Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_687.2057157126620.0
YFR039C5104074083e-43
Scas_712.226242563542e-35
Kwal_47.191847122443314e-32
AFR244C5722443195e-31
Sklu_2433.186272443152e-30
YGL228W (SHE10)5772933091e-29
CAGL0C02167g4804733061e-29
KLLA0A01177g6362452941e-27
CAGL0I04092g5562642361e-20
YKL151C33783674.3
YPL150W90143666.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_687.20
         (571 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_687.20                                                          1030   0.0  
YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...   161   3e-43
Scas_712.22                                                           140   2e-35
Kwal_47.19184                                                         132   4e-32
AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...   127   5e-31
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                        125   2e-30
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...   123   1e-29
CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...   122   1e-29
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...   117   1e-27
CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...    96   1e-20
YKL151C (YKL151C) [3117] chr11 complement(164922..165935) Member...    30   4.3  
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    30   6.0  

>Scas_687.20
          Length = 571

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/571 (89%), Positives = 511/571 (89%)

Query: 1   MQISRKXXXXXXXXXXXXSHYYISANNDSTNAVSGSLLVPYMKMYKGIVVSSLHNLKIDY 60
           MQISRK            SHYYISANNDSTNAVSGSLLVPYMKMYKGIVVSSLHNLKIDY
Sbjct: 1   MQISRKILGAIIGLVIVVSHYYISANNDSTNAVSGSLLVPYMKMYKGIVVSSLHNLKIDY 60

Query: 61  VTTIEPYLAELVSWTGQFCSNVKIHPVSHSVWLRILSAYEYFINEILSPFYENTLLFIRR 120
           VTTIEPYLAELVSWTGQFCSNVKIHPVSHSVWLRILSAYEYFINEILSPFYENTLLFIRR
Sbjct: 61  VTTIEPYLAELVSWTGQFCSNVKIHPVSHSVWLRILSAYEYFINEILSPFYENTLLFIRR 120

Query: 121 NKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKSKYGFFSFDFASGMLN 180
           NKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKSKYGFFSFDFASGMLN
Sbjct: 121 NKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKSKYGFFSFDFASGMLN 180

Query: 181 GTLSESLHQDTLSSARXXXXXXXXXXXXXXXXXXXXNEEVINQKLEDSIELNNLPINADI 240
           GTLSESLHQDTLSSAR                    NEEVINQKLEDSIELNNLPINADI
Sbjct: 181 GTLSESLHQDTLSSARETDNETEIETDTEPESDDIINEEVINQKLEDSIELNNLPINADI 240

Query: 241 NGYHLENQADGILDRKVALNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEM 300
           NGYHLENQADGILDRKVALNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEM
Sbjct: 241 NGYHLENQADGILDRKVALNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEM 300

Query: 301 EIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDS 360
           EIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDS
Sbjct: 301 EIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDS 360

Query: 361 IFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQ 420
           IFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQ
Sbjct: 361 IFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQ 420

Query: 421 FDVVSGQLLDDDPLFEQSAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKL 480
           FDVVSGQLLDDDPLFEQSAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKL
Sbjct: 421 FDVVSGQLLDDDPLFEQSAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKL 480

Query: 481 EEIIDEANNQFEALGKKADVAFXXXXXXXXXXXITSLPLKKANKSVGTKLNFEKSQSLDV 540
           EEIIDEANNQFEALGKKADVAF           ITSLPLKKANKSVGTKLNFEKSQSLDV
Sbjct: 481 EEIIDEANNQFEALGKKADVAFSERESRERESSITSLPLKKANKSVGTKLNFEKSQSLDV 540

Query: 541 ESLIDSIPVHXXXXXXXXXXXXXXXXXMLLL 571
           ESLIDSIPVH                 MLLL
Sbjct: 541 ESLIDSIPVHEETETVVTATGAATTVGMLLL 571

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score =  161 bits (408), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/407 (28%), Positives = 197/407 (48%), Gaps = 22/407 (5%)

Query: 110 FYENTLLFIRRNKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKS--KY 167
           F+ N   F+R N+LCC +H+KLGP L HLRI  +Y++ Y + +K    + F       KY
Sbjct: 94  FWYNIFSFLRLNELCCSLHSKLGPLLNHLRIAWYYLKPYTDNVKNVLENPFNSSTDWMKY 153

Query: 168 GFFSFDFASGMLNGTLSESLHQDTLSSARXXXXXXXXXXXXXXXXXXXXNEEVINQKLE- 226
           G FS D       GTL++ + +    +                        E  N++ E 
Sbjct: 154 GSFSAD-------GTLTKPIFETDSETEDYEDDENENEDEDEDEDEDDVGIEDENKEYEF 206

Query: 227 DSIE-------LNNLPINADINGYHLENQADGILDRKVA--LNNEFNAWINAVEGKSSNA 277
           D ++       L    I  D++   + + +   L+   A  L  E+ AWI A++ K  +A
Sbjct: 207 DGVQDGHGNSQLVTAAILQDLSKIIIGSNSHAELETYEAESLKMEYEAWIKAIDSKIHSA 266

Query: 278 LLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNE 337
           +     EI+   E E +  + E+   L++L   +  Q+  ++  I+DI+C SK+DP  N+
Sbjct: 267 MALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQNK 326

Query: 338 LVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQ 397
           + YFD +G  ++  Y+++  + SI       + +F   +  + ++ F+  M    E+I  
Sbjct: 327 IKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHS-LDSFLTEMAKLAESIRL 385

Query: 398 ENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDD-DPLF-EQSAKKWQRFLDLKHEVVEM 455
           ENVEVYEEWGD+MIS+WS+RMA  DV    L D  DP + E++   W RF++LK +V+  
Sbjct: 386 ENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDPAYIEENHSNWLRFMELKKKVISE 445

Query: 456 RDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKADVAF 502
           R+ L   + D T +   I+  +   +   +   + F      AD  F
Sbjct: 446 RNRLVKHDLDMTLILEWITKLKADFQNTKNNIQDTFLQRMNTADTLF 492

>Scas_712.22
          Length = 624

 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 144/256 (56%), Gaps = 11/256 (4%)

Query: 253 LDRKVALNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIE 312
           +D +  L ++F+ W N +E K ++    F  ++ + I++E +    + + ++ NL  E E
Sbjct: 276 VDEQQLLQSDFDNWSNTIEQKIASINKLFDKDVAKLIKKEMKSNEQKFKDKIQNLNQESE 335

Query: 313 SQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEF 372
                + K IQDI+C    DP +NE +YFD NG  ++ +Y+ RPL+  +F K    ++E 
Sbjct: 336 LLFQDLNKAIQDINCTESLDPQTNETIYFDRNGETQLEQYIERPLIRELFEKTRATLNEL 395

Query: 373 RNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDD 432
             ++++   N  I  +  K+E+I  E+++VYEEWG+IM++EWS+RMA  DVV+  L  + 
Sbjct: 396 IADIQNDE-NVLIEKVNKKVESIRDEHLDVYEEWGEIMVNEWSKRMAYVDVVAAHLNAE- 453

Query: 433 PLFEQSAKK------WQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDE 486
              E+ AKK      W++FL +K +V+  RD L    P+   +E  ++N +  L+ +  +
Sbjct: 454 ---EKEAKKTMSEENWKKFLKVKKQVIGARDELVEHVPNIKTMEQFLNNIQETLKMLSKD 510

Query: 487 ANNQFEALGKKADVAF 502
           A      L  +A++AF
Sbjct: 511 AGEYLYILRARANLAF 526

>Kwal_47.19184
          Length = 712

 Score =  132 bits (331), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 131/244 (53%), Gaps = 4/244 (1%)

Query: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318
           + +EF AW  AV+ K+SN L  F  EI+  ++ +       +   L ++ +  ++    I
Sbjct: 268 VQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDI 327

Query: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378
            K I D+DC  + DP + E +YF+ +GT ++ +Y++RPLM   F  AH  ++E R E   
Sbjct: 328 NKAILDVDCNMELDPVTGEQLYFNRDGT-QLRKYMTRPLMREYFSAAHAHVEE-RLEFVR 385

Query: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDDPLFEQS 438
             +  F+  +  +++ I QE++E+YEEWGD+MISEWS+RMA  D+     +  D   +Q 
Sbjct: 386 AQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYGDIFHA--IGSDSFDQQQ 443

Query: 439 AKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKA 498
              W++FL LK  VV  RD L        AL+  + + +  L  +  +A      L  +A
Sbjct: 444 HDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQA 503

Query: 499 DVAF 502
           ++AF
Sbjct: 504 NLAF 507

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score =  127 bits (319), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 134/244 (54%), Gaps = 6/244 (2%)

Query: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318
           + +EF+AW  A+E K+ + L AF +E+     ++ E    +    L ++  + +    KI
Sbjct: 248 VADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKI 307

Query: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378
            + I+DI+   + DP++N+ ++FD++GT ++ +Y++RPLM   F +A+ ++    N +  
Sbjct: 308 NQAIRDINSTMELDPATNQTIWFDAHGT-QLHQYITRPLMREYFSQANDELANITNHIR- 365

Query: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDDPLFEQS 438
             +   + S+  +++ I QE++EVYEEW D+M+SEWSRRMA  DVV   L  +     + 
Sbjct: 366 AELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE----AER 421

Query: 439 AKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKA 498
            + W+RFL LK  V+++RD L         LE  +   +  L  +  E       L  KA
Sbjct: 422 NRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKA 481

Query: 499 DVAF 502
           +++F
Sbjct: 482 NLSF 485

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score =  125 bits (315), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 130/244 (53%), Gaps = 7/244 (2%)

Query: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318
           + NE+ AW N VE K++ AL AF  E+      + E  +  M   L N+ N  +    KI
Sbjct: 274 VQNEYQAWSNTVERKANTALDAFTKEVHDYEIEQLESVSPLMSSLLQNISNTTQLHFQKI 333

Query: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378
            K I DI+C  +   +  +L +FD +GT ++ EY++RPLM  +F  A+ ++    +++  
Sbjct: 334 NKAILDINCTMEIGENGEQL-FFDRHGT-QLKEYITRPLMRGLFTAANEELTAMSDDLR- 390

Query: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDDPLFEQS 438
             +  F+ ++   ++ I  E++EVYEEWGD+MISEWS+RMA  DVV+   LD+    EQ 
Sbjct: 391 ARLKEFVNTVNDHVDVIRNEHLEVYEEWGDVMISEWSKRMAYVDVVA---LDEQDDSEQH 447

Query: 439 AKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKA 498
           +  W+ FL LK  V++ RD L         LE  +   +  L  +  E+      L  KA
Sbjct: 448 S-NWKNFLKLKRNVIKTRDLLVEHPVKFHDLEVFLKEVQFTLRMLAKESGEYLYILRSKA 506

Query: 499 DVAF 502
           ++ F
Sbjct: 507 NLTF 510

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 147/293 (50%), Gaps = 13/293 (4%)

Query: 222 NQKLEDSIELNNLPINADINGYH-------LENQADGILDRKVALNNEFNAWINAVEGKS 274
            Q + ++I L+    +A  N  H       +E   D  ++ +  L  +F+ W   +  K+
Sbjct: 231 TQTVVETITLDQEEASAVANHAHDDEASTDVEGSTDVNVNEQALLQEDFDMWSETILQKT 290

Query: 275 SNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPS 334
            + +  F+ ++ + I  +     N  + +  +L ++ +    KI   I DI+C+   D  
Sbjct: 291 QDVIQLFEKDVSKYINGKLVEEANHFKAKFQSLDDKSKKFFSKISLAINDIECVEGIDSE 350

Query: 335 SNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLET 394
           + + ++FD +G+ +I +Y++R L+   F +    +DE  N ME   ++     ++ K+  
Sbjct: 351 TGKKIFFDKSGSTEISQYITRELVREYFNETRSTLDELTNAMEKD-LSEITDEIEKKVNA 409

Query: 395 IHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLL--DDDPLFEQSAKK---WQRFLDLK 449
           I +ENVEV+EEWGDI+++EWS+RMA  DV++  +   DD  L E+ AK    W++FL  K
Sbjct: 410 IREENVEVFEEWGDIIVNEWSKRMAYVDVINAHMGADDDTTLDEEKAKSSVNWKKFLKGK 469

Query: 450 HEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKADVAF 502
            +++E RD L +   D + +       + K+     E+      L  KA++ F
Sbjct: 470 KQIIESRDKLAHHSADLSRVNAFRQKVQKKILSFTQESGEFLYILRSKANLQF 522

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/473 (21%), Positives = 201/473 (42%), Gaps = 38/473 (8%)

Query: 48  IVVSSLHNLKIDYVTTIEPYLAELVSWTGQFCSNVKIHPVSHSVWLRILSAYEYFINEIL 107
           ++V++   L + Y   + P   +++ +TG   ++V                Y   + E+L
Sbjct: 9   VLVAASVLLGVLYRDPMTPGCMDMIKYTGYQSTSV---------------PYLAVLIELL 53

Query: 108 SPFYENTLLFIRRNKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKSKY 167
              +   + F+ RN+LCC +H KLGP LQHLRI+L+Y++ + ++      D F  L+   
Sbjct: 54  LDMWGKVVEFVHRNRLCCTLHRKLGPLLQHLRIVLYYLKPFAQQASSSFNDGFAILRGNL 113

Query: 168 GFFSFDFASGML----NG--TLSESLHQDTLSSARXXXXXXXXXXXXXXXXXXXXNEEVI 221
            F   D    ML    NG   +      +                           + ++
Sbjct: 114 DFSRIDEGYSMLSLINNGRNVIESDEEDEDEEDGDEKSTKNKKQSKNKEQAESSNVDAIV 173

Query: 222 NQKLEDSIELNNLPINADINGYHLENQADGILDRKVALNNEFNAWINAVEGKSSNALLAF 281
           +  L D  ++  L  + D +       ++ I    +     FN W+ ++  K        
Sbjct: 174 DAVLNDPTDVT-LHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFKAIENEL 232

Query: 282 QDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYF 341
             E++ +I           +  +  L++++++QI  ++  +Q+I+C   YD +++ + Y+
Sbjct: 233 SQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYY 292

Query: 342 DSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVE 401
           D  G + +  YV+RPL+         ++++    ++  V N  +      LE +  E +E
Sbjct: 293 DHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN-MVEQSHIALEAVRNETIE 351

Query: 402 VYEEWGDIMISEWSRRMAQFDV------------VSGQLLDDDPLFEQSAK---KWQRFL 446
            YEEWGD   +EWS+ MA  D+            + G+   +D   ++ AK    W  F 
Sbjct: 352 AYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIDGKGKGEDQGDDEVAKIYEDWFEFT 411

Query: 447 DLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKAD 499
             K ++++ RD L + + D+  L+   ++   +L+ +      Q ++L  +AD
Sbjct: 412 LHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQAD 464

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 127/245 (51%), Gaps = 5/245 (2%)

Query: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318
           L N+F +W   +E K SN +  F+++I    + + ++    +   L    N  ++    I
Sbjct: 316 LRNDFMSWKITIENKLSNTMKDFENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQII 375

Query: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378
            K I D++C    DP +N+ ++FD N T ++ +Y++R LM   F  AH Q D    E+  
Sbjct: 376 TKAIMDVNCTESVDPKTNKTIWFDQNNT-QLPKYMTRELMREYFSAAHSQFDALSQEIR- 433

Query: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDV-VSGQLLDDDPLFEQ 437
             +      +   +E + QENVE++EEW D+MI+EWS+ +A  DV V+ + L D  L ++
Sbjct: 434 AHLRKLADEVNDHVEVLRQENVELFEEWADVMITEWSKNLAYVDVAVNEEKLAD--LEKE 491

Query: 438 SAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKK 497
             K W+ F+ LK +V++ RDTL        +L+  ++  +  L+ +  E       L  K
Sbjct: 492 QRKNWKDFMKLKRQVIKTRDTLMEHPVKLDSLQSFVNTVQQSLKTLSHENGEYLYILRSK 551

Query: 498 ADVAF 502
           A++ F
Sbjct: 552 ANLEF 556

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 134/264 (50%), Gaps = 12/264 (4%)

Query: 246 ENQADGILDRKVALNNEFNAWINAVEGKSS--NALLA--FQDEIERSIEREGEYFTNEME 301
           E+  D  +D +  L  +F+ W + ++ K    N +L    +  ++  I+   + F ++++
Sbjct: 260 EDITDIEIDHQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLK 319

Query: 302 IRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSI 361
           +    L  E       I K IQDI+C    DP + + +YFDS G  +I +Y++R ++ ++
Sbjct: 320 V----LHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTM 375

Query: 362 FLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQF 421
                  ++    ++E+ V +  +   +   E   ++++  +EEWGDIMI+EWS+++A  
Sbjct: 376 LNDTQTTLNSLVADIENDV-SKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYL 434

Query: 422 DVVSGQ---LLDDDPLFEQSAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARI 478
           DV++       +     E S K W++F+ +K ++++ RD +   +   +  + ++ N + 
Sbjct: 435 DVLAPHEDAEHEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQN 494

Query: 479 KLEEIIDEANNQFEALGKKADVAF 502
            L+ + +E       L  +A++AF
Sbjct: 495 TLQAVTNENGEYLYILRAQANLAF 518

>YKL151C (YKL151C) [3117] chr11 complement(164922..165935) Member of
           the UPF0031 uncharacterized protein family, has moderate
           similarity to uncharacterized C. albicans Orf6.4368p
           [1014 bp, 337 aa]
          Length = 337

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 423 VVSGQLLDDDPLFEQSAKKWQRFLDLKHE----VVEMRDTLYYSEPDSTALEGIIS--NA 476
           VV G  L  DPL  +S K   R++  KHE    +V   D L+    DS   E + S    
Sbjct: 116 VVIGPGLGRDPLMLKSIKDIIRYILEKHEGKIPLVIDADGLFLVTQDSEVKEMLKSYPKG 175

Query: 477 RIKLEEIIDEANNQFEALGKKAD 499
           R+ L   + E     +A+GKK D
Sbjct: 176 RVILTPNVVEFKRLCDAIGKKGD 198

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 24  SANNDSTNAVSGSLLVPYMKMYKGIVVSSLHNLKIDYVTTIEP 66
           SA ++ TN +S  +L P +++ +   +S + N   D+VT++ P
Sbjct: 381 SATHNDTNGISEDVLKPSLELSRAASLSKMLNKGSDFVTSMTP 423

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,167,898
Number of extensions: 750385
Number of successful extensions: 2875
Number of sequences better than 10.0: 54
Number of HSP's gapped: 2924
Number of HSP's successfully gapped: 55
Length of query: 571
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 464
Effective length of database: 12,891,983
Effective search space: 5981880112
Effective search space used: 5981880112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)