Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_690.2075575539860.0
YLL001W (DNM1)75777227480.0
CAGL0D05808g77678027380.0
Kwal_33.1520077378226630.0
KLLA0F12892g77578626570.0
AAL174C75678026450.0
YKR001C (VPS1)70476114880.0
CAGL0L02299g70075414750.0
ABL001W68575514530.0
Scas_668.2872275914340.0
Kwal_26.792469155213321e-174
Sklu_2326.469056213211e-173
KLLA0B13277g68455212511e-162
ACR164C8682614246e-43
Sklu_1555.28842634122e-41
YOR211C (MGM1)9022684086e-41
KLLA0D06721g8832644069e-41
CAGL0L02783g8912644061e-40
Kwal_26.86138613274042e-40
Scas_605.178912644014e-40
YDL205C (HEM3)32751750.56
YOR165W (SEY1)77628703.2
CAGL0J09680g32945693.3
Kwal_47.17014155199703.5
AGR264C79128694.3
Kwal_27.1029888279668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_690.20
         (755 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_690.20                                                          1540   0.0  
YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1063   0.0  
CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1059   0.0  
Kwal_33.15200                                                        1030   0.0  
KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1028   0.0  
AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1023   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   577   0.0  
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   572   0.0  
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   564   0.0  
Scas_668.28                                                           556   0.0  
Kwal_26.7924                                                          517   e-174
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           513   e-173
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   486   e-162
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   167   6e-43
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         163   2e-41
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   161   6e-41
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   160   9e-41
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   160   1e-40
Kwal_26.8613                                                          160   2e-40
Scas_605.17                                                           159   4e-40
YDL205C (HEM3) [669] chr4 complement(92763..93746) Porphobilinog...    33   0.56 
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    32   3.2  
CAGL0J09680g complement(949959..950948) highly similar to sp|P28...    31   3.3  
Kwal_47.17014                                                          32   3.5  
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    31   4.3  
Kwal_27.10298                                                          30   8.3  

>Scas_690.20
          Length = 755

 Score = 1540 bits (3986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/755 (100%), Positives = 755/755 (100%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120
           VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN
Sbjct: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120

Query: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180
           NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL
Sbjct: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180

Query: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240
           TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE
Sbjct: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240

Query: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300
           VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL
Sbjct: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300

Query: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360
           NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY
Sbjct: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360

Query: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420
           SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK
Sbjct: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420

Query: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480
           SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY
Sbjct: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480

Query: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP
Sbjct: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540

Query: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNISKEAD 600
           SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNISKEAD
Sbjct: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNISKEAD 600

Query: 601 ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYDLEPHL 660
           ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYDLEPHL
Sbjct: 601 ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYDLEPHL 660

Query: 661 SEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKESML 720
           SEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKESML
Sbjct: 661 SEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKESML 720

Query: 721 EELLVEDQTIAQDRANCERLLETYKNASSLINNIL 755
           EELLVEDQTIAQDRANCERLLETYKNASSLINNIL
Sbjct: 721 EELLVEDQTIAQDRANCERLLETYKNASSLINNIL 755

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/772 (70%), Positives = 629/772 (81%), Gaps = 32/772 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY SGIDTLDLPILAVVGSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120
           VTRRPLVLQLNN+  +S    E+  S  NP       TK +  E     +E    G+  N
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNS-VNP---HDEVTKISGFEAGTKPLE--YRGKERN 114

Query: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180
              H  EWGEFLHIPG+RFYDF++I+REIENETAR+AGK+KGISK+PINLK+FSPHVLNL
Sbjct: 115 ---HADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNL 171

Query: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240
           TLVDLPGITKVPIGEQPPDIEKQIKNLILDY+ATPNCLILAVSPANVDLVNSESLKLARE
Sbjct: 172 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLARE 231

Query: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300
           VDP GKRTIGVITKLDLMDSGTNALDILSGK+YPLK GFVG+VNRSQQDIQLNK+V+E+L
Sbjct: 232 VDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESL 291

Query: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360
           + EE+YF++HP+YRTIS KCGTRYLAKLLN+ L++HI+DKLPDIKTKLNTL++QTEQEL 
Sbjct: 292 DKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELA 351

Query: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420
            YGG   +T E+RA+L+LQLMNKF+T+FISSI+G SSDINTKELCGGARIYYIYNNVFG 
Sbjct: 352 RYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGN 411

Query: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480
           SLKSIDPT+NL+ +D+RTAIRNSTGPRPTLFVPE AFDLLV+PQ+ LLLEPSQRCVELVY
Sbjct: 412 SLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVY 471

Query: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EELMKICH CGS EL RYP+LKSMLIEV+ +LL+ERL PTR YVESLIDIH+AYINTNHP
Sbjct: 472 EELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHP 531

Query: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENG--------SDRSS-----SSEETG 587
           +FL ATEA  DIMK+ ++R  +  K+   ++++ENG        S  SS     S++ + 
Sbjct: 532 NFLSATEAMDDIMKTRRKRNQELLKSK--LSQQENGQTNGINGTSSISSNIDQDSAKNSD 589

Query: 588 YIDGKNNISKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHIT 647
           Y D  + I  E+ ++K  F + FF  +K+     + + S     I  D N     NL I+
Sbjct: 590 YDD--DGIDAESKQTKDKFLNYFFGKDKKGQP--VFDASDKKRSIAGDGNIEDFRNLQIS 645

Query: 648 ENSQTTYD----LEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCK 703
           + S    D     EP L+ERE+LECELI+RLI+SYF IIREMIEDQ+PKA+M  LVNYCK
Sbjct: 646 DFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCK 705

Query: 704 ESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNIL 755
           +SVQNRLVTKLYKE++ EELLVEDQT+AQDR  C + L  YK A++LI+NIL
Sbjct: 706 DSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGVYKKAATLISNIL 757

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1059 bits (2738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/780 (70%), Positives = 631/780 (80%), Gaps = 29/780 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY SGIDTLDLPILAVVGSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNLPKDSSQANEN------IGSDANPDPFSSGSTKNNQLEDSLS---FVE 111
           VTRRPLVLQLNN+   S    EN      + + +      +G   NN+   SL+      
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120

Query: 112 DGINGQTNNNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLK 171
             I G +N  +  R EWGEFLHIPGRRFYDF+EIRREIE+ETAR+AGKNKGISK+PINLK
Sbjct: 121 SAIGG-SNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179

Query: 172 IFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVN 231
           I+SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNC+ILAVSPANVDLVN
Sbjct: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239

Query: 232 SESLKLAREVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQ 291
           SESLKLAREVDP G RTIGVITKLDLMDSGTNALDILSGKLYPLK GFVG+VNRSQQDIQ
Sbjct: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299

Query: 292 LNKSVQEALNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTL 351
           +NK+V+EALN EEEYF RHP+YRT+S++CGTRYLAKLLN+ L++HIK+KLPDIKT+LNTL
Sbjct: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359

Query: 352 VTQTEQELYSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIY 411
           ++QTEQEL  YG +   TKENRA L+LQLMNKFAT+FISSI+G SS+I+TKEL GGARIY
Sbjct: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419

Query: 412 YIYNNVFGKSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEP 471
           YIYNN+FG +LKSIDPTTNLT +DIRTAIRNSTGPRPTLFVPE AFDLLV+PQ+ LLLEP
Sbjct: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479

Query: 472 SQRCVELVYEELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIH 531
           SQ+CVELVYEEL+KICH CG+PEL RYP+LKS LIEVV DLL+ERL PTR YVESLIDIH
Sbjct: 480 SQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIH 539

Query: 532 KAYINTNHPSFLKATEAYSDIMKSNQERKDKENKNTEVITEK-------ENG-SDRSSSS 583
           +AYINTNHP+FL AT+A SDI++S   ++++EN+  + + EK       ENG + ++S S
Sbjct: 540 RAYINTNHPNFLTATDAMSDIIQS--RKRNQENQRAQKMLEKEKQNEIQENGTASQNSKS 597

Query: 584 EETGYIDGKN-NISKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVIN--EDLNGSL 640
           +    IDG   + SK+A +SK  F + FF  +K+ S  +L+N       +N  +D   S 
Sbjct: 598 DIEPSIDGTELDSSKDATKSKDTFLNYFFGKDKK-SQLSLSNRDGRFSELNGYKDDFSSQ 656

Query: 641 LGNLHITENSQTTYDL-----EPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIM 695
              L+   N  +  D       P L+ERE LECELIRRLI+SYF I+REMIEDQIPKAIM
Sbjct: 657 FQQLNFNSNLNSDDDAFENANHPKLTEREDLECELIRRLIVSYFDIVREMIEDQIPKAIM 716

Query: 696 FFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNIL 755
             LVN+CK+SVQNRLVT+LY+ESM EELLVEDQT+ QDR N  + LE YK AS+LI NIL
Sbjct: 717 CLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKSLEVYKKASALIGNIL 776

>Kwal_33.15200
          Length = 773

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/782 (66%), Positives = 615/782 (78%), Gaps = 36/782 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY +GIDTLDLP+LAV+GSQSSGKSSI+ETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120
           VTRRPLVLQLNN+  DS   N+       P    S       + + L+ +ED +      
Sbjct: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHES-------VPEELT-LEDHLRKNQGL 112

Query: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180
             + + EWGEFLH+PGRRFY+F +IR+EIENETAR+AGKNKGIS++PINLK+FSP VLNL
Sbjct: 113 EPQGKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNL 172

Query: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240
           TLVDLPGITKVPIGEQP DIEKQIKNLIL+YVA PNC+ILAVSPANVDLVNSESLKLAR+
Sbjct: 173 TLVDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD 232

Query: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300
           VDP GKRTIGVITK+DLMDSGTNALDILSGKLYPL+ GFVGIVNRSQQDIQ N++V+EAL
Sbjct: 233 VDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEAL 292

Query: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360
           NNEE +F RHP+YRTIS +CGTRYLAKLLN+ILMNHI+DKLPDIK +LNTL+ QTEQEL 
Sbjct: 293 NNEEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELT 352

Query: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420
           +YGG  + TKENRA L+LQLMNKFA  FISSIEG SSDI+TKELCGGARIYYIYN++FG 
Sbjct: 353 TYGGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGH 412

Query: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480
           SL+SI+PT NL+T DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLLEPSQRCVELVY
Sbjct: 413 SLESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVY 472

Query: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EELMKICH CGSPEL RYP+L++ LIEVV +LL+ERL PTR YVESLIDIH+AYINTNHP
Sbjct: 473 EELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHP 532

Query: 541 SFLKATEAYSDIM---KSNQERKDKENKNTEVI----------TEKENGSDRSSSSEETG 587
           +FL ATEA SDI    ++NQE   K+N + E +             EN    +S   ++G
Sbjct: 533 NFLSATEAMSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSG 592

Query: 588 YIDGKNNISKEADE------SKALFFDNFFATEKQDSSGNLANTSHDTLVIN-------- 633
                N+ S E DE      SK  F + FF  ++Q  +GN    S ++   N        
Sbjct: 593 NTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQ-IAGNYKGFSDNSQFSNFNRYEQTE 651

Query: 634 EDLNGSLLGNLHITENSQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKA 693
              + +   NL I++      +  P L+EREQLECELIRRLI+SYFGI+REMI+DQIPKA
Sbjct: 652 HQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKA 711

Query: 694 IMFFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINN 753
           +M  LVN+ KE +QNRLVTKLYKES+ E+LL+EDQ +AQDR  C +LL+TYK AS++I +
Sbjct: 712 VMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDTYKEASNIIGD 771

Query: 754 IL 755
           IL
Sbjct: 772 IL 773

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/786 (65%), Positives = 616/786 (78%), Gaps = 42/786 (5%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMY +GID+LDLP+LAV+GSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNL-PKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTN 119
           VTRRPLVLQLNN+ P      N +  S  + +  +       + E +L   ED +   +N
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTL---EDHLRKNSN 117

Query: 120 NNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLN 179
              + ++EWGEFLHIPGRRFYDF+EIRREIENETAR+AGK KGIS++PINLKI+SPHVLN
Sbjct: 118 YKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLN 177

Query: 180 LTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAR 239
           LTLVDLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNC+ILA+SPANVDLVNSESLKLAR
Sbjct: 178 LTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAR 237

Query: 240 EVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEA 299
           E+DP GKRTIGVITKLDLMD GTNALDILSGKLYPLK GFVG+VNRSQQDIQ NKSV+EA
Sbjct: 238 EIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEA 297

Query: 300 LNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQEL 359
           LN+EE++F +HP+YRTIS +CGTRYLAKLLN++LMNHI+DKLPDIK +LNTL+ QTEQEL
Sbjct: 298 LNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQEL 357

Query: 360 YSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFG 419
            +YG   + TKENRA L+LQLMNKFAT FISSI+G SS+I+TKELCGGARIYYIYN +FG
Sbjct: 358 ATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFG 417

Query: 420 KSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELV 479
           KSL  I+PT+NL+  DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLL+PSQRCVELV
Sbjct: 418 KSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELV 477

Query: 480 YEELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNH 539
           YEELMKICH CGSPEL RYP+L+S L+EVV +LL+ERL PTR YVESLIDIHKAYINTNH
Sbjct: 478 YEELMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNH 537

Query: 540 PSFLKATEAYSDIMKSNQERKDKENKNTEVITEKE------------NGSDRSSSSEETG 587
           P+F  ATEA ++I+++ + +K  E    +   EK+              SD    +E+  
Sbjct: 538 PNFPSATEAMAEIVEARKNKKQTERLQKQREYEKQLLLEQQQAEREMKKSDSVDETEQDL 597

Query: 588 YIDGKNNISKEAD--------ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGS 639
            +D  +  + E D        +SK  F + FF  E++ S+  L++          D NGS
Sbjct: 598 KLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRI--------DYNGS 649

Query: 640 ----LLGNLHITE------NSQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQ 689
                + NL I +      ++ T  +     +ERE+LECELIRRLI+SYF I+REMIEDQ
Sbjct: 650 DNSYDIENLQIQDFKDKSADAHTKSEAATEFTEREELECELIRRLIVSYFSIVREMIEDQ 709

Query: 690 IPKAIMFFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASS 749
           +PKA+M  LVNY KESVQNRLVTKLYKES+ +ELL+EDQT+AQDR  C  LLETY+ AS 
Sbjct: 710 VPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLETYQKASG 769

Query: 750 LINNIL 755
           +I +IL
Sbjct: 770 IIGDIL 775

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/780 (64%), Positives = 614/780 (78%), Gaps = 49/780 (6%)

Query: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY +GID+LDLP+LAV+GSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120
           VTRRPLVLQLNN+  DS         +A P                   +E+ + GQ+  
Sbjct: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEPT------------------LENRLRGQSG- 101

Query: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180
               R  WGEFLH+PGRRFYDF EIR EIENETAR+AGKNKGIS++PINLKI+SPHVLNL
Sbjct: 102 ---ARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNL 158

Query: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240
           TL+DLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNC+ILAVSPANVDLVNSESLKLAR+
Sbjct: 159 TLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD 218

Query: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300
           VDP GKRTIGV+TKLDLMDSGTNA DIL+GKLYPL+ GFVG+VNRSQQDIQ NKSV++AL
Sbjct: 219 VDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDAL 278

Query: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360
             EEE+F +HP YRTIS+KCGTR+LAK LN+IL+NHI++KLPDIK +LNTL+ QTEQEL 
Sbjct: 279 AREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELA 338

Query: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420
           SYGGS + + E+RA L+LQ+MNKFAT+F+SSIEG SSDI+TKELCGGARIYYIYNN+FG 
Sbjct: 339 SYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGN 398

Query: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480
           SLKSI+PT NL+  DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLL+PSQRCVELVY
Sbjct: 399 SLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVY 458

Query: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EELMKICH CGSP L RYPRL++ LIEVV DLL+ERL PTR YVESLIDIH+A+INTNHP
Sbjct: 459 EELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHP 518

Query: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEE--------------- 585
           +FL ATEA +DI ++ ++++    ++ ++  +++   +++++  E               
Sbjct: 519 NFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVDSDST 578

Query: 586 --TGYIDGKNNISKEADESKALFFDNFFATEKQDSSGN-----LANTSHDTL--VINEDL 636
             +   +G++   ++  ++K  F + FF  ++Q   G+      ++    T+     ++ 
Sbjct: 579 ITSSDSEGED--ERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEA 636

Query: 637 NGSLLGNLHITENSQTTYDLE-PHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIM 695
           +   +  L I +      + E P L+ERE+LECELIRRLIISYFGI+REM+EDQIPKA+M
Sbjct: 637 DFMAMETLKIQDTVAAPVEAEHPELTEREELECELIRRLIISYFGIVREMVEDQIPKAVM 696

Query: 696 FFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNIL 755
            FLVN+CKE VQNRLV+KLYKES+ EELL+ED+T+AQDRA C +LLE YK AS +I +IL
Sbjct: 697 CFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLEGYKQASVIIGDIL 756

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/761 (40%), Positives = 463/761 (60%), Gaps = 70/761 (9%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQL-NNLPKDSSQA------NENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGI 114
           TRRPLVLQL N  PK S  A      NE I  + N D      +  +Q E          
Sbjct: 63  TRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNE---------- 112

Query: 115 NGQTNNNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFS 174
            GQ+ +N   + EWGEFLH+PG++FY+F+EIR+EI  ET ++ G N GIS +PINL+I+S
Sbjct: 113 -GQSEDN---KEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYS 168

Query: 175 PHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSES 234
           PHVL LTLVDLPG+TKVP+G+QPPDIE+QIK+++L Y++ PN +IL+V+ AN DL NS+ 
Sbjct: 169 PHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDG 228

Query: 235 LKLAREVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNK 294
           LKLAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL++G++ ++NR Q+DI+  K
Sbjct: 229 LKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKK 288

Query: 295 SVQEALNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQ 354
           +++EAL NE ++F+ HP Y + ++ CGT YLAK LN IL++HI+  LP+IK K+   + +
Sbjct: 289 TIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKK 348

Query: 355 TEQELYSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIY 414
            + EL + G     T ++ ++++L ++  F+  +   ++G + +++++EL GGARI Y++
Sbjct: 349 YQNELINLGP---ETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVF 405

Query: 415 NNVFGKSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQR 474
           +  F   + S+DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q+    EPS R
Sbjct: 406 HETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLR 465

Query: 475 CVELVYEELMKICHGCGS-PELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKA 533
            V LV++EL+++     S P+  RYP L+  +    +  LK+   PT ++V  +I   + 
Sbjct: 466 LVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQT 525

Query: 534 YINTNHPSFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKN 593
           YINT HP  LK ++A   + +    R+   +  T      +  S ++   EE        
Sbjct: 526 YINTAHPDLLKGSQAMVMVEEKLHPRQVAVDPKTGKPLPTQPSSSKAPVMEE-------- 577

Query: 594 NISKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTT 653
                    K+ FF  FF+T+ +     L                         E+    
Sbjct: 578 ---------KSGFFGGFFSTKNKKKLAAL-------------------------ESPPPV 603

Query: 654 YDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTK 713
                 ++ERE +E E+I+ LI SYF I++  I D IPKA+M  L+   K  +Q  L+ K
Sbjct: 604 LKATGQMTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVLLEK 663

Query: 714 LYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
           LY +  +EEL  E+    Q R  C++++E  +NAS +++++
Sbjct: 664 LYGKQDIEELTKENDITIQRRKECKKMVEILRNASQIVSSV 704

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/754 (40%), Positives = 456/754 (60%), Gaps = 60/754 (7%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNN 121
           TRRPLVLQL N     S       SD   D      +K    ED       G  GQ+ +N
Sbjct: 63  TRRPLVLQLINRRSKKSDKEVQKASDQLLDLNMDDHSKK---EDPA-----GKKGQSEDN 114

Query: 122 QKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLT 181
            +   EWGEFLH+P ++FY+F+EIR EI  ET +L G N GIS +PINL+I+SPHVL LT
Sbjct: 115 AE---EWGEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLRIYSPHVLTLT 171

Query: 182 LVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREV 241
           LVDLPG+TKVP+G+QPPDIEKQIK+++L Y++ PN +IL+V+ AN DL NS+ LKLAREV
Sbjct: 172 LVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREV 231

Query: 242 DPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEALN 301
           DP G RTIGV+TK+DLMD GT+ +DIL+G++ PL++G++ ++NR Q+DI+  K+++ AL 
Sbjct: 232 DPEGTRTIGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIRAALQ 291

Query: 302 NEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELYS 361
           +E+++F+ HP Y + ++ CGT YLAK LN IL++HI+  LPDIK K+ + + +   EL S
Sbjct: 292 DEKKFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIESTLKKYVNELES 351

Query: 362 YGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGKS 421
            G     T ++ ++++L ++  F+  +   ++G + ++ ++EL GGARI ++++ +F   
Sbjct: 352 LGP---ETMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARISFVFHEIFKNG 408

Query: 422 LKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVYE 481
           + S+DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q+    EPS R V LV++
Sbjct: 409 VDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFD 468

Query: 482 ELMKICHGCGS-PELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EL+++     S P+  RYP L+  +    +D LKE + PT ++V+ +I   + YINT HP
Sbjct: 469 ELVRMLKQIISQPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKSEQTYINTAHP 528

Query: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNISKEAD 600
             LK ++A S + +    R    +  T      +  +    + EE               
Sbjct: 529 DLLKGSQAMSMVEEKLHPRPTAVDPKTGKPLPNQPPAKPMPAVEE--------------- 573

Query: 601 ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYDLEPHL 660
             K+ FF  FF+T+ +     L                         E+          +
Sbjct: 574 --KSGFFGGFFSTKNKKKLAAL-------------------------ESPPPVLKATGQM 606

Query: 661 SEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKESML 720
           +ERE +E E+I+ LI SYF I++  I D +PKA+M  L+   K  +Q  L+ KLY    +
Sbjct: 607 TERETMETEVIKLLINSYFNIVKRTIADLVPKALMLKLIVKSKNDMQKVLLQKLYGNQDI 666

Query: 721 EELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
           +EL  E+    Q R  C+R++E  KNAS ++ ++
Sbjct: 667 DELTKENDITIQRRKECQRMIEILKNASQIVTSV 700

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/755 (40%), Positives = 453/755 (60%), Gaps = 77/755 (10%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQL-NNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120
           TRRPLVLQL N   K   + N +                 + LE  L    D   GQ+ +
Sbjct: 63  TRRPLVLQLINRRGKKGDKRNAH----------------GDLLE--LDVAADQKTGQSED 104

Query: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180
           N +   EWGEFLH PG++FY+F++IR+EI NET +L GKN GIS +PINL+I+SPHVL L
Sbjct: 105 NAE---EWGEFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTL 161

Query: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240
           TLVDLPG+TKVP+G+QP DIE QIKN+I+ Y++ PN +ILAV+ AN DL NS+ LKLARE
Sbjct: 162 TLVDLPGLTKVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLARE 221

Query: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300
           VDP G RTIGV+TK+DLMD GT+ +DILSG++ PL++G+V ++NR Q+DI+  K+++EAL
Sbjct: 222 VDPEGTRTIGVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREAL 281

Query: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360
           N+E+ +F+ HP Y + +N CGT YLAK LN IL++HI+  LP+IK K+   + + + EL 
Sbjct: 282 NDEKRFFENHPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAELL 341

Query: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420
           + G   L +     +++L ++  F+  +   ++G + +++++EL GGARI ++++ +F  
Sbjct: 342 ALGPETLDSPN---SIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKG 398

Query: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480
            + ++DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q+    +PS R V L++
Sbjct: 399 GVYALDPFDQIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIF 458

Query: 481 EELMKICHGCGS-PELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNH 539
           +EL++I     S P+  RYP L+  +    +  LKER+ P   +V  +I   + YINT H
Sbjct: 459 DELVRILREIISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTAH 518

Query: 540 PSFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNISKEA 599
           P  LK ++A + +++     K  + K  + +      +D+ SS                 
Sbjct: 519 PDLLKGSQAMA-MVEERLHPKQVDPKTGKSLPPTVQHTDKGSSG---------------- 561

Query: 600 DESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYDLEPH 659
                  F  FFA++ +                           L   E   +       
Sbjct: 562 ------IFGGFFASKNKK-------------------------KLTALEAPPSVLKATGQ 590

Query: 660 LSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKESM 719
           ++ERE LE E+I+ LI SYF I++  + D IPKA+M  L+   K  +Q  L+ KLY    
Sbjct: 591 MTERETLETEVIKLLIESYFSIVKRTVADLIPKAVMLKLIVKSKNDIQKILLEKLYGNQD 650

Query: 720 LEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
           +EEL  E+    Q R  C  +++  K+AS +++++
Sbjct: 651 IEELTKENDITIQRRKECHNMVQILKHASEIVSSV 685

>Scas_668.28
          Length = 722

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/759 (39%), Positives = 462/759 (60%), Gaps = 48/759 (6%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNL-----PKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGING 116
           TRRPLVLQL N       + + QAN                  + +   +    + G  G
Sbjct: 63  TRRPLVLQLINRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDADKKEAPASDKTKKGEKG 122

Query: 117 QTNNNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPH 176
            T+ ++ +  EWGEFLH+PG++F++F+EIR+EI  ET ++ G N GIS +PINL+I+SP+
Sbjct: 123 ATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIYSPY 182

Query: 177 VLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLK 236
           VL LTLVDLPG+TKVP+G+QPPDIEKQIKN++L Y++ PN +IL+V+ AN DL NS+ LK
Sbjct: 183 VLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSDGLK 242

Query: 237 LAREVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSV 296
           LAREVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL++G++ ++NR Q+DI+  K++
Sbjct: 243 LAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGKKTI 302

Query: 297 QEALNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTE 356
           + AL +E+ +F+ HP Y + ++ CGT YLAK LN IL++HI+  LPDIK K+   + + +
Sbjct: 303 RSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLKKYQ 362

Query: 357 QELYSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNN 416
            EL S G     T ++  +++L ++  F+  +   ++G + ++ ++EL GGARI ++++ 
Sbjct: 363 NELISLGP---ETMDSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFVFHE 419

Query: 417 VFGKSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCV 476
           VF   + S+DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q+    EPS R V
Sbjct: 420 VFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSLRLV 479

Query: 477 ELVYEELMKICHG-CGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYI 535
            LV++EL++I       P+  RYP L+  +    +D LKE + PT ++V  +ID  + YI
Sbjct: 480 NLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQTYI 539

Query: 536 NTNHPSFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNI 595
           NT HP  LK + A + +       +++ +   ++  + + G  +    ++    +  N++
Sbjct: 540 NTAHPDLLKGSRAMAMV-------EERLHPPRQIALDPKTG--KPLPQQQQQQQNPSNDV 590

Query: 596 SKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHITENSQTTYD 655
                E K  FF  FF T+ +                           L   E+      
Sbjct: 591 L--VSEDKNGFFGGFFTTKNKK-------------------------KLAALESPPPVLK 623

Query: 656 LEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLY 715
               ++ERE  E E+I+ LI SYFGI++  + D IPKA+M  L+   +  +Q  L+ KLY
Sbjct: 624 ATGQMTERETTETEVIKLLIESYFGIVKRTVADIIPKALMLKLIVKSRTDIQKVLLEKLY 683

Query: 716 KESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
               L++L  E++   Q R  C R+++  +NAS +++++
Sbjct: 684 SSGQLKDLTKENELTIQRRKECNRMVDILRNASEIVSSV 722

>Kwal_26.7924
          Length = 691

 Score =  517 bits (1332), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 261/552 (47%), Positives = 380/552 (68%), Gaps = 27/552 (4%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVG+QSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNN 121
           TRRPLVLQL N  K SS+ N            +S S+KN+ LE      ++   GQ+ +N
Sbjct: 63  TRRPLVLQLVN--KRSSKGN------------TSQSSKNDLLELG---NQEQKGGQSEDN 105

Query: 122 QKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLT 181
                EWGEFLH+PG++F++F+EIR+EI NET +  GKN GIS +PINLKI SPHVL LT
Sbjct: 106 V---DEWGEFLHLPGKKFFNFDEIRQEIVNETEKTTGKNAGISPVPINLKICSPHVLTLT 162

Query: 182 LVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREV 241
           LVDLPG+TKVP+G+QP DIEKQIK+++L Y++ PN +IL+V+ AN DL NS+ LKLAREV
Sbjct: 163 LVDLPGLTKVPVGDQPADIEKQIKDMLLRYISKPNAIILSVNAANTDLANSDGLKLAREV 222

Query: 242 DPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEALN 301
           DP G RTIGV+TK+DLMD GT+ +DIL+G++ PL++G++ ++NR Q+DI++ K+++ AL 
Sbjct: 223 DPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRAALE 282

Query: 302 NEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELYS 361
           +E  YF+ HP Y + ++ CGT YLAK LN IL++HI+  LPDIK K+   + + + EL S
Sbjct: 283 DERRYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAELMS 342

Query: 362 YGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGKS 421
            G     T ++  ++IL ++  F+  +   ++G + +++++EL GGARI ++++ ++   
Sbjct: 343 LGP---ETMDSPNSIILSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNG 399

Query: 422 LKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVYE 481
           ++++DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q++   EPS R V LV++
Sbjct: 400 VRALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQINRFEEPSLRLVSLVFD 459

Query: 482 ELMKICHGCGS-PELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540
           EL++I     S P+  RYP L+  +    +  LKE + PT  +V  +I   + YINT HP
Sbjct: 460 ELVRILKQIISQPKYGRYPGLREAMSNYFIQFLKEAIIPTNSFVTDIIQAEQTYINTAHP 519

Query: 541 SFLKATEAYSDI 552
             LK ++A + I
Sbjct: 520 DLLKGSQAMAMI 531

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%)

Query: 659 HLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKES 718
            ++ERE +E E+I+ LI SYF I++  + D IPKA+M  L+   K  +Q  L+ KLY   
Sbjct: 596 QMTERETMETEVIKLLIESYFNIVKRTVADVIPKAVMLKLIVKSKNDIQKILLEKLYGNQ 655

Query: 719 MLEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
            + EL  E+    Q R  C ++ E  +NAS +++++
Sbjct: 656 DIAELTKENDITIQRRKECHKMTEILRNASEIVSSV 691

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  513 bits (1321), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/562 (46%), Positives = 382/562 (67%), Gaps = 30/562 (5%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN--LPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTN 119
           TRRPLVLQL N    KDS+                  S KN  L+  L+  +D   GQ+ 
Sbjct: 63  TRRPLVLQLINKRTKKDSTLQ----------------SAKNELLD--LNVADDQKKGQSE 104

Query: 120 NNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLN 179
           +N +   EWGEFLHIPG++FY+F++IR+EI  ET +  GKN GIS +PINL+I+SPHVL 
Sbjct: 105 DNAE---EWGEFLHIPGKKFYNFDQIRQEIVIETEKTTGKNAGISPIPINLRIYSPHVLT 161

Query: 180 LTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAR 239
           LTLVDLPG+TKVP+G+QP DIEKQIK+++L Y++ PN +IL+V+ AN DL NS+ LKLAR
Sbjct: 162 LTLVDLPGLTKVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAR 221

Query: 240 EVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEA 299
           EVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PL++G++ ++NR Q+DI+ +K+++ A
Sbjct: 222 EVDPEGTRTIGVLTKVDLMDHGTDVIDILAGRVIPLRYGYIPVINRGQKDIEAHKTIRAA 281

Query: 300 LNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQEL 359
           L +E+++F+ HP Y + ++ CGT YLAK LN IL++HI+  LP+IK K+   + + + EL
Sbjct: 282 LEDEKKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLKKYQAEL 341

Query: 360 YSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFG 419
            S G     T ++  +++L ++  F+  +   ++G + +++++EL GGARI ++++ +F 
Sbjct: 342 LSLGP---ETMDSPNSIVLSMITDFSKEYTGILDGEARELSSQELSGGARISFVFHEIFK 398

Query: 420 KSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELV 479
             + ++DP   +   DIRT + NS+G  P+LFV   AF++LV+ Q+    EPS R V LV
Sbjct: 399 NGVNALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSLRLVSLV 458

Query: 480 YEELMKICHGCGS-PELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTN 538
           ++EL++I     S P+  RYP L+  L    V  LKE + PT ++V  +I   + YINT 
Sbjct: 459 FDELVRILKQIISHPKYSRYPGLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQTYINTA 518

Query: 539 HPSFLKATEAYSDIMKSNQERK 560
           HP  LK ++A + + +    R+
Sbjct: 519 HPDLLKGSQAMATVEEKLHPRQ 540

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%)

Query: 659 HLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKESVQNRLVTKLYKES 718
            ++ERE +E E+I+ LI SYFGI++  + D IPKAIM  L+   K  +Q  L+ KLY   
Sbjct: 595 QMTERETMETEVIKLLIDSYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYGNQ 654

Query: 719 MLEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
            + EL  E+    Q R  C +++E  +NAS +++++
Sbjct: 655 DIAELTKENDITIQRRKECHKMVEILRNASDIVSSV 690

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  486 bits (1251), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 249/552 (45%), Positives = 361/552 (65%), Gaps = 33/552 (5%)

Query: 5   EDLIPTVNKLQDVMYASGIDT---LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS++E +VGRDFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN--LPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTN 119
           TRRPL+LQL N  + K++  A E +                      L       NG   
Sbjct: 63  TRRPLILQLINRRVKKETKHATEEL----------------------LDLDNSAANG--G 98

Query: 120 NNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLN 179
            N+ +  EWGEF H+PG++ ++FNEIR+EI  ET +  GKN GIS +PI L+++SPHVL 
Sbjct: 99  QNEDNAEEWGEFGHLPGKKLFNFNEIRKEIVLETDKSTGKNAGISAVPITLRVYSPHVLT 158

Query: 180 LTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAR 239
           LTLVDLPG+TKVP+G+QP DIE+QIK++IL Y+  PN +ILAV+PAN DL NS+ LKLAR
Sbjct: 159 LTLVDLPGLTKVPVGDQPADIERQIKDMILTYIKKPNAIILAVNPANADLANSDGLKLAR 218

Query: 240 EVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEA 299
           EVDP G RTIGV+TK+DLMD GT+ +DIL+G++ PLKFG++ ++NR Q+DI+ NK+++ A
Sbjct: 219 EVDPDGSRTIGVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQKDIEKNKTIRSA 278

Query: 300 LNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQEL 359
           L +E+ +F+ HP Y   +  CGT YL K LN IL++HI+  LPDIK K+   + + + EL
Sbjct: 279 LEDEKRFFENHPSYSARALYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKYQTEL 338

Query: 360 YSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFG 419
            S       +  + ++++L ++  F+  +   ++G + ++ +KEL GGAR+ ++++ +F 
Sbjct: 339 LS---LGPESLSSSSSIVLSMITDFSKEYTGILDGEARELTSKELSGGARVSFVFHEIFK 395

Query: 420 KSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELV 479
             + ++DP   +   DIRT + N +G  P+LFV   AF++LV+ Q+S   +PS R V LV
Sbjct: 396 NGVYALDPFDQIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLRLVNLV 455

Query: 480 YEELMKICHG-CGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTN 538
           ++EL++I       P+  RYP L+  +    V  LKE + PT  +V  +I   + YINT 
Sbjct: 456 FDELVRILKQIINQPKYSRYPSLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQTYINTA 515

Query: 539 HPSFLKATEAYS 550
           HP  LK ++A +
Sbjct: 516 HPDLLKGSQAMA 527

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 62/109 (56%)

Query: 646 ITENSQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCKES 705
           + EN     +    ++ERE+LE E+I+ LI SYF I++  + D IPKA+M  L+   K  
Sbjct: 576 VLENPPNVLEATGQMTEREKLETEVIKLLIDSYFSIVKRSVADFIPKAVMLKLIVKSKND 635

Query: 706 VQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLETYKNASSLINNI 754
           +Q  L+ KLY    L+EL  E     Q R  C++++    +AS +++++
Sbjct: 636 IQKILLEKLYSSENLDELTKESDLTTQRRKECQKMVNILTHASEIVSSV 684

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  167 bits (424), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 145/261 (55%), Gaps = 57/261 (21%)

Query: 28  LPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIGSD 87
           LP + VVGSQSSGKSS++E++VGRDFLP+G+ +VTRRP+ L L N P          GS+
Sbjct: 208 LPSIVVVGSQSSGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNTPS---------GSE 258

Query: 88  ANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DFNE 144
              D                                           P  R Y   DF E
Sbjct: 259 TTAD------------------------------------------FPTHRIYNLKDFRE 276

Query: 145 IRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQI 204
           ++R I  E       ++ IS+ PI L I SP V +L+LVDLPG  +V   +QP +++ +I
Sbjct: 277 VKR-ILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPMELKSKI 335

Query: 205 KNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGTNA 264
           +N+   Y+A PN +ILA+S A+VDL NS +L+ ++  DP G RTIGVITKLDL++  + A
Sbjct: 336 RNVCQKYLAEPN-IILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLVEP-SAA 393

Query: 265 LDILSGKLYPLKFGFVGIVNR 285
            D+L  K YPLK G+VG++ +
Sbjct: 394 RDLLMNKKYPLKMGYVGVITK 414

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  163 bits (412), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/263 (38%), Positives = 149/263 (56%), Gaps = 57/263 (21%)

Query: 26  LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIG 85
           L LP + V+GSQSSGKSS++E++VG++FLP+G+ +VTRRP+ L L N P     +NE I 
Sbjct: 221 LTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTP----NSNE-IT 275

Query: 86  SDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DF 142
           +D                                               P  R Y   DF
Sbjct: 276 AD----------------------------------------------FPALRVYNLQDF 289

Query: 143 NEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 202
            E++R I  E       ++ +S+ PI L I +  V +L+LVDLPG  +V   +QP +++ 
Sbjct: 290 KEVKR-ILMELNMAVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGYIQVEAADQPLELKS 348

Query: 203 QIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGT 262
           +I+ L   Y+A PN +ILA+S A+VDL NS +L+ ++ VDPLG+RTIGVITKLDL++   
Sbjct: 349 KIRLLCEKYLAEPN-IILAISAADVDLANSAALRASKVVDPLGERTIGVITKLDLVEPA- 406

Query: 263 NALDILSGKLYPLKFGFVGIVNR 285
            A +IL+ K YPLK G+VG++ +
Sbjct: 407 KAREILNNKKYPLKMGYVGVITK 429

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  161 bits (408), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 145/268 (54%), Gaps = 57/268 (21%)

Query: 26  LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIG 85
           L LP + V+GSQSSGKSS++E++VGR+FLP+G+ +VTRRP+ L L N P      + N+ 
Sbjct: 229 LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPN-----SNNVT 283

Query: 86  SDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DF 142
           +D                                               P  R Y   DF
Sbjct: 284 AD----------------------------------------------FPSMRLYNIKDF 297

Query: 143 NEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 202
            E++R +  E       ++ +S+ PI L I S  V +L+LVDLPG  +V   +QP +++ 
Sbjct: 298 KEVKRMLM-ELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKT 356

Query: 203 QIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGT 262
           +I++L   Y+  PN +ILA+S A+VDL NS +LK ++  DP G RTIGVITKLDL+D   
Sbjct: 357 KIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-E 414

Query: 263 NALDILSGKLYPLKFGFVGIVNRSQQDI 290
            A  IL+ K YPL  G+VG++ ++   I
Sbjct: 415 KARSILNNKKYPLSMGYVGVITKTPSSI 442

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  160 bits (406), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 144/264 (54%), Gaps = 57/264 (21%)

Query: 26  LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIG 85
           L LP + V+GSQSSGKSS++E++VG+DFLP+GT +VTRRP+ L L N P      ++ + 
Sbjct: 219 LALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVNTP-----TSQEVT 273

Query: 86  SDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DF 142
           +D                                               P  R Y   DF
Sbjct: 274 AD----------------------------------------------FPTMRIYNLKDF 287

Query: 143 NEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 202
            E++R I  E        + +S  PI L I S  V +L+LVDLPG  +V   +QP +++ 
Sbjct: 288 KEVKR-ILTEMNMAVPSTEAVSDDPIQLTIKSSRVPDLSLVDLPGYIQVEAVDQPIELKS 346

Query: 203 QIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGT 262
           +I+ L   Y+  PN +ILA+S A+VDL NS +L+ ++  DP G RTIGV+TKLDL+D+ T
Sbjct: 347 KIRQLCDKYLEEPN-IILAISAADVDLANSAALRASKVADPQGLRTIGVVTKLDLVDAKT 405

Query: 263 NALDILSGKLYPLKFGFVGIVNRS 286
            A  IL+ + YPLK G+VG++ +S
Sbjct: 406 -ARAILNNRKYPLKMGYVGVITKS 428

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 144/264 (54%), Gaps = 57/264 (21%)

Query: 26  LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIG 85
           L LP + V+GSQSSGKSS++E++VGR+FLP+G+ +VTRRP+ L L N P           
Sbjct: 219 LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTP----------- 267

Query: 86  SDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DF 142
                          N  E +  F                         P  R Y   DF
Sbjct: 268 ---------------NVQETTADF-------------------------PSLRVYNMKDF 287

Query: 143 NEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 202
            E++R +  E       ++ +S+ PI L I S HV +L+LVDLPG  +V   +QP +++ 
Sbjct: 288 REVKRML-TELNLAVPASEAVSEEPIQLTIKSAHVPDLSLVDLPGYIQVEAADQPMELKS 346

Query: 203 QIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGT 262
           +I+ L   Y+A PN +ILA+S A+VDL NS +L+ ++  DP G RTIGVITKLDL+ S  
Sbjct: 347 KIRMLCDKYLAEPN-IILAISAADVDLANSSALRASKVADPQGLRTIGVITKLDLV-SAE 404

Query: 263 NALDILSGKLYPLKFGFVGIVNRS 286
            A  IL+ + YPL  G+VG++ +S
Sbjct: 405 EARKILTNRKYPLTMGYVGVITKS 428

>Kwal_26.8613
          Length = 861

 Score =  160 bits (404), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/327 (33%), Positives = 170/327 (51%), Gaps = 71/327 (21%)

Query: 25  TLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENI 84
           +L LP + V+GSQSSGKSS++E++VG++FLP+G+ +VTRRP+ L L N            
Sbjct: 206 SLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN------------ 253

Query: 85  GSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFYDFNE 144
                    +SGS +                              +F  +      DFNE
Sbjct: 254 ---------TSGSNETT---------------------------ADFPSLRAYNIKDFNE 277

Query: 145 IRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQI 204
           ++R I  E       ++ +S  PI L I S  V +L+LVDLPG  +V   +QP +++ +I
Sbjct: 278 VKR-ILMELNMAVPSSEAVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELKSKI 336

Query: 205 KNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGTNA 264
           + +   Y+A PN +ILA+S A+VDL NS +L+ ++  DP G RTIGVITKLDL++    A
Sbjct: 337 RQVCETYLAEPN-IILAISAADVDLANSSALRASKVADPKGLRTIGVITKLDLVEPA-RA 394

Query: 265 LDILSGKLYPLKFGFVGIVNRS-----------------QQDIQLNKSVQEALNNEEEYF 307
            +IL+ K YPLK G+VG++ ++                 ++ +     +++    E +YF
Sbjct: 395 KEILNSKKYPLKMGYVGVITKNPNSSSRLFDTGTKSGLFKRKVSQESEMEQTRKFERDYF 454

Query: 308 KRHPIYRTISN-KCGTRYLAKLLNKIL 333
           K +    T SN +  T+ L + L KIL
Sbjct: 455 KNNKA--TFSNCQVSTKRLREKLIKIL 479

>Scas_605.17
          Length = 891

 Score =  159 bits (401), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 144/264 (54%), Gaps = 57/264 (21%)

Query: 26  LDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGIVTRRPLVLQLNNLPKDSSQANENIG 85
           L LP + V+GSQSSGKSS++E++VG++FLP+G+ +VTRRP+ L L N P           
Sbjct: 220 LTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTP----------- 268

Query: 86  SDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNNNQKHRSEWGEFLHIPGRRFY---DF 142
                                      G+N  T +              P  R Y   DF
Sbjct: 269 ---------------------------GVNETTAD-------------FPSLRTYNLKDF 288

Query: 143 NEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 202
            E++R I  E        + +S+ PI L I S  + +L+LVDLPG  +V   +QP +++ 
Sbjct: 289 KEVKR-ILMELNMAVPTTEAVSEEPIQLTIKSSSIPDLSLVDLPGYIQVEAADQPTELKT 347

Query: 203 QIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAREVDPLGKRTIGVITKLDLMDSGT 262
           +I+ L   Y+  PN +ILA+S A+VDL NS +L+ A+  DP G RTIGVITKLDL+ S  
Sbjct: 348 KIRQLCDKYLNEPN-IILAISAADVDLANSSALRAAKMADPQGLRTIGVITKLDLI-SPE 405

Query: 263 NALDILSGKLYPLKFGFVGIVNRS 286
            A +IL+ + YPLK G+VG++ +S
Sbjct: 406 AARNILNNRKYPLKMGYVGVITKS 429

>YDL205C (HEM3) [669] chr4 complement(92763..93746) Porphobilinogen
           deaminase (pre-uroporphyrinogen synthase), catalyzes the
           third step in porphyrin biosynthesis pathway [984 bp,
           327 aa]
          Length = 327

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 325 LAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQ----ELYSYGGSALSTKE 371
           LA + +  ++  I++K PD   K+ TL T  +Q     LYS+GG AL TKE
Sbjct: 15  LAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKALWTKE 65

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 26 LDLPILAVVGSQSSGKSSIIETLVGRDF 53
          LD  +++V GSQSSGKS+++  L   +F
Sbjct: 35 LDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>CAGL0J09680g complement(949959..950948) highly similar to sp|P28789
           Saccharomyces cerevisiae YDL205c HEM3 porphobilinogen
           deaminase, start by similarity
          Length = 329

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 8/45 (17%)

Query: 335 NHIKD----KLPDIKTKLNTLVTQTEQ----ELYSYGGSALSTKE 371
           NH++D    K P     + TL T  +Q     LYS+GG AL TKE
Sbjct: 21  NHVRDLVQAKFPQYDCTVFTLQTLGDQIQFKPLYSFGGKALWTKE 65

>Kwal_47.17014
          Length = 1551

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 9/99 (9%)

Query: 400 NTKE-LCGGARIYYIYNNVFGKSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFD 458
           N KE L G +R+  I     G+SL  +D  T +  +    A+R++   R    +P   F+
Sbjct: 865 NRKEHLRGHSRVKAIREYAQGESLGEVDVLTAINRLSTVVALRDTELAR----IPRSLFE 920

Query: 459 LLVRPQVSLLLEPSQRCVELVYEELMKICHGCGSPELVR 497
           LL     S+++    R   LV  ++++   G  SP+ ++
Sbjct: 921 LLALEHPSIMI----RVSRLVARKIIQQQRGSESPQTIK 955

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 26 LDLPILAVVGSQSSGKSSIIETLVGRDF 53
          LD  +++V GSQSSGKS+++  L    F
Sbjct: 41 LDYHVISVFGSQSSGKSTLLNALFNTKF 68

>Kwal_27.10298
          Length = 882

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 248 TIGVITKLDLMDSGTNALDILSGKLYPLKF-------GFVGIVNRSQQDIQLNKSVQEAL 300
           T  + TK+   DS T  L+I+  + Y L+F        F G +N  +Q   L + VQE +
Sbjct: 397 TYTIDTKVVGKDSRTKKLNIMKEREYNLRFIPFGFCRPFAGELNPLKQLQDLTRLVQERI 456

Query: 301 NNEEEYFKRHPIYRTISNK 319
           +  ++ FKR      ISN+
Sbjct: 457 DALKKVFKRLECNERISNE 475

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,365,358
Number of extensions: 1209612
Number of successful extensions: 5047
Number of sequences better than 10.0: 109
Number of HSP's gapped: 5122
Number of HSP's successfully gapped: 125
Length of query: 755
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 646
Effective length of database: 12,822,747
Effective search space: 8283494562
Effective search space used: 8283494562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)