Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_687.1995695642820.0
YFR040W (SAP155)100270220090.0
AFR245W89969417100.0
Sklu_2433.1791455912401e-155
CAGL0C02145g77745811241e-140
Kwal_47.1919179043410881e-134
Scas_712.2182854910331e-126
KLLA0A01155g9933339881e-118
YGL229C (SAP4)8184588491e-99
AFR089W10316018541e-98
Scas_711.22*10185957961e-90
CAGL0L03586g11233166244e-67
YJL098W (SAP185)10583136065e-65
KLLA0F14124g11003126022e-64
YKR028W (SAP190)10983135651e-59
Kwal_26.73467472484931e-51
Scas_675.365573443592e-35
Kwal_26.734328269940.003
Scas_649.1397160731.6
CAGL0J00539g48840685.5
KLLA0A05280g241131687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_687.19
         (956 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_687.19                                                          1654   0.0  
YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated p...   778   0.0  
AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C...   663   0.0  
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement     482   e-155
CAGL0C02145g complement(216905..219238) similar to sp|P43612 Sac...   437   e-140
Kwal_47.19191                                                         423   e-134
Scas_712.21                                                           402   e-126
KLLA0A01155g complement(104687..107668) some similarities with s...   385   e-118
YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...   331   1e-99
AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W...   333   1e-98
Scas_711.22*                                                          311   1e-90
CAGL0L03586g complement(408095..411466) similar to sp|P40856 Sac...   244   4e-67
YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that asso...   238   5e-65
KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces...   236   2e-64
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...   222   1e-59
Kwal_26.7346                                                          194   1e-51
Scas_675.36                                                           142   2e-35
Kwal_26.7343                                                           41   0.003
Scas_649.13                                                            33   1.6  
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    31   5.5  
KLLA0A05280g 469130..476365 highly similar to sp|P33334 Saccharo...    31   7.3  

>Scas_687.19
          Length = 956

 Score = 1654 bits (4282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 842/956 (88%), Positives = 842/956 (88%)

Query: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS 60
           MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS
Sbjct: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS 60

Query: 61  VNLSGDETCSSLVLTKNIYFNKNTLYPTRXXXXXXXXXXXXXXXXXXXXXATDLNSEDIS 120
           VNLSGDETCSSLVLTKNIYFNKNTLYPTR                     ATDLNSEDIS
Sbjct: 61  VNLSGDETCSSLVLTKNIYFNKNTLYPTRSGGASGSSSTSGSPLSSENSSATDLNSEDIS 120

Query: 121 ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLD 180
           ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLD
Sbjct: 121 ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLD 180

Query: 181 YLIDSLLAYVDEIPMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXXXXXVPTSLSKA 240
           YLIDSLLAYVDEIPMEIAKTEKKEEVKIY                       VPTSLSKA
Sbjct: 181 YLIDSLLAYVDEIPMEIAKTEKKEEVKIYATDEEKQTEEEQAEAANEELANEVPTSLSKA 240

Query: 241 TIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRT 300
           TIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRT
Sbjct: 241 TIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRT 300

Query: 301 ENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQ 360
           ENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQ
Sbjct: 301 ENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQ 360

Query: 361 FLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILN 420
           FLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILN
Sbjct: 361 FLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILN 420

Query: 421 KRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSINLPN 480
           KRGYALDTAVSIVIELIRKNNSDYDQVNLLETT            YLGYLLKKFSINLPN
Sbjct: 421 KRGYALDTAVSIVIELIRKNNSDYDQVNLLETTIIDNPPIDRDPIYLGYLLKKFSINLPN 480

Query: 481 FLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEKIA 540
           FLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEKIA
Sbjct: 481 FLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEKIA 540

Query: 541 LKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGXXXXXXXXXXXXXXXXXXXXXTKAV 600
           LKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTG                     TKAV
Sbjct: 541 LKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGSDSNDLKSNNDNSNDFNENDDTKAV 600

Query: 601 KKPKTNNDPNINTSINAXXXXXXXXXXXXXXXXXXXXXXXXPYINESQNMKLREYPTMGD 660
           KKPKTNNDPNINTSINA                        PYINESQNMKLREYPTMGD
Sbjct: 601 KKPKTNNDPNINTSINASEEQEEVNEESDSSIEEIDESFEIPYINESQNMKLREYPTMGD 660

Query: 661 LFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLK 720
           LFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLK
Sbjct: 661 LFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLK 720

Query: 721 GSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMGHLVLVAEEI 780
           GSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMGHLVLVAEEI
Sbjct: 721 GSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMGHLVLVAEEI 780

Query: 781 IKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGGTYVDDGNGNIVPQ 840
           IKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGGTYVDDGNGNIVPQ
Sbjct: 781 IKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGGTYVDDGNGNIVPQ 840

Query: 841 LATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALEEQLMLSTESDLHNKLREML 900
           LATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALEEQLMLSTESDLHNKLREML
Sbjct: 841 LATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALEEQLMLSTESDLHNKLREML 900

Query: 901 ASQGQKQVDDRNAKNGVIILGPPPQXXXXXXXXXXXXXHYAYDYDEPKGANEEYGS 956
           ASQGQKQVDDRNAKNGVIILGPPPQ             HYAYDYDEPKGANEEYGS
Sbjct: 901 ASQGQKQVDDRNAKNGVIILGPPPQEEEENNVDEDDDNHYAYDYDEPKGANEEYGS 956

>YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated
           protein [3009 bp, 1002 aa]
          Length = 1002

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/702 (56%), Positives = 506/702 (72%), Gaps = 44/702 (6%)

Query: 237 LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLL 296
           L+KATIISE  +LD+W+++++L+KN+SYL+K+WSII     +SE+S LV IFLKINQNLL
Sbjct: 279 LTKATIISEIFSLDIWLISESLVKNQSYLNKIWSIINQPNFNSENSPLVPIFLKINQNLL 338

Query: 297 FSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIY 356
            +R + Y+ FI T  + VD++L H+D+S++MDFFLKII+TD+IESPTG+I+LV DQ LI 
Sbjct: 339 LTRQDQYLNFIRTERSFVDDMLKHVDISLLMDFFLKIISTDKIESPTGIIELVYDQNLIS 398

Query: 357 KSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILID 416
           K L FL+N +  +D+Q+C GDFLKALI ISANAP+DDI+IGPNSLTR+LAS E+I  L+D
Sbjct: 399 KCLSFLNNKESPADIQACVGDFLKALIAISANAPLDDISIGPNSLTRQLASPESIAKLVD 458

Query: 417 IILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSI 476
           I++N+RG AL+T VSIVIELIRKNNSDYDQVNLL TT            YLGYLL+KFS 
Sbjct: 459 IMINQRGAALNTTVSIVIELIRKNNSDYDQVNLLTTTIKTHPPSNRDPIYLGYLLRKFSN 518

Query: 477 NLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKA 536
           +L +F +II+DIE D +IPL ENQLHEKFKPLGFERFK+VELIAELLHCSNMGLMNS++A
Sbjct: 519 HLSDFFQIILDIENDANIPLHENQLHEKFKPLGFERFKVVELIAELLHCSNMGLMNSKRA 578

Query: 537 EKIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGXXXXXXXXXXXXXXXXXXXXX 596
           E+IA +RDK R +  S+ +   L++LSI +K  +                          
Sbjct: 579 ERIARRRDKVRSQL-SHHLQDALNDLSIEEKEQL-------------------------- 611

Query: 597 TKAVKKPKTNNDPNINTSINAXXXXXXXXXXXXXXXXXXXXXXXXPYINESQNMKLREYP 656
            K    P  + D ++  +                           PYIN  Q +KLR  P
Sbjct: 612 -KTKHSPTRDTDHDLKNNNGKIDNDNNDNDDESDYGDEIDESFEIPYINMKQTIKLRTDP 670

Query: 657 TMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSL 716
           T+GDLFKI LYDT+++ +IM+LFL HPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV SL
Sbjct: 671 TVGDLFKIKLYDTRIVSKIMELFLTHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVLSL 730

Query: 717 FNLKGSLQYMPPDVIAGIENIEDV------------NFAITTDFILKGYHDSFKFYETRK 764
           FNLK S Q+M  D++   E   DV            +F ITTDFIL+GY DS+KFYE RK
Sbjct: 731 FNLKSSYQFM-TDIVISDEKGTDVSRFSPVIRDPNFDFKITTDFILRGYQDSYKFYELRK 789

Query: 765 TNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKIL 824
            NLGYMGH+VL+AEE++KFS+LYKVELISPDIQ     ++W+YYS +VLNETR+MYSKIL
Sbjct: 790 MNLGYMGHIVLIAEEVVKFSKLYKVELISPDIQVILQTEEWQYYSEEVLNETRMMYSKIL 849

Query: 825 GGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTN---FQEMKDGGELINVEALE 881
           GGG+Y+DDGNGNI+PQL  + T     G  S++++  +++         GG+LINVE+LE
Sbjct: 850 GGGSYIDDGNGNIIPQLPDNTTVLTPNGDASNNNEILDSDTGSSNGTSGGGQLINVESLE 909

Query: 882 EQLMLSTESDLHNKLREMLASQGQKQVDDRNAKNGVIILGPP 923
           EQL LSTESDLHNKLREML ++ Q+ VD++N +NGV ILGPP
Sbjct: 910 EQLSLSTESDLHNKLREMLINRAQEDVDNKNTENGVFILGPP 951

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 118/200 (59%), Gaps = 10/200 (5%)

Query: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS 60
           MSFWPFGQNLNHS+INKILDEYF +LH LE+ NP V K     F+ +    +  S S+ S
Sbjct: 1   MSFWPFGQNLNHSNINKILDEYFHVLHELERINPSVGKAIPAIFNNVQ--ERGTSDSLDS 58

Query: 61  VNLS---GDETCSSLVLTKNIYFNKN----TLYPTRXXXXXXXXXXXXXXXXXXXXXATD 113
           +      GDE  ++    K+  F K+                                TD
Sbjct: 59  IPEEYSHGDEVKTARGDQKS-RFEKDDQQERYEKEEEERSMNSSESSTTSFSSGSTSKTD 117

Query: 114 LNSEDISETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITK 173
           L+ EDIS  T P+ V+ KNLDNSF++R+++++E LNEL+RQN TLLDFIC+GFFFD  T 
Sbjct: 118 LDEEDISNATAPMMVTTKNLDNSFIERMLVETELLNELSRQNKTLLDFICFGFFFDKKTN 177

Query: 174 EKVQNLDYLIDSLLAYVDEI 193
           +KV N++YL+D L+  + +I
Sbjct: 178 KKVNNMEYLVDQLMECISKI 197

>AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C
           (SAP4) - SH] complement(880258..882957) [2700 bp, 899
           aa]
          Length = 899

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/694 (51%), Positives = 457/694 (65%), Gaps = 68/694 (9%)

Query: 237 LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLL 296
           L++   ISE  ALD+W+++++L+K+ S+LSK+WS++ H    +E S LV IFLKINQNLL
Sbjct: 265 LNRVNTISEIFALDIWLISESLVKDPSHLSKIWSVLNHKDFKAEKSPLVPIFLKINQNLL 324

Query: 297 FSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIY 356
            +R +  + FI    +LVDE L H+++S++MDFFLKII+TD+ ESPTG+I+LV DQ LI 
Sbjct: 325 LTRQDQLLNFIRARESLVDEFLQHLEISVLMDFFLKIISTDKQESPTGIIELVYDQGLIP 384

Query: 357 KSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILID 416
           K L FLDN KYS+D+Q+C+GD +KALI IS NAP+D+++IGPN+LTR+L S E+ID  +D
Sbjct: 385 KMLSFLDNHKYSADIQACAGDLMKALISISTNAPLDELSIGPNALTRQLCSEESIDCFLD 444

Query: 417 IILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSI 476
            I+NKRG+AL TAVS+VIELIRKNNSDYDQ+NLL T+            YLG +LKKF+ 
Sbjct: 445 AIINKRGHALTTAVSVVIELIRKNNSDYDQINLLCTSVKTHPPSTRDPIYLGRMLKKFAE 504

Query: 477 NLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKA 536
            LPNF +++++IE D SI    NQL  ++KPLGFERFKIVELIAELLHCSNMGLMNS+KA
Sbjct: 505 KLPNFKRVLLEIENDGSIKDIRNQLGIEYKPLGFERFKIVELIAELLHCSNMGLMNSKKA 564

Query: 537 EKIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITT-----LTGXXXXXXXXXXXXXXXX 591
           E+I  +RD+ R       +   L+ L++ D N  T      LTG                
Sbjct: 565 ERIVKERDEVRNHM-VKQLQDALTELNMNDGNDRTKGDEKGLTG----------LCATNT 613

Query: 592 XXXXXTKAVKKPKTNNDPNINTSINAXXXXXXXXXXXXXXXXXXXXXXXXPYINESQNMK 651
                T AV     N D  I+ S                           PY+N +QN K
Sbjct: 614 SMSTQTTAVND---NADEEIDESFE------------------------IPYLNMNQNSK 646

Query: 652 LREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSF 711
           L   PT+GDLFKI LYDTQ++P+I++LF+ HPWNNFWHNV+FDIIQQIFNGRMDFSYNSF
Sbjct: 647 LPHNPTIGDLFKIQLYDTQLLPKIIQLFIEHPWNNFWHNVVFDIIQQIFNGRMDFSYNSF 706

Query: 712 LVYSLFNLKGSLQYMPPDVIAGIENIED-VNFAITTDFILKGYHDSFKFYETRKTNLGYM 770
           LVYSLFN K + Q++  DV       +D  +FAIT D +L+GY +S  FYE   TNLGYM
Sbjct: 707 LVYSLFNNKDAGQFV-IDVKPEENRAQDFTDFAITRDLVLQGYKNSHAFYEQYNTNLGYM 765

Query: 771 GHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGGTYV 830
           GHLVL+AEEI+KFS++YKVELISPDI     D DW +YS D LN+TR+MYSKILGG  Y+
Sbjct: 766 GHLVLIAEEIVKFSKVYKVELISPDIHRVLQDPDWIFYSEDALNDTRMMYSKILGGSEYL 825

Query: 831 DDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALEEQLMLSTES 890
            + NG    ++       EN+        EF         GG+L            ST++
Sbjct: 826 GEENGCTAAEMEQLTETGENL-------PEF---------GGKLSGYS-------FSTQA 862

Query: 891 DLHNKLREMLASQGQKQVDDRNAKNGVIILGPPP 924
           DLH KL+E L  + Q++VD +N KNGVIILGPPP
Sbjct: 863 DLHQKLKEKLIKRSQEEVDLKNKKNGVIILGPPP 896

 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 110/205 (53%), Gaps = 27/205 (13%)

Query: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKE-----------ALKFFSKIDT 49
           MSFWPFGQN+N+S+IN+ILD+YF++LH+LE++      E           A +   +  T
Sbjct: 1   MSFWPFGQNVNNSNINRILDDYFRVLHSLEEDGAGESGEREAGGGPAAPAAGRIVKERST 60

Query: 50  DSQNVSASISSVNLSGDETCSSLVLTKNIYFNKNTLYPTRXXXXXXXXXXXXXXXXXXXX 109
           +    S      +L   E   ++   + +Y N N+                         
Sbjct: 61  NGGGASGGARD-SLQRTEGGDAM---RPVYHNPNS--------SEQGTVSSAPCVPSALS 108

Query: 110 XATDLNSEDISET-TTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFF 168
            A  + +E+++++   PL  +  +L+ SF+D ++ +SE LNELTRQN+TLLDF+C+GFF+
Sbjct: 109 SAVSICTEELADSDEAPL--TKFSLNYSFIDSILKESELLNELTRQNNTLLDFVCFGFFY 166

Query: 169 DPITKEKVQNLDYLIDSLLAYVDEI 193
           D     K+ N++YLID L+  +D +
Sbjct: 167 D-TDGNKIDNIEYLIDQLMFCIDRV 190

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score =  482 bits (1240), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/559 (47%), Positives = 371/559 (66%), Gaps = 22/559 (3%)

Query: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQN-VSASIS 59
           MSFWPFGQN+N+S+INK+LD+YF +L  LE ++    K++      +D + Q+  SAS +
Sbjct: 1   MSFWPFGQNINNSNINKLLDDYFHVLRDLEAQS----KDST---GGVDDNKQSQTSASGA 53

Query: 60  SVNLSGDETCSSLVLTKNIYFNKN--TLYPTRXXXXXXXXXXXXXXXXXXXXXATDLNSE 117
              +  D   S + L   I  + +   L P                        +  +  
Sbjct: 54  MDPIPEDTIISPVPLNATIAQDPSPQALRPASSPSLKTQRNVDPSESESLSSSTSTSSVA 113

Query: 118 DISETT-TPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKV 176
            ++ T  +P+  ++++L+NSF+D L+ ++E LNELTRQN+TLLDFIC+G+F+D     KV
Sbjct: 114 SLTGTVESPM--TLQSLNNSFIDNLLQETELLNELTRQNNTLLDFICFGYFYDAYGT-KV 170

Query: 177 QNLDYLIDSLLAYVDEI-------PMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXX 229
           +N++YLID L+  +D+I       P +     ++E+                        
Sbjct: 171 ENIEYLIDQLMICIDKINEHDDNEPDDKDLQVEQEDGPSTQTQPNDDSNDISTPSVDNQE 230

Query: 230 XXXVPTSLSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFL 289
                + L+KATIISE  +LD+W+++++L+KN +YL+ +WSI+ H    SE S L+ IFL
Sbjct: 231 EDDQSSYLNKATIISEIFSLDIWLISESLVKNSTYLATIWSILHHPNFSSEKSPLIPIFL 290

Query: 290 KINQNLLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLV 349
           KINQNLL +R + Y+ FI T  NLV + L HI +S++MDFFLK+I+TD+ ESPTG+I+LV
Sbjct: 291 KINQNLLLTRQDQYLNFIRTRENLVGDFLKHIGISVLMDFFLKVISTDKQESPTGIIELV 350

Query: 350 CDQKLIYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNE 409
            +Q LI K L +LDN  Y +D+Q+C+GDF+KALI ISANAP+DD++IGPNSLTR+L S +
Sbjct: 351 YEQGLISKLLNYLDN-GYHADIQACAGDFIKALIAISANAPLDDMSIGPNSLTRQLCSEQ 409

Query: 410 AIDILIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGY 469
            ID+L++ I+NKRG AL TAVSIVIELIRKNNSDYDQVNLL TT            YLG 
Sbjct: 410 CIDLLLNAIVNKRGAALTTAVSIVIELIRKNNSDYDQVNLLTTTVKTHPPSIRDPIYLGV 469

Query: 470 LLKKFSINLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMG 529
           +LKKF++NLP F +I++D+E DD IPL +NQL++++KPLGFERFK+VELIAELLHCSNMG
Sbjct: 470 MLKKFAVNLPEFYRILLDVENDDRIPLVKNQLNQEYKPLGFERFKVVELIAELLHCSNMG 529

Query: 530 LMNSRKAEKIALKRDKYRK 548
           LMNS+KAE+I  +RD+ R+
Sbjct: 530 LMNSKKAERIVKERDEVRQ 548

 Score =  295 bits (754), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 205/291 (70%), Gaps = 33/291 (11%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PY+N SQN KLR  PT GDLFKI+LYDTQ++P+I++LFL +PWNNFWHNV+FDIIQQIF+
Sbjct: 632 PYVNPSQNAKLRLNPTTGDLFKINLYDTQILPKIIELFLRYPWNNFWHNVLFDIIQQIFS 691

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYE 761
           GRMDFSYNSFLVYSLFN KGS Q+M   + A   ++ D  F IT D IL+GY DS  FYE
Sbjct: 692 GRMDFSYNSFLVYSLFNNKGSAQFM---LTAKPTHVRD--FRITADLILQGYRDSHDFYE 746

Query: 762 TRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYS 821
             +TNLGYMGHLVL+AEEI+KFS++YKVELISPDI E   D+ W +YS DVLN+TR+MYS
Sbjct: 747 VHETNLGYMGHLVLIAEEIVKFSKVYKVELISPDIYEVLQDEAWIFYSEDVLNDTRVMYS 806

Query: 822 KILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALE 881
           KILGGG Y+DDG  N +  LA+          PSS +            GG+LINV    
Sbjct: 807 KILGGGDYMDDGGENAIHDLAS----------PSSSES-----------GGDLINVSNYG 845

Query: 882 EQLM-------LSTESDLHNKLREMLASQGQKQVDDRNAKNGVIILGPPPQ 925
           ++L         ST+SDLH KL+E L  + Q +VD RN + GVI+LG  P+
Sbjct: 846 QELQQHTQANAFSTQSDLHKKLKEKLIKESQSEVDRRNKEKGVIVLGMTPE 896

>CAGL0C02145g complement(216905..219238) similar to sp|P43612
           Saccharomyces cerevisiae YFR040w SAP155 SIT4P-associated
           protein, hypothetical start
          Length = 777

 Score =  437 bits (1124), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 324/458 (70%), Gaps = 14/458 (3%)

Query: 114 LNSEDISETTTPLN--VSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPI 171
           +N  +++E T PL    + + LD+SF+DR++ + E LNEL  QN  L+DFIC+GFFF   
Sbjct: 3   INGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKEN 62

Query: 172 TKEKVQNLDYLIDSLLAYVDEIPMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXXXX 231
            KE+V+N+DYL+D LL  VD+  M  A T     V +                       
Sbjct: 63  EKERVENIDYLLDQLLFCVDQFKMVEADT-----VNVTRENSPADEGIEMDFNKVIEDNA 117

Query: 232 XVPTS-LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLK 290
                 LS+A +I+E  +LD+W++T++L+KN+ +LSK+W+++ +     E S L+ IFLK
Sbjct: 118 EDEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLK 177

Query: 291 INQNLLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVC 350
           +NQNLL +R + Y+ FI +  +LVD++L HID++++MDFFLK+I+TD+IESPTGVI+LV 
Sbjct: 178 MNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVS 237

Query: 351 DQKLIYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEA 410
           DQKLI K L+FL+N  YS+D+Q+C  DFLKALI ISANAP+D+++IGPNSLTR LAS ++
Sbjct: 238 DQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKS 297

Query: 411 IDILIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYL 470
           ID +I I+LN+RG AL++ +SIVIELIRKNNSDYDQVNLL+TT            +LGYL
Sbjct: 298 IDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYL 357

Query: 471 LKKFSINLPNFLKIIVDI----ETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCS 526
           L++F+ NLP   +II DI    +T+D + L  NQ++EKF P+GFERFKIVELIAELLHCS
Sbjct: 358 LRRFAANLPKLFEIIDDIYDNNDTNDDM-LLTNQMNEKFIPIGFERFKIVELIAELLHCS 416

Query: 527 NMGLMNSRKAEKIALKRDKYRKRANSYDVHHTLSNLSI 564
           NMGL+N+++AE+IA  RDK RK+  S+ +   L++L+I
Sbjct: 417 NMGLLNTKRAERIARVRDKVRKQV-SFQLQDALNDLTI 453

 Score =  373 bits (958), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/284 (64%), Positives = 223/284 (78%), Gaps = 17/284 (5%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PYINE+QN KLR  PT+GDLFKI LYD Q++P+IMKLFL HPWNNFWHNVIFDIIQQIFN
Sbjct: 506 PYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFN 565

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYE 761
           GRMDFSYNSFLV+SLFNL+GS QYM  +  A    ++D  F+IT DFIL+GYH S+KFYE
Sbjct: 566 GRMDFSYNSFLVFSLFNLEGSFQYMDSEA-AKDAKLKD--FSITKDFILEGYHKSYKFYE 622

Query: 762 TRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYS 821
            + TNLG+MGHLVL+AEE++KFS+LYKVELIS DIQ++  + DW+YYS +VLN TR+MYS
Sbjct: 623 EKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYS 682

Query: 822 KILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALE 881
           KILGGG +V+D NGNIVPQ+  DG       +   D+ + +        GG+LINVE LE
Sbjct: 683 KILGGGNFVEDANGNIVPQM-NDGN-----YLDYDDENDVS--------GGKLINVENLE 728

Query: 882 EQLMLSTESDLHNKLREMLASQGQKQVDDRNAKNGVIILGPPPQ 925
           EQL LSTESDLH KLR+ML  + Q++VD +NA NGVIILG P +
Sbjct: 729 EQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVIILGGPEE 772

>Kwal_47.19191
          Length = 790

 Score =  423 bits (1088), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/434 (50%), Positives = 299/434 (68%), Gaps = 13/434 (2%)

Query: 133 LDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLDYLIDSLLAYVDE 192
           L + ++D ++ +SE LNELTRQNSTLLDF+C+G+F+      KVQN++YLID L+A V+ 
Sbjct: 75  LSSKYIDGILAESELLNELTRQNSTLLDFVCFGYFYGA-DGGKVQNIEYLIDQLMACVER 133

Query: 193 IPMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXXXXXVPTSLSKATIISEALALDLW 252
           +    A  E+                               P  L++ATIISE  ALD+W
Sbjct: 134 LGAAEAGQEQNSSASTPAAEDSVEGTEDPQQ----------PV-LNRATIISEIFALDIW 182

Query: 253 MLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRTENYIAFICTNPN 312
           +++++L+KN SYL+K+WSI++     SE S+L+ IFLKINQNLL +R + Y+ FI +   
Sbjct: 183 LISESLVKNASYLNKIWSILKQQNFASEKSALIPIFLKINQNLLATRQDQYLNFIRSKDT 242

Query: 313 LVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQFLDNTKYSSDVQ 372
           LVD++L+HI +S++MDF LKII+TD+ ESP+G+I+LV +Q+L  K L +LDN +Y  D+Q
Sbjct: 243 LVDDLLEHIQISVLMDFLLKIISTDKQESPSGIIELVHEQRLPNKLLSYLDNDRYEPDIQ 302

Query: 373 SCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILNKRGYALDTAVSI 432
           +C+ D LKA++ ISANAP+DD++IGPNSLTR LAS + +  L+D I++KRG AL  AVSI
Sbjct: 303 ACAADLLKAIVAISANAPLDDMSIGPNSLTRHLASEDCVSFLLDTIIDKRGNALINAVSI 362

Query: 433 VIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSINLPNFLKIIVDIETDD 492
           VIELIRKNNSDYDQVNLL TT            YLG +LK F+  LP+  +I+ DIE D 
Sbjct: 363 VIELIRKNNSDYDQVNLLTTTLTSHPPSMRDPIYLGVMLKLFTERLPSIFQILTDIELDS 422

Query: 493 SIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEKIALKRDKYRKRANS 552
           +    ENQL EK+KPLGFERFK+VELIAELLHCSNMGL+NS+KAE+I  +R+  R  A  
Sbjct: 423 TTKELENQLGEKYKPLGFERFKVVELIAELLHCSNMGLLNSKKAERIVKERNNARG-AVV 481

Query: 553 YDVHHTLSNLSIRD 566
             +   L++L ++D
Sbjct: 482 KQLQDALADLDLQD 495

 Score =  315 bits (806), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 198/289 (68%), Gaps = 25/289 (8%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PY+N +QN KLRE PT+GDLFKI+LYD Q++P+I+ LFL +PWNNFWHNV+FDIIQQ+FN
Sbjct: 520 PYVNPNQNAKLRENPTIGDLFKITLYDNQIIPRIVHLFLQYPWNNFWHNVVFDIIQQLFN 579

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYE 761
           GRMDFSYNSFL+YSLFN   + ++M     A  + + D  F IT D ILKGY +S+ FYE
Sbjct: 580 GRMDFSYNSFLIYSLFNNHAASRFMSE---ATAKTVRD--FQITRDLILKGYKESYAFYE 634

Query: 762 TRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYS 821
              T LG+MGHLVL+AEEI+KFS++YKVELISPDIQ    + DW +YS DVLN+TRIMYS
Sbjct: 635 KHNTALGFMGHLVLIAEEIVKFSKVYKVELISPDIQAVLQNDDWVFYSEDVLNDTRIMYS 694

Query: 822 KILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALE 881
           KILGG  Y++DGN N            E  G    DD     N Q    GG LIN+  L 
Sbjct: 695 KILGGNDYLEDGNTN------------ERDGDLIDDDTHNRENPQP---GGNLINLSELS 739

Query: 882 EQLM-----LSTESDLHNKLREMLASQGQKQVDDRNAKNGVIILGPPPQ 925
           +        LST SDLH KLR+ L  Q Q +VD RN +NGVIILG  P+
Sbjct: 740 QDQGQGLSNLSTTSDLHKKLRQRLIDQSQGEVDRRNEQNGVIILGMAPE 788

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (93%), Gaps = 1/31 (3%)

Query: 1  MSFWPFGQNLNHSDINKILDEYFQILHTLEK 31
          MSFWPFGQN  HS+IN++L+EYFQ+LH+LEK
Sbjct: 1  MSFWPFGQN-EHSNINRVLEEYFQVLHSLEK 30

>Scas_712.21
          Length = 828

 Score =  402 bits (1033), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/549 (42%), Positives = 343/549 (62%), Gaps = 53/549 (9%)

Query: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS 60
           MSFWPF Q+ + S+++KILDEYF IL++L K N             I+ D  +V      
Sbjct: 1   MSFWPFPQD-STSNVSKILDEYFDILNSLRKAN------------LIEDDDNDVP----- 42

Query: 61  VNLSGDETCSSLVLTKNIYFNKNTLYPTRXXXXXXXXXXXXXXXXXXXXXATDLNSEDIS 120
             L G+E            +  +   P +                     + D ++E  S
Sbjct: 43  --LRGEEQIHD-------SYGSSKFQPRKHKHRTRKRKRKLAVTSEES--SCDRDTE--S 89

Query: 121 ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLD 180
           + +  + VS  +LDNSF++R++ + + ++EL ++N+ LLDF+C+G+FFD  +K K+ N+ 
Sbjct: 90  KKSNDVVVSKVSLDNSFIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSK-KIMNMQ 148

Query: 181 YLIDSLLAYVDEIPMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXXXXXVPTSLSKA 240
           YLID L++ V  +    A     +E K                          P  L KA
Sbjct: 149 YLIDQLISCVQYLTN--ASITSVDEDK----------------ANDNMRSQEGPNFLHKA 190

Query: 241 TIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRT 300
           TIIS  L+ D W+++++LIKN +YL+++WS++ +  L++E S L+ IFLK+N++LL SR 
Sbjct: 191 TIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRK 250

Query: 301 ENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQ 360
           + Y+ FI T   LVDE   H+++ +++DF LK+IATD+ + PTG+I+L+ DQ++I K L+
Sbjct: 251 DQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLK 310

Query: 361 FLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILN 420
           F  N +YS+DVQ+C+ DFLKALIGISAN P+D++++GPN L+R LAS + +D LI+IILN
Sbjct: 311 FFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLINIILN 370

Query: 421 KRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSINLPN 480
           + G AL+  +S+VIELIRKNNSDYD++NLLETT            YLGYLLKKFS  + N
Sbjct: 371 ENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIEN 430

Query: 481 FLKIIVDIETDDSI--PLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEK 538
              ++ D+  D +I   +R NQ++++F+PLGFER KIVELIAELLHCSNMGLMNS++AE 
Sbjct: 431 IFALVDDM-ADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEH 489

Query: 539 IALKRDKYR 547
           IALKRD  R
Sbjct: 490 IALKRDHLR 498

 Score =  278 bits (711), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 166/209 (79%), Gaps = 1/209 (0%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PYINE QN KLR  PT+GD FKI+LYD Q++ +I+ LFL +PWNNFWHNVIFDIIQQ+FN
Sbjct: 582 PYINEKQNSKLRNGPTIGDRFKINLYDNQIIIKILILFLKNPWNNFWHNVIFDIIQQLFN 641

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIEN-IEDVNFAITTDFILKGYHDSFKFY 760
           GRMDFSYNSF+VYSLFNL+ + Q+   D  A   N I   NF IT DFIL GY  S++FY
Sbjct: 642 GRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFY 701

Query: 761 ETRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMY 820
           E  KTNLGYMGHLVL+AEE++KFS+LYKVELISPDIQ+   +K+W +Y ++VL+ TRIMY
Sbjct: 702 EKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMY 761

Query: 821 SKILGGGTYVDDGNGNIVPQLATDGTPEE 849
           SKILGGG++VDDGNGN+VPQ      P E
Sbjct: 762 SKILGGGSFVDDGNGNVVPQFIESSDPYE 790

>KLLA0A01155g complement(104687..107668) some similarities with
           sp|P43612 Saccharomyces cerevisiae YFR040w SAP155
           SIT4P-associated protein, hypothetical start
          Length = 993

 Score =  385 bits (988), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 253/333 (75%), Gaps = 1/333 (0%)

Query: 235 TSLSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQN 294
           T L+KA IISE  ALD+W+++++L+KN  YL+K+WSI+ H     E S L+ IFLKINQN
Sbjct: 392 TFLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQN 451

Query: 295 LLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKL 354
           LL +R + Y+ FI T  NLV ++L HID+S++MDFFLKI+ATD+ E+PTG+I+LV +QKL
Sbjct: 452 LLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKL 511

Query: 355 IYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDIL 414
           I     FL N KYS+D+Q+C+GDF+K++I +SANAP+D+++IGPN+LTRE+AS + ID L
Sbjct: 512 IDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYL 571

Query: 415 IDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKF 474
           +  I+N+RG AL TAVSI IELIRKNNSDYDQVNLL TT            YLG +L+KF
Sbjct: 572 LGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKF 631

Query: 475 SINLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSR 534
           S NL N  +I+ DIE D SIP+ +NQ+ E +KPLGFERFK+VELIAELLHCSNMGLMNS+
Sbjct: 632 SENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSK 691

Query: 535 KAEKIALKRDKYRKRANSYDVHHTLSNLSIRDK 567
           KAE+I  +RD+ R       +   L++L+I+ K
Sbjct: 692 KAERIVKERDQVRTEL-VQQLEDALTDLNIKSK 723

 Score =  296 bits (758), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 147/285 (51%), Positives = 198/285 (69%), Gaps = 43/285 (15%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PY+N++QN KLR  PT+GDLFKI LY++Q++P I++LF+ +PWNNFWHNVIFDIIQQIFN
Sbjct: 750 PYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFN 809

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIED--VNFAITTDFILKGYHDSFKF 759
           GRMDFSYNSFLVY+LF+ K + ++      A  + ++D  ++F IT D +L GY +S KF
Sbjct: 810 GRMDFSYNSFLVYALFSNKNAERF------ATDKTLDDAPIDFQITRDLVLLGYRNSHKF 863

Query: 760 YETRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIM 819
           YE   T LG+MGHLVL+AEEI+KFS++YKV+LISPDI E  +D+DW +YSND+LN+TRIM
Sbjct: 864 YEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIM 923

Query: 820 YSKILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEA 879
           YSKILGGG Y++DGN N                                  GG+++ +  
Sbjct: 924 YSKILGGGDYIEDGNLN----------------------------------GGDIV-MGN 948

Query: 880 LEEQLMLSTESDLHNKLREMLASQGQKQVDDRNAKNGVIILGPPP 924
            ++    ST+ DLH+KLRE L  + +++VD++N KNGVIIL   P
Sbjct: 949 DQDPTSFSTQMDLHDKLREKLIEKSRQEVDEKNEKNGVIILPAGP 993

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 51/66 (77%), Gaps = 1/66 (1%)

Query: 128 VSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLDYLIDSLL 187
           + ++ L + F+D ++ ++E LNELTRQN+TLLDF+C+G+F+   T +KV+N+ YLID LL
Sbjct: 210 IPLQALSHKFMDEILEETELLNELTRQNNTLLDFVCFGYFYTE-TGDKVENIAYLIDRLL 268

Query: 188 AYVDEI 193
             +D+I
Sbjct: 269 DCIDKI 274

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 26/32 (81%)

Query: 1  MSFWPFGQNLNHSDINKILDEYFQILHTLEKE 32
          MSFWPFGQN N S+IN IL+EYF ++H LE +
Sbjct: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQ 32

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score =  331 bits (849), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 185/458 (40%), Positives = 284/458 (62%), Gaps = 31/458 (6%)

Query: 132 NLDNSFVDRLIIDSEFLNELT-RQNSTLLDFICYGFFFDPITKEKVQNLDYLIDSLLAYV 190
           +L+ SF+DR+++++  L+EL    N  L+DFIC G+F+D    ++V+++DYL+D L+AY+
Sbjct: 61  DLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDD-RSQQVRHMDYLVDMLMAYL 119

Query: 191 DEIPMEIAKTEKKEEVKIYXXXXXXXXXXXXXXXXXXXXXXXVPTSLSKATIISEALALD 250
            +I     +T    E   +                           +    IIS      
Sbjct: 120 KDIDRTGYRTPFLLENSFHQTGEYEDQDDE--------------DPMLYVNIISSIFCSK 165

Query: 251 LWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRTENYIAFICTN 310
              + +AL++N  +LS L+ + + + +++E+  ++++FLKIN+ LLF +T +Y+ F  + 
Sbjct: 166 SAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEFFKSQ 225

Query: 311 PNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQFLDNTKYSSD 370
           PN+VD+ L HI+VS +++F +KI+ TD++ESPT +I  +  Q LI K L  L+N+KYS  
Sbjct: 226 PNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSKYSPG 285

Query: 371 VQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILNKRGYALDTAV 430
           +Q+ SG+ LKALI IS N  +D + IGPN LTR+LAS + +D LI+IIL +RG+A+  AV
Sbjct: 286 IQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAMGVAV 345

Query: 431 SIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSINLPNFLKIIVDIE- 489
           SI+IELIRKNNSDYD+V+LL TT            YLG+LL + ++++ +F  +++ +E 
Sbjct: 346 SIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLIKLEN 405

Query: 490 --------TDDSIP-----LRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKA 536
                      ++P     L ENQLHE F+PLGFER KI ELI+E+LHCSNMGLMNS++ 
Sbjct: 406 DDDDDHDTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMNSKRG 465

Query: 537 EKIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLT 574
           EKIA  RDK R   +   +   + NL+I D N+IT+ T
Sbjct: 466 EKIARTRDKCRDTLDQNSLEKAMKNLNIND-NTITSNT 502

 Score =  253 bits (646), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 175/262 (66%), Gaps = 4/262 (1%)

Query: 642 PYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFN 701
           PY++E+QN+K+R+ PT+GDLFKI L+D    P+ ++LFL +PWNNFWHN++FDIIQQIFN
Sbjct: 556 PYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFN 615

Query: 702 GRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYE 761
           GRMDFSYNSFLVYSLF+ K S +++P  +    + +   +F I +DFIL+G+ DSF+FYE
Sbjct: 616 GRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYE 675

Query: 762 TRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYS 821
             KTNLGYMG LVL+AEEI K+S++YK +LI+PDI     D+ W  YS+D+LNETR M S
Sbjct: 676 KEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCS 735

Query: 822 KILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALE 881
            ILGGG +  + + N       D   + +M  P+             +D      V  L 
Sbjct: 736 IILGGGQFCAESDENT----NQDFLEKADMSKPAHPSTMDENEIVHEEDVKLHDKVAELI 791

Query: 882 EQLMLSTESDLHNKLREMLASQ 903
           ++L   TE D+H+K+++++   
Sbjct: 792 DELGQLTELDIHDKIKDVIVDH 813

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%)

Query: 1  MSFWPFGQNLNHSDINKILDEYFQILHTLE 30
          MS WPFG+ L+HS I+ IL+EY+ I  +LE
Sbjct: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLE 30

>AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W
           (SAP185) - SH] complement(590137..593232) [3096 bp, 1031
           aa]
          Length = 1031

 Score =  333 bits (854), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 225/601 (37%), Positives = 308/601 (51%), Gaps = 72/601 (11%)

Query: 239 KATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFS 298
           +A + +E L+ D+W ++ A I+++  L KLWSI+ H    S  +S  + F+KIN+ LL  
Sbjct: 211 RARMAAEILSADVWPISSAFIEHDELLYKLWSILDHPAPLSIVAS--TYFMKINERLLDM 268

Query: 299 RTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKS 358
              + I FI    NLVD  L HID   +MDF LK+I+TD+ ++PT VI L+  QKLI K 
Sbjct: 269 DIASMIRFILNQDNLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIGLLKYQKLISKL 328

Query: 359 LQFLDNTKYSSDVQSCSGDFLKALIGISANAPID-DIAIGPNSLTRELASNEAIDILIDI 417
           L  L + ++SS VQS +GDFLKALI ISAN+  +   AIGPN LTREL S      L DI
Sbjct: 329 LDHL-SPEWSSSVQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSPAMASKLGDI 387

Query: 418 ILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSIN 477
           +LN  G +L   V IVIELIRKNNSDYD   ++ TT            YLG+L+K F+  
Sbjct: 388 MLNG-GTSLSNGVGIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVYLGHLVKSFANK 446

Query: 478 LPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAE 537
           LP F  +++D +    +P  E       +PLGFERFKI ELIAELLHCSNMGL+N  K E
Sbjct: 447 LPEFNAMLLDTK----LPPLETPFG-TIEPLGFERFKICELIAELLHCSNMGLLNEPKGE 501

Query: 538 ----------KIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGXXXXXXXXXXXX 587
                     +  L+ + Y    N +D   ++S   I +++    +              
Sbjct: 502 EIVNERDIDRECVLRLEGYGIPKNCHDEERSVSVSPIEEEDLAKKIRDLQLVTD------ 555

Query: 588 XXXXXXXXXTKAVKKPKTNNDPNINTSINAXXXXXXXXXXXXXXXXXXXXXXXXPYINES 647
                        K+P ++N      S+N+                            E 
Sbjct: 556 -------------KRPSSDNSVE---SLNSDSQQATTPIHQLGTEIHSEDSSDA----EL 595

Query: 648 QNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFS 707
               LRE P +GD  KI+L D +++  I+ +F  +PWNNF HNV+FDI+QQIFNG +   
Sbjct: 596 SEQALREKPVVGDQLKIALQDNKIITTILGMFFKYPWNNFLHNVVFDIVQQIFNGPLKTG 655

Query: 708 YNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNL 767
           YN FL+  LF                         A  T+ I++G     ++       L
Sbjct: 656 YNRFLLADLF-----------------------ASAHITEAIIEGDRKCHEYERETGLRL 692

Query: 768 GYMGHLVLVAEEIIKFSRL---YKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKIL 824
           GYMGHL LVAEE+ KF+      K+   +P I E+  D+ WR Y+  VL ETR  YS +L
Sbjct: 693 GYMGHLTLVAEEVTKFASYIDEMKISFSNPVISESLNDQRWREYTELVLAETRGKYSTVL 752

Query: 825 G 825
           G
Sbjct: 753 G 753

>Scas_711.22*
          Length = 1018

 Score =  311 bits (796), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 212/595 (35%), Positives = 302/595 (50%), Gaps = 65/595 (10%)

Query: 237 LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHD-GLDSESSSLVSIFLKINQNL 295
           + +A + SE L+ ++W +++A+++N+  L+KLWSI+ H   L  E+S+    F+KIN+ L
Sbjct: 202 VRRAHMASEILSAEVWGISNAILENDELLTKLWSILDHPIPLSIETSTY---FMKINERL 258

Query: 296 LFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLI 355
           L +     + FI +   LV   L HID   ++DF LK+I++D+ ++PT VIQ + +Q LI
Sbjct: 259 LDTDITGMVTFILSQSTLVARFLKHIDNPPLLDFLLKVISSDKPDAPTRVIQCLKEQGLI 318

Query: 356 YKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIA--IGPNSLTRELASNEAIDI 413
            + L  L + +Y    Q+ + DFLKA + IS N    +IA  IGPN LTR+L S E ++ 
Sbjct: 319 PRLLDCLSH-EYDPSTQTAAADFLKAFVTISGNCN-SEIASSIGPNELTRQLVSPEMMEK 376

Query: 414 LIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKK 473
           LI I+L   G +L   V I+IELIRKNNSDYD V ++ TT            YLGYL+  
Sbjct: 377 LIKIMLTG-GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLVSL 435

Query: 474 FSINLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNS 533
           F+  +P F K ++D    +S  LR +       PLGFERFK+ ELIAELLHCSNM L+N 
Sbjct: 436 FAQYMPEFNKFLLDT---NSTMLRTS--FGNITPLGFERFKVCELIAELLHCSNMSLLNE 490

Query: 534 RKAEKIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGXXXXXXXXXXXXXXXXXX 593
            K E I  +RD+ RKR  ++   H   +         TT+ G                  
Sbjct: 491 PKGEAIVKERDEERKRVLNF--SHISDSEEANMNGDTTTIEG------------------ 530

Query: 594 XXXTKAVKKPKTNNDPNINTSINAXXXXXXXXXXXXXXXXXXXXXXXXPYINESQNMKLR 653
              T+ +   K  ++  I   +N                         P   +S    +R
Sbjct: 531 EEITERIDSLKLESEEEIR-ELNEKEDESSVAESSDVEAAPEDHISDSPATEKS----IR 585

Query: 654 EYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV 713
           +   +GD+ K  LYDT ++  I+K+F   PWNNF HNV+FDIIQQIFNG +   YN FL+
Sbjct: 586 DEKIVGDVLKTLLYDTGIVVNIVKMFFQFPWNNFLHNVVFDIIQQIFNGPLKTGYNIFLL 645

Query: 714 YSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMGHL 773
             L                          A  T  +L G   S ++ E     LGYMGHL
Sbjct: 646 KDLLTR-----------------------AHLTQLLLDGDTRSREYEERTHFRLGYMGHL 682

Query: 774 VLVAEEIIKFSRLY---KVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILG 825
            L+ EEI+KF+      KV     DI +A  D  W  Y++ +L +TR  Y   LG
Sbjct: 683 TLIGEEILKFAAYLEETKVVFTEDDIVDALQDSAWIEYADTILADTREKYETALG 737

>CAGL0L03586g complement(408095..411466) similar to sp|P40856
           Saccharomyces cerevisiae YJL098w SAP185 or sp|P36123
           Saccharomyces cerevisiae YKR028w SAP190, start by
           similarity
          Length = 1123

 Score =  244 bits (624), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 200/316 (63%), Gaps = 14/316 (4%)

Query: 237 LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDG-LDSESSSLVSIFLKINQNL 295
           L +A + +E L+ D+W ++ A+I+NE  L KLWSI+++   L  E S+    F+KIN+ L
Sbjct: 247 LRRARMAAEVLSADVWPISSAIIQNEDLLEKLWSIMQYPAPLPIEISTY---FMKINERL 303

Query: 296 LFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLI 355
           L       +AFI  +PNL+D  L HID   +MDF LK+I+TD+ ++PTG+I+++ +Q +I
Sbjct: 304 LDMDLNGILAFILNHPNLLDIFLTHIDNPPLMDFLLKVISTDKADTPTGIIKILKEQGMI 363

Query: 356 YKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIA--IGPNSLTRELASNEAIDI 413
            K L FL + +Y    QS +GDF+KAL+ IS N   ++IA  IGPN + REL S   ++ 
Sbjct: 364 PKLLDFL-SPEYDKSTQSAAGDFIKALVTISGNCN-NEIASSIGPNEMIRELVSPPMVEK 421

Query: 414 LIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKK 473
           LI I+L K G +L   V IVIELIRKNNSDYD V L  TT            YLGYLLK 
Sbjct: 422 LISIML-KAGSSLSNGVGIVIELIRKNNSDYDFVQLAYTTIKTHPPNDRDPIYLGYLLKA 480

Query: 474 FSINLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNS 533
           F+ ++  F +++  IE     PL+  Q   + +PLGFERFKI ELIAELLHCSNM L+N 
Sbjct: 481 FAAHMAEFTQMLTSIEL---PPLQTPQ--GEIEPLGFERFKICELIAELLHCSNMTLLND 535

Query: 534 RKAEKIALKRDKYRKR 549
              E I  +RD+ R+R
Sbjct: 536 PNGESIVKERDEERER 551

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 96/178 (53%), Gaps = 26/178 (14%)

Query: 651 KLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNS 710
           KLRE PT+GD  KI+L DT+V+  I+++F  + WNNF HNV+FDIIQQIFNG +   YN 
Sbjct: 645 KLRENPTVGDQLKIALEDTRVIEVILEMFFHYVWNNFLHNVVFDIIQQIFNGPLMTGYNR 704

Query: 711 FLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYM 770
           FL+  L                 ++NI        TD I+KG   S  + E     LGYM
Sbjct: 705 FLLIDL-----------------LKNIH------MTDLIIKGNEQSGVYEEKHVLRLGYM 741

Query: 771 GHLVLVAEEIIKFSRL---YKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILG 825
           GHL L+AEEI+KF       K+   +  I     +  W+YY+   L + R  Y+ ILG
Sbjct: 742 GHLTLMAEEIVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETELADLREKYNTILG 799

>YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3177 bp, 1058 aa]
          Length = 1058

 Score =  238 bits (606), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 193/313 (61%), Gaps = 12/313 (3%)

Query: 239 KATIISEALALDLWMLTDALIKNESYLSKLWSIIR-HDGLDSESSSLVSIFLKINQNLLF 297
           +A I +E L+ D+W ++ ALI+NE  L+KLWSI+R    L  E+S+    F+KIN+ LL 
Sbjct: 208 RARIAAEILSADVWPISSALIENEGLLAKLWSILRLPSPLSIEASTY---FMKINERLLD 264

Query: 298 SRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYK 357
              +  I FI    ++VD+ L HID   +MDF LK+I+TD+ E   GVIQL   Q L+ K
Sbjct: 265 MNMDGIIEFILKKEHIVDDFLAHIDNPPLMDFLLKVISTDKPEISNGVIQLFKKQNLVPK 324

Query: 358 SLQFLDNTKYSSDVQSCSGDFLKALIGISANAPID-DIAIGPNSLTRELASNEAIDILID 416
            +  LD   + S  QS +GDFLKAL+ IS N P +   +IGPN LTR+L S   +  L+D
Sbjct: 325 LIHLLDPV-FDSCTQSAAGDFLKALVTISGNCPNEITSSIGPNELTRQLVSPNMMKQLMD 383

Query: 417 IILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSI 476
           I+L K G +L+  V I+IELIRKNNSDYD +    TT            YLGYL+K FS 
Sbjct: 384 IML-KGGNSLNNGVGIIIELIRKNNSDYDTIQTNYTTIESHPPTDRDPIYLGYLVKMFSE 442

Query: 477 NLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKA 536
           ++ +F KI+    T+  IPL +   +   +PLGFERFKI ELIAELLHCSNM L+N   A
Sbjct: 443 HMADFNKIL----TEKKIPLLQTS-YGTIEPLGFERFKICELIAELLHCSNMTLLNEPSA 497

Query: 537 EKIALKRDKYRKR 549
             I  +RD  R+R
Sbjct: 498 YDIVRERDAERER 510

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 94/177 (53%), Gaps = 26/177 (14%)

Query: 652 LREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSF 711
            R  P +GD  KISL DT+V+  ++++F    WNNF HNV++D++QQIFNG +   YN F
Sbjct: 622 FRVSPNVGDQLKISLQDTRVIDTMLEMFFHFQWNNFLHNVVYDVVQQIFNGPLKIGYNRF 681

Query: 712 LVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMG 771
           L+  L                       +N  + TD I+ G ++  ++ +   T LGYMG
Sbjct: 682 LLDDLL----------------------INIRL-TDMIINGNNECIEYEKGHDTRLGYMG 718

Query: 772 HLVLVAEEIIKFSRLYK---VELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILG 825
           HL L+AEE+ KF+   +   +   + ++  +  +  W  Y+ DVL + +  Y+ ILG
Sbjct: 719 HLTLIAEEVTKFTAYIEEMNITFENTEVMSSLFESKWIAYTEDVLEDLKEKYNAILG 775

>KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces
           cerevisiae YKR028w SAP190 SIT4P-associated protein,
           start by similarity
          Length = 1100

 Score =  236 bits (602), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 192/312 (61%), Gaps = 10/312 (3%)

Query: 239 KATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFS 298
           +A I +E L+ D+W ++ A + NE  L KLWS + H    S  +S  + F+KIN+ LL  
Sbjct: 284 RARIAAEILSADVWTISSAFMDNEDLLVKLWSTLEHPAPLSIIAS--TYFMKINERLLDM 341

Query: 299 RTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKS 358
                I FI    N+VD  + HID   +MDF LK+I+TD+ ++PTG+I L+  Q LI K 
Sbjct: 342 DISGMINFILKQENIVDRFIAHIDNPPLMDFLLKVISTDKPDAPTGIIALLKKQHLISKL 401

Query: 359 LQFLDNTKYSSDVQSCSGDFLKALIGISANAPID-DIAIGPNSLTRELASNEAIDILIDI 417
           L +L + ++ S +QS +GDFLKALI ISAN+  +   AIGPN LTREL S E +  L++I
Sbjct: 402 LDYL-SIEHDSSIQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSAEMVSKLVNI 460

Query: 418 ILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSIN 477
           +L + G +L   V IVIELIRKNNSDYD V ++ TT            YLG+L++ F+  
Sbjct: 461 ML-QCGTSLSNGVGIVIELIRKNNSDYDFVQVMYTTLETHPPSDRDPVYLGHLVRCFANK 519

Query: 478 LPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAE 537
           +  F KI+++ + D   PL         +PLGFERFKI EL+AELLHCSNMGL+     E
Sbjct: 520 MDRFNKILLETKLD---PLE--TPFGSIEPLGFERFKICELVAELLHCSNMGLLGEPSGE 574

Query: 538 KIALKRDKYRKR 549
            I L+RD  R+ 
Sbjct: 575 AIVLERDLKREE 586

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 98/185 (52%), Gaps = 31/185 (16%)

Query: 652 LREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSF 711
           LRE P +GDL KISL D  ++  I+ +F   PWNNF HNV+FDI+QQIFNG +   YN F
Sbjct: 679 LRENPVVGDLLKISLQDNNIITTILDMFFRFPWNNFLHNVVFDIVQQIFNGPLKSGYNKF 738

Query: 712 LVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKTNLGYMG 771
           L+  LF                       + A  TD I++G     ++ +     LGYMG
Sbjct: 739 LLADLF-----------------------SSAHITDVIMEGDRKCLEYEKETGIRLGYMG 775

Query: 772 HLVLVAEEIIKFSRLYK---VELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGGT 828
           HL L+AEE+ KF+   +   V   SP +QE   +  W+ Y + +L ETR  YS +LG   
Sbjct: 776 HLTLIAEEVAKFAAYIEEANVTFASPVVQEGLNEPKWKEYCDTILTETREKYSSLLG--- 832

Query: 829 YVDDG 833
             DDG
Sbjct: 833 --DDG 835

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score =  222 bits (565), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 192/313 (61%), Gaps = 12/313 (3%)

Query: 239 KATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFS 298
           +A I +E L+ D+W ++ A+++N+  L +LWSI+ H       +S  + F+KIN+ LL  
Sbjct: 215 RARIAAEILSADVWPISAAIMQNKDLLGRLWSILDHPAPLPIPAS--TYFMKINERLLDM 272

Query: 299 RTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKS 358
                + FI +  +LV   L H+D   +MDF LK+I+TD+ +SPTGVI+++  Q+LI K 
Sbjct: 273 DITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVISTDKPDSPTGVIKILKSQELIPKL 332

Query: 359 LQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIA--IGPNSLTRELASNEAIDILID 416
           L  L N +Y    QS +GDF+KA + +S N+  +++A  IGPN LTR+L S E I+ LI 
Sbjct: 333 LDHL-NPEYGISTQSAAGDFIKAFVTLSTNSS-NELASGIGPNELTRQLVSEEMIEKLIK 390

Query: 417 IILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSI 476
           I+L K G +L   V I+IELIRKNNSDYD + L+ TT            +L +L+K F+ 
Sbjct: 391 IML-KGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLESHPPTDRDPIHLIHLVKLFAK 449

Query: 477 NLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKA 536
           ++P+F     D+     +PL E       +PLGFERFKI ELIAELLHCSNM L+N    
Sbjct: 450 HMPDF----ADMLDKTKLPLMEMPFG-NIEPLGFERFKICELIAELLHCSNMTLLNEPNG 504

Query: 537 EKIALKRDKYRKR 549
           E IA +RD  R +
Sbjct: 505 EMIAQERDIERAK 517

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 95/187 (50%), Gaps = 34/187 (18%)

Query: 646 ESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMD 705
           ES    LRE P +GD  KI+L DT+++  I+ +F   PWNNF HNVIFDI QQIFNG + 
Sbjct: 607 ESVRECLREKPLVGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLK 666

Query: 706 FSYNSFLVYSLFNLKGSL--QYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETR 763
             YN FL      LK  L   Y+   ++   +  +D                    YE +
Sbjct: 667 TGYNRFL------LKDYLVDAYLTKKIVDADKACQD--------------------YE-K 699

Query: 764 KTNL--GYMGHLVLVAEEIIKFSRL---YKVELISPDIQEATVDKDWRYYSNDVLNETRI 818
           KT L  GYMGHL LVAEEI KF       K+   +  + +   +  W+ YS  +L +TR 
Sbjct: 700 KTGLRYGYMGHLTLVAEEISKFKEYIDEMKLTFCNTAVSDRLEEPFWKEYSETILADTRE 759

Query: 819 MYSKILG 825
            Y+ +LG
Sbjct: 760 KYNTVLG 766

>Kwal_26.7346
          Length = 747

 Score =  194 bits (493), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 156/248 (62%), Gaps = 8/248 (3%)

Query: 304 IAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQFLD 363
           + FI    NLVD  L HID   +MD+ LK+I+TD+ ++ TGVI+ +  Q LI K L  L 
Sbjct: 2   LHFILAQDNLVDRFLKHIDNPPLMDYLLKVISTDKPDTTTGVIERLDSQDLIPKLLDHLA 61

Query: 364 NTKYSSDVQSCSGDFLKALIGISANAPID-DIAIGPNSLTRELASNEAIDILIDIILNKR 422
           +  +S   +S +GDFLKALI ISAN+  +   AIGPN LTR+L S   ++ L++I+L+  
Sbjct: 62  SV-HSPSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRKLVSPSMVEKLMNIMLSG- 119

Query: 423 GYALDTAVSIVIELIRKNNSDYDQVNLLETTXXXXXXXXXXXXYLGYLLKKFSINLPNFL 482
           G +L   V I+IELIRKNNSDYD V ++ TT            YLGYL+K  + +LP F 
Sbjct: 120 GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCSAKHLPEFN 179

Query: 483 KIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEKIALK 542
           KI+V+ E    +P  E       +PLGFERFKI EL+AELLHCSNM L+N    E+I  +
Sbjct: 180 KILVETE----LPPLETPFG-SIEPLGFERFKICELVAELLHCSNMTLLNEPNGEEIVSE 234

Query: 543 RDKYRKRA 550
           RD  R+++
Sbjct: 235 RDAVREKS 242

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 96/178 (53%), Gaps = 28/178 (15%)

Query: 652 LREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSF 711
           LRE P +GD  KI+L D +V+  I+++F A PWNNF HNV+FDI+QQIFNG +   +N F
Sbjct: 315 LRENPVVGDQLKIALQDNRVITTILEMFFAFPWNNFLHNVVFDIVQQIFNGPLKTGFNRF 374

Query: 712 LVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKFYETRKT-NLGYM 770
           L+  LF     L +M   ++ G +  ED                    YE      LGYM
Sbjct: 375 LIADLFT-GAKLTHM---IMEGDKKCED--------------------YENETGLRLGYM 410

Query: 771 GHLVLVAEEIIKFSRL---YKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILG 825
           GHL L+AEE+ KF+      K+   +  I ++  +  W+ Y+  VL +TR  YS +LG
Sbjct: 411 GHLTLIAEEVAKFAAYVEEMKISFSNQAITDSLDEPSWKEYTETVLADTRENYSSVLG 468

>Scas_675.36
          Length = 557

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 156/344 (45%), Gaps = 48/344 (13%)

Query: 508 LGFERFKIVELIAELLHCSNMGLMNSRKAEKIA----LKRDKYRKRANSYDVHHTLSNLS 563
           LGFE+FKI ELIAELLHCSNM L+N    E I     L+R K   +    D++ T     
Sbjct: 1   LGFEKFKICELIAELLHCSNMTLLNEPNGEAIVTERDLERVKMFSQEEDNDMNGTADLQE 60

Query: 564 IRDKNSIT--TLTGXXXXXXXXXXXXXXXXXXXXXTKAVKKPKTNNDP---NINTSINAX 618
             ++NS+   +  G                      + ++    +ND    N N  ++  
Sbjct: 61  EIEENSVAEKSSNGGEVTEKLNKLKIEPEQIISETNEEIETEHEDNDTDPVNTNDELDVA 120

Query: 619 XXXXXXXXXXXXXXXXXXXXXXXPYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKL 678
                                     +E+    LRE P  GD  KISL +T ++  I+++
Sbjct: 121 NGEVETAEIYDETLSD----------SEATEALLRENPIPGDQLKISLRETGIIRTILEM 170

Query: 679 FLAHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIE 738
           F    WNNF HNV+FDI+QQIFNG +  +YN FL+               D++ G E I 
Sbjct: 171 FFHFEWNNFLHNVVFDIVQQIFNGPLRTTYNRFLL--------------GDLLTGSEIIH 216

Query: 739 DVNFAITTDFILKGYHDSFKFYETRKTNLGYMGHLVLVAEEIIKFSRL---YKVELISPD 795
                     +L G        E     +GYMGHL+L+AEEI KF       K+   +P 
Sbjct: 217 ---------LVLDGDKKCAAQQEKHGLRIGYMGHLMLIAEEIAKFIEYIEEMKISFSNPA 267

Query: 796 IQEATVDKDWRYYSNDVLNETRIMYSKILGGGTYV-DDGNGNIV 838
           IQE   +  WR Y   +L +TR+ Y+ +L  G +V +DG+G+++
Sbjct: 268 IQECLNEPQWREYMATILADTRVKYNTVL--GDFVSEDGSGDLI 309

>Kwal_26.7343
          Length = 282

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 239 KATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFS 298
           +A + +E L+ D+W ++ A + +E  LS+LWS++ H    S  +S  + F+KIN+ LL  
Sbjct: 213 RARMAAEILSADVWPISSAFMDHEELLSQLWSMLDHPAPLSIVAS--TYFMKINERLLDM 270

Query: 299 RTENYIAFI 307
                + FI
Sbjct: 271 DIAGMLHFI 279

>Scas_649.13
          Length = 971

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 3   FWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISSVN 62
           FW  G +++  D+  I      ILH      PLV++E +KF  ++   ++N++A  +SVN
Sbjct: 376 FWEDGSHIDLKDVASI------ILHGGSTRVPLVQQELIKFLGEVKI-AKNINADEASVN 428

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 121 ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLD 160
           + T+P N+S + L N+    L+ + EFL +   QNST+ D
Sbjct: 383 QQTSPTNISPQRLHNNGSHDLLQEPEFLTQTPNQNSTIPD 422

>KLLA0A05280g 469130..476365 highly similar to sp|P33334 Saccharomyces
            cerevisiae YHR165c PRP8 U5 snRNP protein, pre-mRNA
            splicing factor singleton, start by similarity
          Length = 2411

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 675  IMKLFLAHPWNNFWHNVIFDIIQQIFNGRMD 705
            ++++F AH W     +V+FDI  QI +G+MD
Sbjct: 1646 LIQIFRAHLWQKIHESVVFDIC-QILDGQMD 1675

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,155,206
Number of extensions: 1261636
Number of successful extensions: 4105
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4150
Number of HSP's successfully gapped: 62
Length of query: 956
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 845
Effective length of database: 12,753,511
Effective search space: 10776716795
Effective search space used: 10776716795
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)