Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_690.3642442421730.0
Scas_588.1442342913700.0
YDR300C (PRO1)42843013440.0
KLLA0C10296g41842612751e-175
YHR033W42343112711e-174
Kwal_47.1818742143012531e-171
CAGL0D03894g48547812541e-170
CAGL0H01441g42742712281e-167
AAL061C42042211621e-158
CAGL0K03905g34960691.6
KLLA0F07689g610177691.8
ADR106W79837673.6
CAGL0H02673g26770663.6
Sklu_2086.3616166656.2
ACR279C603119639.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_690.36
         (424 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_690.36                                                           841   0.0  
Scas_588.14                                                           532   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   522   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   495   e-175
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   494   e-174
Kwal_47.18187                                                         487   e-171
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   487   e-170
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   477   e-167
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   452   e-158
CAGL0K03905g 362440..363489 weakly similar to sp|P32841 Saccharo...    31   1.6  
KLLA0F07689g 727832..729664 highly similar to sp|P31383 Saccharo...    31   1.8  
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    30   3.6  
CAGL0H02673g complement(243231..244034) similar to sp|P36144 Sac...    30   3.6  
Sklu_2086.3 YAL016W, Contig c2086 2156-4006 reverse complement         30   6.2  
ACR279C [1326] [Homologous to ScYAL016W (TPD3) - SH] (860598..86...    29   9.4  

>Scas_690.36
          Length = 424

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/424 (97%), Positives = 412/424 (97%)

Query: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDA 60
           MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHK            LDA
Sbjct: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDA 60

Query: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120
           MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN
Sbjct: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120

Query: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180
           TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP
Sbjct: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180

Query: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240
           KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI
Sbjct: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240

Query: 241 IMSSQTPANILKIIEYMETSNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENSETYL 300
           IMSSQTPANILKIIEYMETSNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENSETYL
Sbjct: 241 IMSSQTPANILKIIEYMETSNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENSETYL 300

Query: 301 KNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVG 360
           KNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVG
Sbjct: 301 KNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVG 360

Query: 361 ERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLAL 420
           ERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLAL
Sbjct: 361 ERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLAL 420

Query: 421 TPRY 424
           TPRY
Sbjct: 421 TPRY 424

>Scas_588.14
          Length = 423

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/429 (62%), Positives = 322/429 (75%), Gaps = 14/429 (3%)

Query: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDA 60
           M+K  T+VIKLGSSSLVDE T+EPKL+ M+ +VE V  L+RLGHK            L  
Sbjct: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62

Query: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120
           +NL K+P  L+E+QAIAA+GQG+LIGRW++LF Q+ ++IAQIL+TR DI  WTQ+KNAQN
Sbjct: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122

Query: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180
           TIN LLKMGVVPIVNENDTLS+SEIKFGDNDTLSAITSALV ADYLFLLTDVDCLYTDNP
Sbjct: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182

Query: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240
           + N +AKPIL V D+     +K L    + S SGS++GTGGM TK+ AADLATN G+HTI
Sbjct: 183 RTNPEAKPILVVPDL-----AKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTI 237

Query: 241 IMSSQTPANILKIIEYMETSNL------KVDGGVCSNNDLELKNLIAHDVPLHTKFIANE 294
           IM S  P NILKI+EYM+  +L      K  G + S  D EL  L +  VPLHT FIAN+
Sbjct: 238 IMKSDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIAND 297

Query: 295 NSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELEC 354
           N   +LKNREFWILHGLVT+GS+IID+ +Y  L RK +   GLLP+ IID E  FHELEC
Sbjct: 298 NLH-HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNK--AGLLPVGIIDIEGTFHELEC 354

Query: 355 VELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVH 414
           V+LK+G+RLPNG+++    L+ VGRARCNYTS E+++IKGL+S+QI E LGY DS Y  H
Sbjct: 355 VDLKLGKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAH 414

Query: 415 NENLALTPR 423
            ENLA  P 
Sbjct: 415 RENLAFPPH 423

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/430 (61%), Positives = 320/430 (74%), Gaps = 16/430 (3%)

Query: 2   TKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDAM 61
           +KS TIVIKLGSSSLVDE T+EPKL+ M+ IVE V  L+R+GHK            L  M
Sbjct: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66

Query: 62  NLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNT 121
            + K+P  L+E+QAIAAIGQG+LIGRW++LF Q++++IAQILLTR DI  WTQ+KNAQNT
Sbjct: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126

Query: 122 INALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPK 181
           IN LL MGV+PIVNENDTLSV EIKFGDNDTLSAITSAL++ADYLFLLTDVDCLYTDNP+
Sbjct: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186

Query: 182 VNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTII 241
            N DA PIL V D+     SK L    +   SGS++GTGGM TK+ AADLATN G+HT+I
Sbjct: 187 TNPDAMPILVVPDL-----SKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLI 241

Query: 242 MSSQTPANILKIIEYMETSNLKVDGGV--CSNNDL------ELKNLIAHDVPLHTKFIAN 293
           M S TPANI +I+EYM+T  L  +  V    N DL      E + L A +VPLHTKFIAN
Sbjct: 242 MKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIAN 301

Query: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353
           +N   +LKNREFWILHGLV+KG+++ID+ +Y  L RK +   GLLP  +ID +  FHELE
Sbjct: 302 DNKH-HLKNREFWILHGLVSKGAVVIDQGAYAALTRKNK--AGLLPAGVIDVQGTFHELE 358

Query: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413
           CV++KVG++LP+G ++    L+ VG+ARCNYTS E+ KIKGL SDQI E LGY DS YV 
Sbjct: 359 CVDIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVA 418

Query: 414 HNENLALTPR 423
           H ENLA  PR
Sbjct: 419 HRENLAFPPR 428

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  495 bits (1275), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 250/426 (58%), Positives = 314/426 (73%), Gaps = 11/426 (2%)

Query: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDA 60
           M K   IVIKLGSSSLVDE T+EPKLS M+ IVE V  L+R GHK            L  
Sbjct: 1   MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKT 60

Query: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120
           MN+K +P +LS++QAIAA+GQG+LIGRW+ LF +++++IAQIL+TR DI  WTQ+KNAQN
Sbjct: 61  MNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180
           TI+ LL MGVVPIVNENDTLSVSEIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNP
Sbjct: 121 TISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNP 180

Query: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240
           + N DAKPIL V D     IS+ L    +   SGS++GTGGM+TK+ AA+LATN G+HTI
Sbjct: 181 RANPDAKPILVVPD-----ISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTI 235

Query: 241 IMSSQTPANILKIIEYMETSNLKVDGGVCSNNDL---ELKNLIAHDVPLHTKFIANENSE 297
           IM S TP NI KI+ YM+  +  V+       DL   E+++L+ + VPLHT+FIAN N  
Sbjct: 236 IMKSDTPENISKIVLYMQERDDGVNELTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHH 295

Query: 298 TYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVEL 357
            +LKNR+FW+LHGLV++G++IID  +Y+ L RK +   GLLP  +I+ +  FHE EC+++
Sbjct: 296 -HLKNRQFWMLHGLVSQGAVIIDIGAYEALTRKNK--AGLLPAGVIEVQGSFHEHECIDI 352

Query: 358 KVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNEN 417
           K+G R  +G +++   LK VGRARCNYTS E++KIKGL+SDQI + LGY DS YV H EN
Sbjct: 353 KLGVRDSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHREN 412

Query: 418 LALTPR 423
           LA  P 
Sbjct: 413 LAFPPH 418

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  494 bits (1271), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/431 (58%), Positives = 309/431 (71%), Gaps = 15/431 (3%)

Query: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDA 60
           MTK+ TIVIKLGSSSLVDE T+EPKLS MT IVE V+ LKR+GHK            LDA
Sbjct: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60

Query: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120
           +N+  KP QLSE+QAIAA+GQG+LI RW MLF QY EQ AQILLTR DI  W Q+ NA+N
Sbjct: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120

Query: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180
           TIN LL MGV+PIVNENDTLS+SEI+FGDNDTLSAIT+ALV AD+LFLLTDVDCLYTDNP
Sbjct: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180

Query: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240
           + N DA+PI+ V ++ E      L    + S SGS +GTGGMRTK+ AADLA+N GI TI
Sbjct: 181 RTNPDARPIVLVPELSEG-----LPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETI 235

Query: 241 IMSSQTPANILKIIEYME---TSNLKVDGGVCSN----NDLELKNLIAHDVPLHTKFIAN 293
           +M S  P  + KI++Y++        +  G         D EL+ L  +DVP+HTKF+AN
Sbjct: 236 VMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLAN 295

Query: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353
           +N    LKNREFWILHGL+TKG+IIID+NSY  LL K      L P ++I+  D FHELE
Sbjct: 296 DNKHK-LKNREFWILHGLITKGAIIIDENSYDKLLSK--DMASLTPNAVIEVRDNFHELE 352

Query: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413
           CV+LK+G+RLPNG+++    ++ VG  R NYTS E+ KIKGL S++I + LGY  S YV 
Sbjct: 353 CVDLKIGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVA 412

Query: 414 HNENLALTPRY 424
           H EN+A  P++
Sbjct: 413 HRENIAFPPQF 423

>Kwal_47.18187
          Length = 421

 Score =  487 bits (1253), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 243/430 (56%), Positives = 310/430 (72%), Gaps = 16/430 (3%)

Query: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDA 60
           M+K+ TIVIKLGSSSLVDE T+EPKL+TM  +VE V  L+R+GH+            L  
Sbjct: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60

Query: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120
           +NL K+P  L+++QAIAA+GQG+LIGRW+ LF Q++++IAQIL+TR DI  WTQ+KNAQN
Sbjct: 61  LNLDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180
           TI+ LL+MGVVPIVNENDTLSVSEIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNP
Sbjct: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180

Query: 181 KVNKDAKPILTV---FDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGI 237
           + N +AKPIL V     M E ++        + S SGS++GTGGM TK+ AA+LATN G+
Sbjct: 181 RTNPNAKPILVVPATSQMSEGTLG-----VKTSSGSGSDVGTGGMTTKLIAAELATNAGV 235

Query: 238 HTIIMSSQTPANILKIIEYMETSNLKVDGGVCSN----NDLELKNLIAHDVPLHTKFIAN 293
           +TIIM S  P+NI K++ YM+     + G    N     + E+  L  + VPLHT+F+A+
Sbjct: 236 NTIIMKSAEPSNISKVVSYMQNCE-SITGAAADNVEHLQEQEMLRLQENCVPLHTRFVAD 294

Query: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353
           E S+ +L NREFW+LHGLV+KG+I+ID+ +Y  L RK +   GLLP  +I+ E  FHE E
Sbjct: 295 E-SQMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNK--AGLLPAGLIEVEGNFHEHE 351

Query: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413
           C++LKVG RL  G+++    +  +GRARCNYTS E+ KIKGL+SDQI   LGY DS YV 
Sbjct: 352 CIDLKVGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVA 411

Query: 414 HNENLALTPR 423
           H  NLA  P 
Sbjct: 412 HRGNLAFPPH 421

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  487 bits (1254), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/478 (54%), Positives = 326/478 (68%), Gaps = 64/478 (13%)

Query: 4   SNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDAMNL 63
           S TIVIKLG+SSLVDE TREPKLS MTQ+VE V  LKR GHK            L+AM +
Sbjct: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEM 61

Query: 64  KKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTIN 123
            KKP+ L+EIQAIAAIGQG+LIGRW MLF+QY E+IAQIL+TR DI GWTQ+KNAQNTI 
Sbjct: 62  DKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121

Query: 124 ALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKVN 183
            LL+MGVVPIVNENDTLS+SEIKFGDNDTLSAIT+ALV+AD+LFLLTDVDCLYT+NP+ N
Sbjct: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181

Query: 184 KDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIMS 243
            DAKPI+ V +M  D     +DT  S +D+GS++GTGGMRTK+ AADLATN G++TIIM 
Sbjct: 182 PDAKPIVIVPNM--DQGVPGVDT--SNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMK 237

Query: 244 SQTPANILKIIEYM------------------ETSNLKVD---------GGVCSN----- 271
           S  P+N+  I++Y+                   +  L +D         GGV S      
Sbjct: 238 SDAPSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEE 297

Query: 272 -----NDLELKNLIAHDVPLHTKFIANENSETYLKNREFWILHGLVTKGSIIIDKNSYK- 325
                 D ELK +   +VPLHT F+A ++ + +LKNREFWILHGLVTKG +IID+++Y  
Sbjct: 298 DLLSLQDAELKEIKERNVPLHTVFLA-KDIDHHLKNREFWILHGLVTKGVLIIDEDAYNT 356

Query: 326 ---------------------DLLRKKEKCKGLLPISIIDTEDQFHELECVELKVGERLP 364
                                D + + ++  GLLP  +I+ +  FHELECV++KVG+RLP
Sbjct: 357 LTNESGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLP 416

Query: 365 NGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLALTP 422
           NGK++  A L+ VGRARCN+TS E+N+IKGL  D++ + LGY  S YV H +NLA  P
Sbjct: 417 NGKLDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  477 bits (1228), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 307/427 (71%), Gaps = 14/427 (3%)

Query: 3   KSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDAMN 62
           K  TIVIKLG+SSLVDE T+EP+L+ M+ IVE V  L+RLGH             L  + 
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 63  LKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTI 122
           ++K+P  LSE+QAIAAIGQ KLIGRW+ LF  + + IAQILLTR DI  W+Q++NAQNT+
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 123 NALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKV 182
             LLKMGVVPI+NENDTLSV EIKFGDNDTLSAIT+ L++ADYLFLLTDVDCLYT +P+ 
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 183 NKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIM 242
           + DAKPIL V D+     SK L    + S SGS++GTGGM+TK+ AA+LATN G+HTIIM
Sbjct: 189 DPDAKPILIVPDL-----SKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIM 243

Query: 243 SSQTPANILKIIEYMET------SNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENS 296
            S  P+NI KI++Y+++       N   +G +      E + L    VP HTKF+AN  S
Sbjct: 244 KSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSIS 303

Query: 297 ETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVE 356
             +L+N+EFWILHGLVT G++IID+ +YK L RK +   GLLP+ +I+ E  FHE+ECV+
Sbjct: 304 R-HLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNK--AGLLPVGVIEIEGSFHEMECVD 360

Query: 357 LKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNE 416
           LKVG+RLPNG+++    L +VGRARCNY S EI+KIKG +SD+I   LGY +S Y+ H E
Sbjct: 361 LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420

Query: 417 NLALTPR 423
           N+A  P 
Sbjct: 421 NMAFPPH 427

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 240/422 (56%), Positives = 299/422 (70%), Gaps = 14/422 (3%)

Query: 6   TIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKXXXXXXXXXXXXLDAMNLKK 65
           TIV+KLGSSSLVDE T EPKLS M+ IVE V  L+R+GHK            L  +   +
Sbjct: 9   TIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTDR 68

Query: 66  KPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTINAL 125
           +P +LS++QAIAA+GQG+LI RW+ LFR +NE+IAQILLTR DI  W+Q+KNAQNT + L
Sbjct: 69  RPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHEL 128

Query: 126 LKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKVNKD 185
           L MGV PIVNENDTLS+S +KFGDNDTLSAIT+ L+ ADYLFL+TDVDCLYTDNP+ N D
Sbjct: 129 LAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPD 188

Query: 186 AKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIMSSQ 245
           AKPIL V D+     S+ L    + S SGS +GTGGM TKI AADLATN G+HTIIM S+
Sbjct: 189 AKPILVVPDL-----SQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSE 243

Query: 246 TPANILKIIEYME----TSNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENSETYLK 301
            P ++++I+E+ME     + +  D      ++L L  L  H VPLHT+FIAN   +  L 
Sbjct: 244 RPVDMVRIVEFMEWREQCTAVSADAETLQTDELNL--LQEHGVPLHTRFIANV-WQPSLN 300

Query: 302 NREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVGE 361
            REFWILHGLV+ G++IIDK +YK L RK +   GLLP  +I  E  FHELE V+LK+G 
Sbjct: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNK--AGLLPAGVIAVEGSFHELEAVDLKIGV 358

Query: 362 RLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLALT 421
           R  +G ++    L+ VGRARCNY+S E++KIKGL+S QI   LGY DS Y+ H ENLA  
Sbjct: 359 RKADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRENLAFP 418

Query: 422 PR 423
           PR
Sbjct: 419 PR 420

>CAGL0K03905g 362440..363489 weakly similar to sp|P32841
           Saccharomyces cerevisiae YMR133w meiotic recombination
           protein, hypothetical start
          Length = 349

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 133 IVNENDTLSVSEIKFGD-NDTLSAITSALVNADYLFLLTDVDCLYTDNPKVNKDAKPILT 191
           I NE+  L + EIKFG+ +D + +  +A +N  +L  +   +   T+   V K  KP++T
Sbjct: 250 IPNESAQLIIPEIKFGNISDIIDSENNAPLNKQFLTTVNTEEICNTNTTDVTKHTKPVIT 309

>KLLA0F07689g 727832..729664 highly similar to sp|P31383
           Saccharomyces cerevisiae YAL016w TPD3 ser/thr protein
           phosphatase 2A, regulatory chain A singleton, start by
           similarity
          Length = 610

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 71/177 (40%), Gaps = 35/177 (19%)

Query: 210 LSDSGSNIGTGGMRTKITAADLATNVGIHTIIMSSQTPANILKIIEYMETSNLKVDGGVC 269
           L  S   IG    R +  AAD           ++SQ  +N   + E +E         +C
Sbjct: 257 LQSSIQLIGDEAWRVRYMAADRFEE-------LASQFVSNPQYVSELLEPF-----LALC 304

Query: 270 SNNDLELKNLIAHDVPLHTKFIANENSETYLKNREFWILHGL------VTKGSIIIDKNS 323
            +N+ +++  IA  +P + K +   N  + + NR       L        + S+ ++  +
Sbjct: 305 QDNESDVRKAIAKQIPGYAKLL---NDPSVILNRIIPAAQNLSIDETECVRASLALEITN 361

Query: 324 YKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVGERLPNGKVNRKAGLKVVGRA 380
              LL K++    L+PI +   +D+F              P+ ++N  A LK+V  +
Sbjct: 362 LAPLLPKQDSMDSLVPILLHMLKDEF--------------PDVRLNIIAKLKIVNES 404

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 125 LLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALV 161
           L +M ++ + NENDTLS  +I+ G N T   I  +++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>CAGL0H02673g complement(243231..244034) similar to sp|P36144
           Saccharomyces cerevisiae YKR060w, hypothetical start
          Length = 267

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 235 VGIHTIIMSSQTPANILKIIEYMETSNLKVDGGVC--SNNDLELKNLIAHDVPLHTKFIA 292
           VG  +   + Q   NI  +IE++   N+K  GGV   S   L++K   +  +P++     
Sbjct: 196 VGFVSTHTAKQILENIQDVIEFLSDKNMKPSGGVIKGSIKSLQVKTASSASIPIYQ---Y 252

Query: 293 NENSETYLKN 302
           NEN E  + N
Sbjct: 253 NENKEKNIPN 262

>Sklu_2086.3 YAL016W, Contig c2086 2156-4006 reverse complement
          Length = 616

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 68/166 (40%), Gaps = 33/166 (19%)

Query: 217 IGTGGMRTKITAADLATNVGIHTIIMSSQTPANILKIIEYMETSNLKVDGGVCSNNDLEL 276
           IG    R +  AAD           +SSQ  AN   I E ++         +C +N+ ++
Sbjct: 271 IGDEAWRVRYMAADRFEE-------LSSQFTANPAFIEELIQPF-----LSLCEDNESDV 318

Query: 277 KNLIAHDVPLHTKFIANENSETYLKN-----REFWILHGLVTKGSIIIDKNSYKDLLRKK 331
           +  +A  +P  +K + +  S+  LK      +   +      + S+  +  +   LL K+
Sbjct: 319 RKAVAKQLPGFSKLLLD--SQVVLKKILPAVQNLSMDESEAVRASLASEVTNLAPLLSKQ 376

Query: 332 EKCKGLLPISIIDTEDQFHELECVELKVGERLPNGKVNRKAGLKVV 377
           E    L+PI +   +D+F              P+ ++N  A LKVV
Sbjct: 377 EAIDNLIPILLNMLKDEF--------------PDVRLNVIAKLKVV 408

>ACR279C [1326] [Homologous to ScYAL016W (TPD3) - SH]
           (860598..862409) [1812 bp, 603 aa]
          Length = 603

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 49/119 (41%), Gaps = 21/119 (17%)

Query: 267 GVCSNNDLELKNLIAHDVPLHTKFIANENSETYLKN-----REFWILHGLVTKGSIIIDK 321
            +C +N+ +++  IA  +P   K + N  S   LK      +   +      + S+  + 
Sbjct: 299 ALCEDNESDVRKAIAKQIPGFAKLLPN--SAVILKKLLPVVQTLCMDENETVRASLASEI 356

Query: 322 NSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVGERLPNGKVNRKAGLKVVGRA 380
                LL K+E    L+PI +   +D+F              P+ ++N  A LKVV  A
Sbjct: 357 TGLAPLLSKQEAIDNLIPILLNMLKDEF--------------PDVRLNIIAKLKVVNEA 401

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,534,011
Number of extensions: 595851
Number of successful extensions: 1694
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1697
Number of HSP's successfully gapped: 22
Length of query: 424
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 320
Effective length of database: 12,995,837
Effective search space: 4158667840
Effective search space used: 4158667840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)