or sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, start by
           similarity
          Length = 310

 Score =  143 bits (361), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 147/288 (51%), Gaps = 40/288 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP I LGT+   ++       EALKAGYRH DTA +Y NE ++G  I       
Sbjct: 13  LNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD----- 67

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL-- 127
                R+++F TTKLW +Q  +     A+ + L ++ GL Y+D+ L+H P+  +T  +  
Sbjct: 68  -SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIKD 123

Query: 128 ------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                                   +TW  MQE  +    + IGVSN+   +++ELL  + 
Sbjct: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSKG 182

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221
             + P  NQIEI P + + EL ++CK  G+V+EA++PL  T    L + ++  ++K+ G 
Sbjct: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
           +  Q++I W  Q GY+ LPK+   +R+  N E   F+L+ E    + +
Sbjct: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288

>YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldehyde
           reductase induced by osmotic and oxidative stress,
           member of the aldo/keto reductase family, plays a role
           in arabinose catabolism and may play a general role in
           reducing pentose sugars [939 bp, 312 aa]
          Length = 312

 Score =  142 bits (359), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 138/276 (50%), Gaps = 37/276 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP +  GT+    +     V  ALKAGYRH D A +Y NE +VG  I       
Sbjct: 14  LNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----- 68

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKR--- 126
                R ++F TTKLW ++      + A+ + L ++ GL Y+D+ L+H P+  +T R   
Sbjct: 69  -SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVTD 124

Query: 127 -----------------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                                  ++TW  MQE  ++G  K +GVSN+   +++ELL+   
Sbjct: 125 GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPN 184

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221
             + P  NQIEI P + + EL  +CK  G+VVEA++P    +   L +  ++ ++K+ G 
Sbjct: 185 NKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257
              Q++I WS+Q GY+ L K+   +R+  N + +  
Sbjct: 245 EPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280

>KLLA0E21714g complement(1929294..1930283)
           gi|1351442|sp|P49378|XYL1_KLULA Kluyveromyces lactis
           NAD(P)H-dependent xylose reductase, start by similarity
          Length = 329

 Score =  142 bits (357), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 95/310 (30%), Positives = 161/310 (51%), Gaps = 48/310 (15%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           MT + +  T NNG ++P + LG + +P  + A  +YEA+K GYR FD A  Y NE +VG+
Sbjct: 1   MTYLAETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQ 60

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           G+ + I+E     KR D+   +KLWNS +       A++  L+ +  L Y+D+  IH PL
Sbjct: 61  GVNRAIKEG--LVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQ-LDYVDIFYIHFPL 117

Query: 121 ----------------------------EGRTKRLETWRAMQEAVESGLVKNIGVSNYGR 152
                                       E +   L+TWRA+++ V+ G +K++G+SN+  
Sbjct: 118 AFKPVPFDEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSG 177

Query: 153 QHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEA---FAPLT------- 202
             +++LL+  R  IKPV  QIE  P++ +  L  Y K+ G+ V A   F P++       
Sbjct: 178 ALIQDLLRGAR--IKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENK 235

Query: 203 ---HGYKLHDADLVR-VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYN-F 257
              +   L + D ++ ++ +   +  QVL+RW+ Q+G   +PK+   +RL +NL   +  
Sbjct: 236 KALNTPTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDAL 295

Query: 258 QLTTEQMQLI 267
            LT ++++ I
Sbjct: 296 TLTDDELKQI 305

>Kwal_47.18084
          Length = 309

 Score =  141 bits (356), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 141/276 (51%), Gaps = 36/276 (13%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            N G  IP +  GT+   +      V  A+K GYRH D+A +YGNE  VG  I       
Sbjct: 13  LNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGRAIRD----- 67

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL-- 127
                R ++F TTKLWN+Q    +   A+ + L ++ GL Y+D+ LIH PL  +T R+  
Sbjct: 68  -SGVPREELFVTTKLWNTQQ--REPAKALDQSLQRL-GLDYVDLYLIHWPLPIKTDRITD 123

Query: 128 -----------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERL 164
                                  +TW+ MQE   +G  + +GVSN     +E+LL  +  
Sbjct: 124 GNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGN 183

Query: 165 TIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLVR-VSKEVGRS 222
            + P V Q+E  P + +++L D+C    +++EA++PL + G  L D  +++ ++K+    
Sbjct: 184 KVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNAD 243

Query: 223 TVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQ 258
             Q++I W ++ GY+ LPK+ T  R++ NL+  + +
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLE 279

>AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W
           (GCY1) - SH] complement(1406905..1407846) [942 bp, 313
           aa]
          Length = 313

 Score =  139 bits (351), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 149/287 (51%), Gaps = 38/287 (13%)

Query: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68
           T N G +IP   LGT+       +  V  ALK GY+H DTA  Y NE  VG+ + +    
Sbjct: 15  TLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVGKAVKE---- 70

Query: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL-------- 120
                 R ++F TTK+WN Q        A+   L K+ G +Y+D+LL+H P+        
Sbjct: 71  --SGIPREELFITTKVWNDQQ--RDPAGALDLSLKKL-GTEYVDLLLMHWPVPFKEPENS 125

Query: 121 -----------EGRTKR------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                      +G+  R      ++TW  MQ+ + +G VK IGVSN+   ++EELL  E 
Sbjct: 126 TLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEG 185

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221
            T+ P VNQ+E+   + + EL +YC+  G+VVEA++PL  +    L DA + +V+++ G 
Sbjct: 186 TTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGV 245

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268
           +   VL+ +    G + LPK+    R+  N E   F++  E ++L++
Sbjct: 246 TPAHVLLNYVANRGIVVLPKSVKESRIISNFEY--FKMDEEDIKLLN 290

>Kwal_55.21426
          Length = 308

 Score =  138 bits (348), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 144/276 (52%), Gaps = 37/276 (13%)

Query: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68
           T N G +IP + LGT+ + +    K +  ALKAGYRH D+A +  NE  +G+ I      
Sbjct: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD---- 68

Query: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL- 127
                +R ++F TTKLW++Q  +     A+ + L ++ GL+Y+D+ ++H PL  R  ++ 
Sbjct: 69  --SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIK 123

Query: 128 ------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163
                                   +TW  MQ+ + +   + IGV+N+    +  LL+   
Sbjct: 124 AKNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPN 182

Query: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLVR-VSKEVGR 221
             I P  +Q+E  P++   E+  +C+  G+++EA++PL   G  L D  ++R +SK++  
Sbjct: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242

Query: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257
              Q+LI W L+ G   LPK+KT  R+E NLE ++ 
Sbjct: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278

>Scas_676.4
          Length = 313

 Score =  137 bits (345), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 147/291 (50%), Gaps = 44/291 (15%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYE----ALKAGYRHFDTAVLYGNEHQVGEGILQW 65
            N G  IP I+LGT+   +S+ A   Y+    ALKAGYRH DTA +YGNE QVG+ I   
Sbjct: 14  LNTGANIPEISLGTW---RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD- 69

Query: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAK------------------VHG 107
                    R ++F T+KLWN+Q   H    A+K+ L++                     
Sbjct: 70  -----SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122

Query: 108 LQYIDMLLIHSPLEGRT-------KRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQ 160
           ++  D ++I     G+          ++TW  MQE   +G+ K +GVSN+   +++ELL 
Sbjct: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182

Query: 161 WERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKE 218
                + P  NQIEI P +   +L  +C+  G+++EA++PL   +   L +  ++ +SK+
Sbjct: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242

Query: 219 VGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
           +     Q++I W +Q GY+ L K+   +R+  N +   F L+ E  + I +
Sbjct: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAIKN 291

>Sklu_2408.8 , Contig c2408 19753-20721 reverse complement
          Length = 322

 Score =  130 bits (328), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 152/277 (54%), Gaps = 39/277 (14%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSI--TAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQ 64
           Y+  N G +IPS+ LGT + P+ +  T   V  A+K GYR  DTA +YG+E  +GE + +
Sbjct: 10  YFNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQE 69

Query: 65  WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL---- 120
             +E     KR D+F TTK+W     Y+  + +++E L ++  L Y+D+LL H PL    
Sbjct: 70  LFEEG--VVKREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQHWPLCFVK 124

Query: 121 ----EGRTKR------------------LETWRAMQEAVE--SGLVKNIGVSNYGRQHVE 156
                G+ K                   L TW+ +++  +  SG V+NIGVSNY  +++E
Sbjct: 125 QYDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLE 184

Query: 157 ELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHGYKLH-DADLVR- 214
            LL+     + PV+NQ+E+ P + + EL++YC S G+++E+F+PL      H +  LV+ 
Sbjct: 185 RLLK--ETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKE 242

Query: 215 VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEEN 251
           +SK+       VL+ + ++ G + +P++    R+ +N
Sbjct: 243 LSKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKN 279

>ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH]
           (152564..153628) [1065 bp, 354 aa]
          Length = 354

 Score =  130 bits (326), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 143/285 (50%), Gaps = 47/285 (16%)

Query: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69
            NNG  +P + LG + IP  + A+ VYEA+K GYR  D A  Y NE +VG+GI + I E 
Sbjct: 35  LNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAIDEG 94

Query: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL--------- 120
               +R ++F  +KLWN+ +       A++  L+ + GL Y+D+  IH PL         
Sbjct: 95  --LVRREELFVVSKLWNNYHRPEDVGKALQRTLSDL-GLDYLDLFYIHFPLAFKFVPLEE 151

Query: 121 --------------EGRTKR-----LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQW 161
                          GR  +     +ET+RA+++ V+ G ++ IG+SN+    V++LL+ 
Sbjct: 152 RYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLLRG 211

Query: 162 ERLTIKPVVNQIEISPWVMRSELADYCKSVGLVV--------EAFAPLTHGYKLHDADLV 213
            R  I+P   QIE  P++ +  L  Y KS GL V        ++F  L +    + A L+
Sbjct: 212 CR--IRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAPLL 269

Query: 214 ------RVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENL 252
                 R+++    +  +VL+RW+ Q     +PK+   +RL  NL
Sbjct: 270 QHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNL 314

>Scas_319.1
          Length = 195

 Score =  122 bits (305), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 107/196 (54%), Gaps = 33/196 (16%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGE 60
           M+++ K  T NNG ++P I LG + IP  + A  VYEA+K GYR FD A  YGNE +VG+
Sbjct: 5   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 64

Query: 61  GILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL 120
           GI + I E     KR D+F  +KLWNS +     + A+K+ L  + GL Y+D+  IH PL
Sbjct: 65  GIKKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDI-GLDYLDLFYIHFPL 121

Query: 121 EGR----------------------------TKRLETWRAMQEAVESGLVKNIGVSNYGR 152
             +                               ++T+RA+++ V+ GL+K+IG+SN+  
Sbjct: 122 AFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNG 181

Query: 153 QHVEELLQWERLTIKP 168
             V++LL+  R  IKP
Sbjct: 182 SLVQDLLRGAR--IKP 195

>Kwal_56.22611
          Length = 321

 Score =  120 bits (300), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 150/280 (53%), Gaps = 40/280 (14%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSI--TAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQ 64
           Y+T NNG ++P++ LGT ++ + I  T + V  A+K+GYRH DTA  Y  E ++GE + +
Sbjct: 10  YFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKE 69

Query: 65  WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL---- 120
             +E     KR D+F TTK+W +   + +A  +I   L  + G+ Y+D++L H PL    
Sbjct: 70  LFEEG--VIKREDIFITTKVWPTN--WDRADESISRSLENL-GVDYVDLVLQHWPLCFNR 124

Query: 121 ----EG-------------------RTKRLETWRAMQEAVESG--LVKNIGVSNYGRQHV 155
               EG                   +   L+T++++++   S     ++IGVSNY  +++
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYL 184

Query: 156 EELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLV- 213
           E LL+     + P VNQ+E+ P + + EL D+C    + +EAF+P    G  +   +LV 
Sbjct: 185 ERLLK--ECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQ 242

Query: 214 RVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLE 253
           +V+++   +   VLI + L+ G + +P++   K +  N++
Sbjct: 243 KVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQ 282

>KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 309

 Score =  119 bits (298), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 146/288 (50%), Gaps = 36/288 (12%)

Query: 6   KYYTFNNGNQIPSIAL--------------GTYDIPQSITAKIVYEALKAGYRHFDTAVL 51
           K++T +NGN+IP++A+               T+  P     K   + +  G  H D A +
Sbjct: 5   KFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTV-PGVVHIDAAEI 63

Query: 52  YGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYI 111
           Y    ++G  +         +  R ++F T K    +      + A++  L K+ G+ Y+
Sbjct: 64  YRTYPELGAAL------KDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKL-GVDYV 116

Query: 112 DMLLIHSPL--EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPV 169
           D+ L+HSP+  E +      W+ ++E  +SG  KNIGVSN+  + +E+LL      +KP 
Sbjct: 117 DLYLLHSPIIKESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLLAVAE--VKPQ 174

Query: 170 VNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTH-GYKLHDAD-------LVRVSKEV 219
           VNQIE SP++      + ++ +  G+++EA++PL     +  DAD       +  +SK+ 
Sbjct: 175 VNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPFYQYIAELSKKY 234

Query: 220 GRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
            +S  Q+L+ W  + G LP+  +  ++R+++  + ++F L  E++Q I
Sbjct: 235 NKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKI 282

>Sklu_1571.2 YBR149W, Contig c1571 1437-2405
          Length = 322

 Score =  114 bits (284), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 148/282 (52%), Gaps = 45/282 (15%)

Query: 7   YYTFNNGNQIPSIALGTYDI----PQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGI 62
           Y+  NNG +IP++ LGT +     PQ  T + V  A+KAG+R  DTA  YG E  +GE +
Sbjct: 10  YFNLNNGTRIPAVGLGTANPKDKWPQ--TKEAVKAAVKAGFRQIDTAWAYGTEEYIGEAL 67

Query: 63  LQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL-- 120
            +   E     KR D+F TTK+W   N + QA+ ++ E L ++  L Y+D+LL H P   
Sbjct: 68  QELFAEGVV--KREDLFITTKVW--PNYWDQAEKSLNESLKRLQ-LDYVDLLLQHWPFCF 122

Query: 121 ------EGRTKR-------------------LETWRAMQE---AVESGLVKNIGVSNYGR 152
                 EG  +                    LET++ ++    A     V+ IGVSNY  
Sbjct: 123 VKKQDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPI 182

Query: 153 QHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDAD 211
           +++E L + E  T+ P +NQ+E+ P + + EL DYC   G+++ +++PL ++G       
Sbjct: 183 EYLERLFK-ECKTV-PAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIP 240

Query: 212 LVR-VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENL 252
           LV+ ++ +   +   VL+ + ++ G + +P++  ++R+ + L
Sbjct: 241 LVQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGL 282

>YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of
           NADP+-dependent D-arabinose dehydrogenase [1035 bp, 344
           aa]
          Length = 344

 Score =  113 bits (283), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 155/293 (52%), Gaps = 43/293 (14%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSI--TAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQ 64
           Y++ NNG +IP++ LGT +  + +  T + V  A+KAGYRH DTA  Y  E  VGE I +
Sbjct: 24  YFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKE 83

Query: 65  WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL---- 120
            +++     KR D+F TTK+W     + +   ++ E L K  GL+Y+D+LL H PL    
Sbjct: 84  LLEDG--SIKREDLFITTKVWPVL--WDEVDRSLNESL-KALGLEYVDLLLQHWPLCFEK 138

Query: 121 -----------------EGRT------KRLETWRAMQEAV---ESGLVKNIGVSNYGRQH 154
                             G+T        LET++ +++         V+ IGVSN+  ++
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 155 VEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLV 213
           +E L++  R  +KP VNQ+E  P + + EL  +C    +++ A++PL +HG       LV
Sbjct: 199 LERLIKECR--VKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 214 -RVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQ 265
            +++++   +   +LI + ++ G + +P++    R+  ++E  +  LT +++Q
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFAS--LTKDELQ 307

>YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent
           reductase, has similarity to putative aldose reductases
           [939 bp, 312 aa]
          Length = 312

 Score =  112 bits (281), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 142/288 (49%), Gaps = 35/288 (12%)

Query: 6   KYYTFNNGNQIPSIAL---GT---------YDIPQSITAKIVYEALKAGYRHFDTAVLYG 53
           +++T NNGN+IP+IA+   GT              S+  +IVY     G  H D A +Y 
Sbjct: 6   QFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYR 65

Query: 54  NEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDM 113
              +VG+ +   + E P    R+ +F T K ++ Q     +     +   K  G  Y+D+
Sbjct: 66  TYPEVGKAL--SLTEKP----RNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDL 118

Query: 114 LLIHSPLEGRT----KRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPV 169
            L+HSP   +        E W+ M++  +SG  KNIGVSN+  + ++ +L+     +KP 
Sbjct: 119 YLLHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAE--VKPQ 176

Query: 170 VNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTHGYKLHDAD--------LVRVSKEV 219
           VNQIE SP++      +  +C+   ++VEA++PL    K    D        +  +S++ 
Sbjct: 177 VNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKY 236

Query: 220 GRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
            +S  Q+++RW  + G LP+  +   +R+ +    ++F LT E++  I
Sbjct: 237 IKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKI 284

>Scas_704.9
          Length = 309

 Score =  111 bits (277), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 136/285 (47%), Gaps = 32/285 (11%)

Query: 6   KYYTFNNGNQIPSIA--------LGTYDIPQSITAKIVYEALKA----GYRHFDTAVLYG 53
           +++T NNGN+IP+IA          T +   + + ++V E   A    G  H D A +Y 
Sbjct: 6   EFFTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYR 65

Query: 54  NEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDM 113
              +V   + +        N+  D  + T  +++Q        A      K  GL Y+D+
Sbjct: 66  TYPEVAAALRE-------SNRPRDEIFITDKYSTQLKLSDDPIAGLNISLKTLGLDYVDL 118

Query: 114 LLIHSPLEGRTKRLE-TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQ 172
            L+HSP       LE  W+ M++  +SG  KNIGVSN+  + +E++L+    TIKP +NQ
Sbjct: 119 YLLHSPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIA--TIKPQINQ 176

Query: 173 IEISPWVMRSE--LADYCKSVGLVVEAFAPLTHGYKLHDAD--------LVRVSKEVGRS 222
           IE +  +      +  +CK   + +EA+ PL    ++ D          +  +SK+  ++
Sbjct: 177 IEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKYNKT 236

Query: 223 TVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
             Q+L+RW  + G LP+  +   +RL +    ++F L + ++  I
Sbjct: 237 EAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKI 281

>KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces
           cerevisiae YBR149w ARA1 D-arabinose dehydrogenase, large
           subunit, start by similarity
          Length = 330

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 146/281 (51%), Gaps = 41/281 (14%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSI--TAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQ 64
           Y+TFNNGN++P+  LGT    + +  T + V  A+KAGYRH DTA  YG E  VGE + +
Sbjct: 10  YFTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQE 69

Query: 65  WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL---- 120
             +E  +  KR D+  T+K+W++   ++    ++ E LA++  + Y+D+ L H PL    
Sbjct: 70  LFEE--RVVKREDLHITSKVWHTM--WNDVDKSLNESLARLK-VDYVDLFLQHWPLCTQK 124

Query: 121 -----------------------EGRTKRLETWRAMQEAV---ESGLVKNIGVSNYGRQH 154
                                  + +   +ET++ +++         V+ IGVSN+  ++
Sbjct: 125 VPDPHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEY 184

Query: 155 VEELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLV 213
           ++ +L+  R    P  NQ+E+ P + + EL ++C    ++V A++PL  +G  L +  ++
Sbjct: 185 LKRVLKECRTV--PACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPIL 242

Query: 214 R-VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLE 253
           + + ++   S   +L  + L+ G + +P++    R+  NLE
Sbjct: 243 KGLCEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLE 283

>Scas_518.4
          Length = 338

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 153/295 (51%), Gaps = 43/295 (14%)

Query: 7   YYTFNNGNQIPSIALGTYDIPQSI---TAKIVYEALKAGYRHFDTAVLYGNEHQVGEGIL 63
           Y+  NNG +IP+I LGT   P+     T K V  A++AGYR  DTA  Y  E  +GE + 
Sbjct: 10  YFNLNNGGRIPAIGLGTAS-PKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALK 68

Query: 64  QWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL--- 120
           +  ++   + KR D+F TTK+W     +    T+I E L K  G+ Y+DM+L H PL   
Sbjct: 69  ELFRDG--EIKREDLFITTKVWPCY--WDDPSTSINESL-KSLGIDYVDMVLQHWPLCYK 123

Query: 121 ----------------EGRTKRLE------TWRAMQEAV---ESGLVKNIGVSNYGRQHV 155
                           +G+    E      T++ M++     +   V+ IGVSNY  +++
Sbjct: 124 KTYDENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYL 183

Query: 156 EELLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHGYKLH-DADLVR 214
           E +++  ++T  PV+NQ+E+ P + + EL D+C   G+++ A++PL  G   +    LV+
Sbjct: 184 ERVIKECKVT--PVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQ 241

Query: 215 -VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268
             +K+   +   +L  + ++ G + +P++   +R+  N+  Y   LT  +M+ +D
Sbjct: 242 EYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNI--YFAPLTKNEMKSLD 294

>Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement
          Length = 312

 Score =  107 bits (266), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 149/297 (50%), Gaps = 43/297 (14%)

Query: 1   MTSVPKYYTFNNGNQIPSIA-LGT-----------YDIPQSITAKIVYEALKAGYRHFDT 48
           M+   +++T NNGN+IP++A +GT                 +  ++ Y     G  H D 
Sbjct: 1   MSIKQEFFTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDA 60

Query: 49  AVLYGNEHQVGEGILQWIQEDPQQNKRSDVF----YTTKLWNSQNGYHQAQTAIKECLAK 104
           A +Y    ++G+ + +       +  R++++    Y+T L  S N     +  +KE    
Sbjct: 61  AEIYRTYPELGKALRE------TKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKEL--- 111

Query: 105 VHGLQYIDMLLIHSPL--EGRTKRL--ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQ 160
             G+ YID+ L+HSP   EGR      + W+ ++E  +SG  KNIGVSN+ ++ +E +L+
Sbjct: 112 --GVDYIDLYLLHSPFITEGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILK 169

Query: 161 WERLTIKPVVNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTH-GYKLHDAD------ 211
                IKP VNQIE S ++      + ++ K   +++EA++PL     +  +AD      
Sbjct: 170 IAE--IKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLPFYK 227

Query: 212 -LVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
            +  ++++ G+S  QVL+RW  + G LP+  +    R+ +    + F LT+ +++ I
Sbjct: 228 YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKI 284

>Sklu_2324.3 , Contig c2324 5024-5971 reverse complement
          Length = 315

 Score =  107 bits (266), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 86/299 (28%), Positives = 145/299 (48%), Gaps = 43/299 (14%)

Query: 1   MTSVPKYYTFNNGNQIPSIALGT---YDIPQS----------ITAKIVYEALKAGYRHFD 47
           MT++P      +G+ +PSI  G+   + I +S            A  V  A++ G+ H D
Sbjct: 3   MTNIPGITLKGSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHID 62

Query: 48  TAVLYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKL------WNSQNGYHQAQT-AIKE 100
           TA  Y    +VG GI         Q  R  ++ T K       W   +G  ++ T ++KE
Sbjct: 63  TAEAYKTYKEVGTGI------SNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKE 116

Query: 101 CLAKVHGLQYIDMLLIHSP-LEGRTKRL---ETWRAMQEAVESGLVKNIGVSNYGRQHVE 156
                  L Y+D+ +IH P +  +T  +   E W  M+E     + +NIGVSN+  + +E
Sbjct: 117 M-----NLDYVDLYMIHVPNITTKTAGIDLKEAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 157 ELLQWERLTIKPVVNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTHGYKLH----DA 210
            +  + +   +PVVNQIE S ++ +    +  YC+   +VVE ++PL    K      D 
Sbjct: 172 YIKSFAKY--QPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLDE 229

Query: 211 DLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
            L  ++ + G+S +QVL+RW  Q+G + +  T   +RL E+L  ++F+L+ E    I +
Sbjct: 230 ILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITN 288

>Kwal_33.13274
          Length = 108

 Score = 96.3 bits (238), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 64/98 (65%), Gaps = 2/98 (2%)

Query: 8   YTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQ 67
           Y  NNG QIP I  G Y+IP+  TA  VY ALK GYRH DTAVLY N+ +  +G+ +++ 
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLD 72

Query: 68  EDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKV 105
           E  +   R ++++TTKLW+SQ G  + + A++E  A V
Sbjct: 73  ETGE--ARENIWFTTKLWDSQFGREETKKALQEVAADV 108

>Kwal_47.19278
          Length = 314

 Score =  100 bits (248), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 137/297 (46%), Gaps = 45/297 (15%)

Query: 2   TSVPKYYTFNNGNQIPSIALGT-----------YDIPQSIT--AKIVYEALKAGYRHFDT 48
           + +P      +G++IP I  G+               Q IT  A  V  A+ AG+ H D 
Sbjct: 3   SKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDA 62

Query: 49  AVLYGNEHQVGEGILQ--------WIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKE 100
           A  Y    +VG G+          WI +           YT   W+ + G    ++ +  
Sbjct: 63  AEAYKTHPEVGRGVKNSGVPRDKLWITDK----------YTPWSWDWRKGTGPLES-LSL 111

Query: 101 CLAKVHGLQYIDMLLIHSPL----EGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVE 156
            L K+  + Y+D+ L+H P            E WR M+E  + GL KNIGVSN+  + +E
Sbjct: 112 SLEKMQ-MSYVDLYLLHVPFITVQTAGIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLE 170

Query: 157 ELLQWERLTIKPVVNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTHGYKLH----DA 210
            + +  +    PVVNQIE + ++ +    +  YCK   +VVE ++PL    K      D 
Sbjct: 171 YITKIGKYL--PVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLDK 228

Query: 211 DLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
            L  ++++  +S +Q+L+RW  Q+G + +  +    R++E++  ++F+LT E    I
Sbjct: 229 LLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSI 285

>CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 311

 Score = 98.6 bits (244), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 137/289 (47%), Gaps = 37/289 (12%)

Query: 6   KYYTFNNGNQIPSIAL---GTY---------DIPQSITAKIVYEALKAGYRHFDTAVLYG 53
           +++  NNG+++P +A+   GT          +  Q++  ++ Y     G  H D A  Y 
Sbjct: 5   EFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYM 64

Query: 54  NEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDM 113
              +VG  + +          R ++F T K W            ++  L ++ GL+Y+D+
Sbjct: 65  TYREVGRALAE------TSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRL-GLEYVDL 117

Query: 114 LLIHSPLEGRTKR----LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPV 169
            L+HSP   +        E W  M+E   SG  KNIGVSN+ ++ +E +L+     +KP 
Sbjct: 118 YLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERVLK--VCKVKPQ 175

Query: 170 VNQIEISPWVMRSE--LADYCKSVGLVVEAFAPLTHGYKLHDAD---------LVRVSKE 218
           VNQIE + ++      + ++CK   + + A++PL    K   AD         + ++++ 
Sbjct: 176 VNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQK-KPADGNSQPFYSYINKLAQH 234

Query: 219 VGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
             ++  QVL+RW  + G + +  ++  +R+++  E + F L  +++  I
Sbjct: 235 YNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVTEI 283

>KLLA0B05291g 478251..478634 some similarities with sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 127

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 51  LYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQY 110
           +YGNE  VG+GI            R ++F TTKLWN+Q       +A+ E L ++ GL Y
Sbjct: 1   MYGNETAVGKGIRD------SGIPREEIFVTTKLWNTQQ--RDPASALNESLERL-GLDY 51

Query: 111 IDMLLIHSPL 120
           +D+ LIH P+
Sbjct: 52  VDLFLIHWPV 61

>Scas_664.5
          Length = 343

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 122/307 (39%), Gaps = 76/307 (24%)

Query: 33  KIVYEALKAGYRHFDTAVLYGN---EHQVGEGILQWIQEDPQQNKRSDVFYTTKLW---- 85
           KI+      G R FDTA +Y N   E  VGE + ++        KR  V   TK++    
Sbjct: 44  KILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKY------NIKRETVVIMTKIFFPVD 97

Query: 86  ---------NSQNGYHQAQTAIKECLAKVHGLQ-----------YIDMLLIHSPLEGRTK 125
                    N      + Q  ++  L++ H +            YID+L IH  L+  T 
Sbjct: 98  ESLDLHHGSNVNQEAMELQLTLQRGLSRKHIIDGVANSVERLGTYIDVLQIHR-LDEETS 156

Query: 126 RLETWRAMQEAVESGLVKNIGVSNY------GRQHVEELLQWER-LTIKPVVNQIEISPW 178
             E  R++ + V SG V+ IG S+         Q + E   W + ++ +   N I     
Sbjct: 157 MEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQSYYNLINRED- 215

Query: 179 VMRSELADYCKSVGLVVEAFAPLTHGY-----------KLHDADLVRV--------SKEV 219
               EL  +CK  G+ +  ++P   G             L D    R+         KE+
Sbjct: 216 --ERELIPFCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDDEKEI 273

Query: 220 GRSTVQVLIR-----------WSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268
            R    V  R           W+L  G  P+    +V+R++E ++A  F LT ++++L++
Sbjct: 274 VRRIQMVAERRSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEIKLLE 333

Query: 269 HPDAYEP 275
            P  Y+P
Sbjct: 334 EP--YKP 338

>Scas_568.7
          Length = 343

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 123/307 (40%), Gaps = 76/307 (24%)

Query: 33  KIVYEALKAGYRHFDTAVLYGN---EHQVGEGILQWIQEDPQQNKRSDVFYTTKLW---N 86
           KI+      G R FDTA +Y N   E  +GE + ++        KR  V   +K++   +
Sbjct: 44  KILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRF------NIKRETVVIMSKIFFPVD 97

Query: 87  SQNGYHQA----------QTAIKECLAKVHGLQ-----------YIDMLLIHSPLEGRTK 125
                HQ           Q + ++ L + H +            YID+L IH  L+    
Sbjct: 98  ESLDLHQGSKVDQEYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDILQIHR-LDKEAS 156

Query: 126 RLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQ-------WERLTIKPVVNQIEISPW 178
             E  R++ + V SG V+ IG S+       EL         ++ + ++   N +     
Sbjct: 157 MEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNRED- 215

Query: 179 VMRSELADYCKSVGLVVEAFAPLTHGY------------------------KLHDAD--- 211
              +EL  +CK  G+ +  ++P   G                         KL ++D   
Sbjct: 216 --ENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEI 273

Query: 212 ---LVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268
              +  ++K+ G S   V + W L  G   +    +++R++E + A + + T E+++L++
Sbjct: 274 IGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVEELELLE 333

Query: 269 HPDAYEP 275
            P  Y+P
Sbjct: 334 KP--YKP 338

>Sklu_2082.3 , Contig c2082 6775-7791
          Length = 338

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 120/294 (40%), Gaps = 54/294 (18%)

Query: 33  KIVYEALKAGYRHFDTAVLYGN---EHQVGEGI---------------LQWIQEDPQQNK 74
           KI+      G R FDTA +Y N   E  +GE +               +++  ++  +  
Sbjct: 44  KILKHCYDNGLRTFDTADVYSNGLSERLLGEFLKRYKINRETVVILSKVRFPVDESLELP 103

Query: 75  RSDVFYT---TKLWNSQNGYHQAQTAIKECLAKVHGL-QYIDMLLIHSPLEGRTKRLETW 130
            S ++ T   T L  +  G    +  +      V  L  YID+L IH   +  T   ET 
Sbjct: 104 LSTIYGTDEVTALTLANQGGLSRKHIMDGVAKSVERLGTYIDVLQIHR-FDHETPMEETM 162

Query: 131 RAMQEAVESGLVKNIGVSNY------GRQHVEELLQWERLTIKPVV-------NQIEISP 177
           +A+ + VE G  + IG S+         Q V E   W +              ++ E+ P
Sbjct: 163 KALNDVVEKGYTRYIGASSMLATEFAELQFVAEKHSWFKFISSQSCYNLLYREDERELIP 222

Query: 178 WVMRSELADYC---KSVGLVVEAFAPLTHGY----KLHDA-----DLVRVSKEVG--RST 223
           +  R  +        S GL+       T  Y    +LH+      +++R  +EV   R T
Sbjct: 223 FAKRHRIGLIPWSPNSRGLLTRPLGLTTARYEADSRLHNIAPDEQEIIRRVEEVAKKRDT 282

Query: 224 VQVLIR--WSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEP 275
              ++   W L  G  P+    + +R++E L+A +F+LT E+ + ++ P  Y+P
Sbjct: 283 TMAIVSTAWVLSKGCYPIVGLSSTERVDEALKAIDFELTEEESKYLEEP--YKP 334

>Scas_687.3
          Length = 344

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 123/309 (39%), Gaps = 74/309 (23%)

Query: 35  VYEALK----AGYRHFDTAVLYGN---EHQVGEGILQWIQEDPQQNKRSDVFYTTK---- 83
           V+E LK     G R FDTA +Y N   E  +GE + ++        KR  V   TK    
Sbjct: 43  VFEILKHCYDRGLRTFDTADVYSNGISERLLGEFLKKF------NIKRETVVILTKTFFP 96

Query: 84  ------LWNSQNGYHQAQT---AIKECLAKVHGLQ-----------YIDMLLIHSPLEGR 123
                 L   +  + ++ T     +  L++ H LQ           YID+L IH   +  
Sbjct: 97  VDESLSLALGEMSFSESDTLDLTNQRGLSRKHILQSVKNSVERLGTYIDVLQIHR-FDPT 155

Query: 124 TKRLETWRAMQEAVESGLVKNIGVSNY-GRQHVEELLQWERLTIKPVVNQIEISPWVMRS 182
           T   ET +A+ + VESG V+ IG S+    Q VE     ++      VN       + R 
Sbjct: 156 TPIKETMKALNDVVESGDVRYIGASSMLPTQFVEMQSVADKHDWFQFVNVQSCYNLLYRE 215

Query: 183 ---ELADYCKSVGLVVEAFAP---------------------LTHGYKLHDAD------- 211
              +L  YC+   + +  ++P                     + +G+ + D         
Sbjct: 216 DERDLMQYCEKHNIALTPWSPNHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSEIEII 275

Query: 212 --LVRVSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269
             +  +SK+   S   +   W L  G  P+    ++ R++E + A + + T E+ + ++ 
Sbjct: 276 NRVEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETKQLEE 335

Query: 270 PDAYEPTDW 278
           P  Y+P ++
Sbjct: 336 P--YKPRNF 342

>Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement
          Length = 342

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 118/302 (39%), Gaps = 67/302 (22%)

Query: 33  KIVYEALKAGYRHFDTAVLYGN---EHQVGEGILQWIQEDPQQNKRSDVFY----TTKLW 85
           K++      G R FDTA  Y N   E  VG+ + ++          + VF+    T  L 
Sbjct: 44  KVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVFFPVDETLDLS 103

Query: 86  NSQNGYHQAQTAI--KECLAKVHGLQ-----------YIDMLLIHSPLEGRTKRLETWRA 132
           +S+      Q  +  +  L++ H L            YID+L IH   +  T   ET +A
Sbjct: 104 HSKGMDEATQLTVANQRGLSRKHILDGVAKSVERLGTYIDVLQIHR-FDTETPVNETMKA 162

Query: 133 MQEAVESGLVKNIGVSNY------GRQHVEELLQWERLT----------------IKPVV 170
           + + V  G  + IG S+         Q V E   W +                  + P  
Sbjct: 163 LNDVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQSCYNLLYREDERELIPFA 222

Query: 171 NQ--IEISPWV----------MRSELADYCKSVGLV-VEAFAPLTHGYKLHDADLVR--- 214
            +  I + PW           + ++   +    GL  + AF       + H+ ++VR   
Sbjct: 223 KRHHIGLIPWSPNARGVLTRPLGTQTLRHSTDFGLKRISAF-----DLQPHEEEIVRRVG 277

Query: 215 -VSKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAY 273
            ++++ G +   V I W L  G  P+    + +R++E ++A  F+LT E+   ++ P  Y
Sbjct: 278 EIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEEATYLEEP--Y 335

Query: 274 EP 275
            P
Sbjct: 336 RP 337

>CAGL0E05214g complement(508038..509078) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 346

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 118/295 (40%), Gaps = 62/295 (21%)

Query: 34  IVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLW-------- 85
           I+  A   G R +DTA +Y N +   E +L+   E   Q KR  V   TK++        
Sbjct: 48  ILKHAYDRGLRTYDTADVYSNGY--SERLLKEFFE-KYQIKRETVVIMTKVFFGVDEDLN 104

Query: 86  -----NSQNGYHQAQTAIKECLAKVHGLQ-----------YIDMLLIHSPLEGRTKRLET 129
                 + N +       +  L++ H L+           YID+L IH  L+  T   E 
Sbjct: 105 LHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHR-LDKETPMKEI 163

Query: 130 WRAMQEAVESGLVKNIGVSNY------GRQHVEELLQW-ERLTIKPVVNQI------EIS 176
            +A+ + VE+G  + IG S+         Q + E   W + ++++   N +      EI 
Sbjct: 164 MKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDEREII 223

Query: 177 PWVMRSELADY---CKSVGLVVEAFAPLTH------GYKLHDAD------------LVRV 215
           P+  R  +A       + GL+       T        +K  D D            +  V
Sbjct: 224 PFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLTEDQKEIINRVEEV 283

Query: 216 SKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHP 270
           +K+   S   +   W L  G  P+    ++ R++E + + +F+L+ E ++ I+ P
Sbjct: 284 AKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYIEEP 338

>YPL088W (YPL088W) [5356] chr16 (381960..382988) Putative aryl
           alcohol dehydrogenase, may participate in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [1029 bp, 342 aa]
          Length = 342

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 120/305 (39%), Gaps = 63/305 (20%)

Query: 33  KIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWN------ 86
           KI+      G R FDTA  Y N   + E I++   E     KR  V   TK++       
Sbjct: 44  KIMKHCYDKGLRTFDTADFYSN--GLSERIIKEFLE-YYSIKRETVVIMTKIYFPVDETL 100

Query: 87  ------SQNGYHQAQTAIKECLAKVH---GLQ--------YIDMLLIHSPLEGRTKRLET 129
                 + N + +   + +  L++ H   G++        YID+L IH  L+  T   E 
Sbjct: 101 DLHHNFTLNEFEELDLSNQRGLSRKHIIAGVENSVKRLGTYIDLLQIHR-LDHETPMKEI 159

Query: 130 WRAMQEAVESGLVKNIGVSNYGRQHVEELLQ-------WERLTIKPVVNQI------EIS 176
            +A+ + VE+G V+ IG S+       EL         ++ ++ +   N +      E+ 
Sbjct: 160 MKALNDVVEAGHVRYIGASSMLATEFAELQFTADKYGWFQFISSQSYYNLLYREDERELI 219

Query: 177 PWVMRSELADYC---KSVGLVVEAFAPLTHGYK-------LHDADLV-----------RV 215
           P+  R  +        + G++       T   K       LH  +L            +V
Sbjct: 220 PFAKRHNIGLLPWSPNARGMLTRPLNQSTDRIKSDPTFKSLHLDNLEEEQKEIINRVEKV 279

Query: 216 SKEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEP 275
           SK+   S   + I W L  G  P+    T  R++E + A    LT E+++ ++ P  Y+P
Sbjct: 280 SKDKKVSMAMLSIAWVLHKGCHPIVGLNTTARVDEAIAALQVTLTEEEIKYLEEP--YKP 337

Query: 276 TDWEC 280
               C
Sbjct: 338 QRQRC 342

>CAGL0E05192g complement(506594..507631) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 345

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 118/294 (40%), Gaps = 61/294 (20%)

Query: 34  IVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQ 93
           I+  A   G R +DTA +Y N +   E +L+   E   Q KR  V   TK++   +    
Sbjct: 48  ILKHAYDRGLRTYDTADVYSNGY--SERLLKEFFE-KYQIKRETVVIMTKVFFGVDEDLN 104

Query: 94  AQTAIK------------ECLAKVHGLQ-----------YIDMLLIHSPLEGRTKRLETW 130
            Q  +K              L++ H L+           YID+L IH  L+  T   E  
Sbjct: 105 LQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHR-LDKETPMKEIM 163

Query: 131 RAMQEAVESGLVKNIGVSNY------GRQHVEELLQW-ERLTIKPVVNQI------EISP 177
           +A+ + VE+G  + IG S+         Q + E   W + ++++ + N +      EI P
Sbjct: 164 KALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSLYNLLIREDEREIIP 223

Query: 178 WVMRSELADY---CKSVGLVVEAFAPLTH------GYKLHDADLV------------RVS 216
           +  R  +A       + GL+       T        +K  + D +             V+
Sbjct: 224 FAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTEDQKEIINRVEEVA 283

Query: 217 KEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHP 270
           K+   S   +   W L  G  P+    ++ R++E + + +F+L  E ++ ++ P
Sbjct: 284 KKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDIKYLEEP 337

>Scas_719.39
          Length = 345

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 120/296 (40%), Gaps = 67/296 (22%)

Query: 42  GYRHFDTAVLYGN---EHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQT-- 96
           G R FDTA +Y N   E  +GE + ++        +R  V   TK++   +   +  +  
Sbjct: 54  GLRTFDTADVYNNGQSEVLLGEFLKKY------NIRRETVVILTKIYFDSDDSMEVGSNF 107

Query: 97  -AIKEC----------LAKVHGLQ-----------YIDMLLIHSPLEGRTKRLETWRAMQ 134
            +I E           L++ H +Q           YID+L IH  L+         +++ 
Sbjct: 108 ASINESTKLDLVNQRGLSRKHIIQGVKNSVRRLGTYIDVLQIHR-LDDNVPMKSIMKSLN 166

Query: 135 EAVESGLVKNIGVSNYGRQHVEEL------------LQWE-------RLTIKPVV----- 170
           + V SG V+ IG S+       +L            + W+       R   + V+     
Sbjct: 167 DVVLSGDVRYIGASSMLATEFADLQAIADKHDWFQFVNWQSQYNLLYREDEREVIPYAKR 226

Query: 171 NQIEISPWV--MRSELADYCKSVGLVVEAFAPLTHGYKLHDADLV----RVSKEVGRSTV 224
           + I ++PW    R  LA    +V    + F P        D +++    +++K+   S  
Sbjct: 227 HNIAVTPWSPNARGLLAKPA-NVTSERKNFDPRLASISDDDKEIIGRVEKIAKDKDISMA 285

Query: 225 QVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWEC 280
            V   W L   +LP+     ++R++E ++A    LT E+++ ++  +AY+P   E 
Sbjct: 286 MVSTAWVLSKRFLPIVGMSKMERIDEAVKAIKVTLTQEEIKYLE--EAYKPKPLET 339

>ABR094W [685] [Homologous to ScYMR041C - SH]
           complement(555931..557010) [1080 bp, 359 aa]
          Length = 359

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 75/157 (47%), Gaps = 21/157 (13%)

Query: 24  YDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQV-GEGILQWIQEDPQQNKRSDVFYTT 82
           Y++P   T  +V  AL+AG    DT+  YG   ++ GE +     E P    R   F  T
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP----RETYFICT 104

Query: 83  KLWN---SQNGYHQA--QTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLETWRAMQEAV 137
           K+     S   Y  A  + ++    A++H  +Y+D++ +H  +E   +    W A+QE  
Sbjct: 105 KVGREGPSDFDYSAAHVRASVHRSCARLH-TEYLDLVYLHD-IEF-VEAAGIWEALQELR 161

Query: 138 ---ESGLVKNIGVSNYGRQHVEELLQ--WERLTIKPV 169
              + G+++  G+S Y  + ++E+ +   ER  + P+
Sbjct: 162 RLKDEGVIRFFGISGYPVELLQEVSEQACERPDVGPL 198

>CAGL0E05236g complement(509478..510512) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 344

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 112/294 (38%), Gaps = 61/294 (20%)

Query: 34  IVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQEDPQQNKRSDVFYTTKLWNSQ----- 88
           I+  A   G R +DTA +Y N +   E +L+   E   Q KR  V   +K++ +      
Sbjct: 47  ILKRAYDRGLRTYDTADMYSNGY--SERLLKEFFE-KYQIKRETVVIMSKVFYAVDEDLD 103

Query: 89  -------NGYHQAQTAIKECLAKVHGLQ-----------YIDMLLIHSPLEGRTKRLETW 130
                  N         +  L++ H L+           YID+L IH  L+  T   E  
Sbjct: 104 LHHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGTYIDVLQIHR-LDKETPMKEIM 162

Query: 131 RAMQEAVESGLVKNIGVSNY------GRQHVEELLQWERLT----------------IKP 168
           +A+ + VE+G  + IG S+         Q + E   W +                  I P
Sbjct: 163 KALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDEREIIP 222

Query: 169 VVNQ--IEISPWV--MRSELADYCKSVGLVVEA--------FAPLTHGYKLHDADLVRVS 216
              +  I ++PW    R  L      + + +++           LT   K     +  V+
Sbjct: 223 FAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIINRVEEVA 282

Query: 217 KEVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDHP 270
           K+   S   +   W L  G  P+    ++ R++E + + +F+L  E ++ ++ P
Sbjct: 283 KKHNTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYLEEP 336

>Kwal_26.8377
          Length = 338

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 71/152 (46%), Gaps = 22/152 (14%)

Query: 15  QIPSIALGTYDI-------PQSI-TAKIVYEALKAGYRHFDTAVLYGNEHQV-GEGILQW 65
           Q+P + LG   +       P +I  ++++  A++ G R  DT+  YG+  ++ G+ +   
Sbjct: 21  QLPKLVLGGATLNTQYNEDPTTIPVSEMLKYAVQHGIRAIDTSPYYGDSEKLFGKALESL 80

Query: 66  IQEDPQQNKRSDVFYTTKLWNSQ------NGYHQAQTAIKECLAKVHGLQYIDMLLIHSP 119
             E P++N     F  TK+   +      +  H   + ++ C  +     Y+D++ +H  
Sbjct: 81  KDEIPREN----YFICTKVGRIRLDEFDYSREHVRSSVLRSC--ERLRTDYLDVVFLHDV 134

Query: 120 LEGRTKR-LETWRAMQEAVESGLVKNIGVSNY 150
               T + LE  + +++  + G++ N G+S Y
Sbjct: 135 EFVETAQVLEALKELRKLKDEGVLHNFGISGY 166

>YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with
           similarity to S. pombe pyridoxal reductase [1038 bp, 345
           aa]
          Length = 345

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 97  AIKECLAKVHGLQYIDML---LIHSPL--EGRTKRLETWRAMQEAVESGLVKNIGVSNYG 151
           ++K  ++ + G  YID+     I + L  +G     E++ A+ E +  G++  I +S   
Sbjct: 109 SVKNSVSAIGG--YIDIFEVARIDTSLCTKGEVYPYESFEALAEMISEGVIGGISLSEVN 166

Query: 152 RQHVEELLQ-WERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHG 204
            + +  + + W +      V     S  ++ + +A  C  +GL +  ++PL  G
Sbjct: 167 EEQIRAIHKDWGKFLTCVEVELSLFSNDILHNGIAKTCAELGLSIICYSPLGRG 220

>KLLA0B05302g 478541..478696 similar to sp|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 galactose-induced protein of
           aldo/keto reductase family, hypothetical start
          Length = 51

 Score = 30.0 bits (66), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 133 MQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISP 177
           MQ   ++G  + +GVSN+  +++E++       + P VNQ  + P
Sbjct: 1   MQPLPKTGKTRAVGVSNFSIKNLEDMSNSGLDVLVPAVNQFNVHP 45

>YJR155W (AAD10) [3046] chr10 (727320..728186) Putative aryl alcohol
           dehydrogenase, may participates in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [867 bp, 288 aa]
          Length = 288

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 38/61 (62%), Gaps = 5/61 (8%)

Query: 212 LVRVSKEVGRSTVQVL----IRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
           L++V++E G  +V  +    +R   +H + PL   + ++ L++N+EA + +LT EQ++ +
Sbjct: 191 LLKVAEEHGTESVTAIAIAYVRSKAKHVF-PLVGGRKIEHLKQNIEALSIKLTPEQIKYL 249

Query: 268 D 268
           +
Sbjct: 250 E 250

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 60/157 (38%), Gaps = 36/157 (22%)

Query: 21  LGTYDIPQSITAKIVYEALKAGYRHF-----DTAVLYGNEHQVGEGILQWIQEDPQQNKR 75
           +G +DIPQ       Y  LK+G          T  L G+  +VG  +     +D   +  
Sbjct: 106 IGIWDIPQD------YSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLAS-- 157

Query: 76  SDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLL--------IHSPLEGRTKRL 127
           S + YT ++WN + G              ++ L++ DM+          H     R K+L
Sbjct: 158 SSLDYTVRIWNVETGED------------IYKLKHPDMVTSMSFSYDGTHLATVARDKKL 205

Query: 128 ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERL 164
             W   +E V S    + G  N   Q V  L   ERL
Sbjct: 206 RVWNVREEKVVSEGAAHAGAKN---QRVVWLGNSERL 239

>YFL057C (AAD16) [1627] chr6 complement(14305..14763) Predicted aryl
           alcohol dehydrogenase C-terminal domain, may participate
           in late steps of degradation of aromatic compounds that
           arise from the degradation of lignocellulose [459 bp,
           152 aa]
          Length = 152

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 212 LVRVSKEVGRSTVQVL----IRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
           L +V++E G  +V  +    +R S      PL   + ++ L++N+EA + +LT EQ++ +
Sbjct: 56  LAKVAEEHGTESVTAIAIAYVR-SKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIKYL 114

Query: 268 DHPDAYE---PTDWECTD 282
           +    ++   PT++   D
Sbjct: 115 ESIIPFDVGFPTNFIGDD 132

>KLLA0B09658g complement(837873..838901) similar to sgd|S0006331
           Saccharomyces cerevisiae YPR127w, hypothetical start
          Length = 342

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query: 111 IDMLLIHSPLEGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQ--WERLTIKP 168
           +D+ LI    E    R ET+  + E V+ G +  I +S    + +  + +   E L    
Sbjct: 129 LDLELIKKTGESVFPR-ETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGEYL---- 183

Query: 169 VVNQIEISPW---VMRSELADYCKSVGLVVEAFAPLTHG 204
           V  ++E+S +   ++ + + D C  +GL + A++PL  G
Sbjct: 184 VCVEVELSMFSAEILSNGIVDTCNELGLPIVAYSPLGRG 222

>CAGL0D04840g 471574..472164 no similarity, hypothetical start
          Length = 196

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 33/67 (49%)

Query: 130 WRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELADYCK 189
           +  M+E +E+G  +   ++   + H++  L+    T  P+V Q+   P  +  ++A Y +
Sbjct: 108 YMRMKETLETGYYRKHYIAPLLKSHLKSHLKSNPSTTVPIVTQLATHPSDIPPQMAKYIR 167

Query: 190 SVGLVVE 196
            + +  E
Sbjct: 168 GMDVTTE 174

>YDL243C (AAD4) [634] chr4 complement(17577..18566) Putative
           aryl-alcohol dehydrogenase, may participates in late
           steps of degradation of aromatic compounds that arise
           from the degradation of lignocellulose [990 bp, 329 aa]
          Length = 329

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 212 LVRVSKEVGRSTVQVL----IRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
           L +V++E G  +V  +    +R S      PL   + ++ L++N+EA + +LT EQ++ +
Sbjct: 233 LAKVAEEHGTESVTAIAIAYVR-SKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIEYL 291

Query: 268 D 268
           +
Sbjct: 292 E 292

>YNL331C (AAD14) [4284] chr14 complement(16118..17248) Putative aryl
           alcohol dehydrogenase, may participate in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [1131 bp, 376 aa]
          Length = 376

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 212 LVRVSKEVGRSTVQVL----IRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLI 267
           L ++++E G  +V  +    +R S      PL   + ++ L++N+EA + +LT EQ++ +
Sbjct: 279 LTKIAEEHGTESVTAIAIAYVR-SKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYL 337

Query: 268 D 268
           +
Sbjct: 338 E 338

>YMR041C (YMR041C) [4005] chr13 complement(350965..351972) Member of
           the aldo-keto reductase family, which include some
           related monomeric NADPH-dependent oxidoreductases, has
           high similarity to uncharacterized C. albicans
           Orf6.6905p [1008 bp, 335 aa]
          Length = 335

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 56/136 (41%), Gaps = 17/136 (12%)

Query: 25  DIPQSITAK-IVYEALKAGYRHFDTAVLYG-NEHQVGEGILQWIQEDPQQNKRSDVFYTT 82
           D P+SI  + I+  A   G    DT+  YG +E   G  +     E P    R   F  T
Sbjct: 30  DEPESIPLEDIIKYAFSHGINAIDTSPYYGPSEVLYGRALSNLRNEFP----RDTYFICT 85

Query: 83  KL-------WNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHS-PLEGRTKRLETWRAMQ 134
           K+       +N    +   + ++     ++H   Y+D++ +H          LE  + ++
Sbjct: 86  KVGRIGAEEFNYSRDF--VRFSVHRSCERLHT-TYLDLVYLHDVEFVKFPDILEALKELR 142

Query: 135 EAVESGLVKNIGVSNY 150
                G++KN G+S Y
Sbjct: 143 TLKNKGVIKNFGISGY 158

>Sklu_2241.3 YML059C, Contig c2241 1211-5983 reverse complement
          Length = 1590

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 56/136 (41%), Gaps = 13/136 (9%)

Query: 102  LAKVHGLQYIDMLLIHSPLEGRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQW 161
            LA++    +  + L H  +  R  RL   + +Q+         I  S+ G ++   L+  
Sbjct: 950  LARIPRTLFEVLALEHPSIMIRVSRLVARKILQQQSIGNEPSKIVFSSNGNKYDYSLMIP 1009

Query: 162  ERLTIK-PVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLTHGYKLHD--ADLVRVSKE 218
               T K  V+N   +S    RS           +     P+THG  + +    LV   ++
Sbjct: 1010 PSETTKGSVINSESVSSNSTRS----------YITITILPITHGLPVEEFAIKLVSAFRQ 1059

Query: 219  VGRSTVQVLIRWSLQH 234
            +GRST+ +  R +L H
Sbjct: 1060 LGRSTISLNQRTALSH 1075

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,739,807
Number of extensions: 399598
Number of successful extensions: 1272
Number of sequences better than 10.0: 70
Number of HSP's gapped: 1128
Number of HSP's successfully gapped: 82
Length of query: 284
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 184
Effective length of database: 13,134,309
Effective search space: 2416712856
Effective search space used: 2416712856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)