Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_672.28*92923742e-48
Scas_691.392923742e-48
AGL310C92923542e-45
YPR043W (RPL43A)92923491e-44
YJR094W-A (RPL43B)92923491e-44
CAGL0H08734g92923473e-44
KLLA0E05896g92923231e-40
AGR067W112535630.53
KLLA0F19734g113328601.4
KLLA0D02266g50122548.5
CAGL0L03916g64242549.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_691.3
         (92 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_672.28*                                                          148   2e-48
Scas_691.3                                                            148   2e-48
AGL310C [4002] [Homologous to ScYPR043W (RPL43A) - SH; ScYJR094W...   140   2e-45
YPR043W (RPL43A) [5476] chr16 (654161..654162,654566..654842) Ri...   139   1e-44
YJR094W-A (RPL43B) [2986] chr10 (608222..608223,608499..608775) ...   139   1e-44
CAGL0H08734g join(complement(852251..852252),complement(851585.....   138   3e-44
KLLA0E05896g join(complement(532447..532448),complement(531676.....   129   1e-40
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    29   0.53 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    28   1.4  
KLLA0D02266g 193082..194587 similar to sp|P36113 Saccharomyces c...    25   8.5  
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    25   9.7  

>Scas_672.28*
          Length = 92

 Score =  148 bits (374), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 76/92 (82%), Positives = 76/92 (82%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KKC                RSTIRRLREMVEA
Sbjct: 61 KKCVAGGAYTVSTAAAATVRSTIRRLREMVEA 92

>Scas_691.3
          Length = 92

 Score =  148 bits (374), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 76/92 (82%), Positives = 76/92 (82%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KKC                RSTIRRLREMVEA
Sbjct: 61 KKCVAGGAYTVSTAAAATVRSTIRRLREMVEA 92

>AGL310C [4002] [Homologous to ScYPR043W (RPL43A) - SH;
          ScYJR094W-A (RPL43B) - SH] (120834..121112) [279 bp, 92
          aa]
          Length = 92

 Score =  140 bits (354), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 72/92 (78%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIW C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KK                 RSTIRRLREM EA
Sbjct: 61 KKTVAGGAYTFSTAAAATVRSTIRRLREMAEA 92

>YPR043W (RPL43A) [5476] chr16 (654161..654162,654566..654842)
          Ribosomal protein L43A (human L37A), identical to
          Rpl43Bp [279 bp, 92 aa]
          Length = 92

 Score =  139 bits (349), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 72/92 (78%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLE+QQHARYDCSFCGKK VKRGAAGIWTC  C
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KK                 RSTIRRLREMVEA
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLREMVEA 92

>YJR094W-A (RPL43B) [2986] chr10 (608222..608223,608499..608775)
          Ribosomal protein L43B (human L37A), identical to
          Rpl43Ap [279 bp, 92 aa]
          Length = 92

 Score =  139 bits (349), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 72/92 (78%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLE+QQHARYDCSFCGKK VKRGAAGIWTC  C
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KK                 RSTIRRLREMVEA
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLREMVEA 92

>CAGL0H08734g
          join(complement(852251..852252),
          complement(851585..851861)) highly similar to sp|P49631
          Saccharomyces cerevisiae YPR043w RPL43A or sp|P49631
          Saccharomyces cerevisiae YJR094wa RPL43B
          Length = 92

 Score =  138 bits (347), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 73/92 (79%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKK V+RGAAGIW+C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKTVRRGAAGIWSCHSC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
          KK                 RSTIRRLR+MVEA
Sbjct: 61 KKTVAGGAYTVSTAAAATVRSTIRRLRDMVEA 92

>KLLA0E05896g
          join(complement(532447..532448),
          complement(531676..531952)) highly similar to sp|P49631
          Saccharomyces cerevisiae YPR043W (RPL43A) or YJR094W-A
          (RPL43B) 60S ribosomal protein, start by similarity
          Length = 92

 Score =  129 bits (323), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/92 (69%), Positives = 69/92 (75%)

Query: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSC 60
          MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHA Y+CSFCGK  VKRGAAG+W+C SC
Sbjct: 1  MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHATYNCSFCGKTCVKRGAAGVWSCSSC 60

Query: 61 KKCXXXXXXXXXXXXXXXXRSTIRRLREMVEA 92
           +                 RSTIRRLR+M EA
Sbjct: 61 NRTIAGGAYTLSTAAAATVRSTIRRLRDMAEA 92

>AGR067W [4377] [Homologous to ScYDR128W - SH]
            complement(842182..845559) [3378 bp, 1125 aa]
          Length = 1125

 Score = 28.9 bits (63), Expect = 0.53,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 27   KKLEVQQHARYDCSFCGKKAVKRGAAGIWTCGSCK 61
            K +E      + C++CG +A KR    I+ CGSC+
Sbjct: 1061 KWIERSSAITHSCAYCGLQAKKR----IFLCGSCQ 1091

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 27.7 bits (60), Expect = 1.4,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 4/28 (14%)

Query: 34   HARYDCSFCGKKAVKRGAAGIWTCGSCK 61
            H + +CS+CG KA +     ++ CG+C+
Sbjct: 1073 HTQQNCSYCGLKAGRL----VFVCGNCQ 1096

>KLLA0D02266g 193082..194587 similar to sp|P36113 Saccharomyces
           cerevisiae YKR017c singleton, start by similarity
          Length = 501

 Score = 25.4 bits (54), Expect = 8.5,   Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 10/22 (45%)

Query: 39  CSFCGKKAVKRGAAGIWTCGSC 60
           C FCG    K G     TC SC
Sbjct: 296 CPFCGTSIEKNGGCNHMTCQSC 317

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 25.4 bits (54), Expect = 9.7,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 5/42 (11%)

Query: 14  YGVRYGSSLRRQVKKLEVQQHAR-----YDCSFCGKKAVKRG 50
           Y   Y S +  Q   L+V   A      ++C FCGK+  + G
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAG 521

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.134    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,900,939
Number of extensions: 46750
Number of successful extensions: 158
Number of sequences better than 10.0: 11
Number of HSP's gapped: 151
Number of HSP's successfully gapped: 11
Length of query: 92
Length of database: 16,596,109
Length adjustment: 63
Effective length of query: 29
Effective length of database: 14,415,175
Effective search space: 418040075
Effective search space used: 418040075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)