Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_687.172222228961e-124
Kwal_47.192032351744662e-58
YFR042W2001664625e-58
Sklu_2433.152101664426e-55
KLLA0A01111g2091363471e-40
CAGL0C02101g1971933442e-40
AFR247W2112163392e-39
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_687.17
         (222 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_687.17                                                           349   e-124
Kwal_47.19203                                                         184   2e-58
YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   182   5e-58
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     174   6e-55
KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   138   1e-40
CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   137   2e-40
AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   135   2e-39

>Scas_687.17
          Length = 222

 Score =  349 bits (896), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/222 (80%), Positives = 178/222 (80%)

Query: 1   MATSSDSNTAAVTGDPASRRPIEPKTPFIYKLYQYYQLSTSXXXXXXXXRWLIIFPLAGA 60
           MATSSDSNTAAVTGDPASRRPIEPKTPFIYKLYQYYQLSTS        RWLIIFPLAGA
Sbjct: 1   MATSSDSNTAAVTGDPASRRPIEPKTPFIYKLYQYYQLSTSFLFAALLARWLIIFPLAGA 60

Query: 61  RFLPGGVHEFLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDY 120
           RFLPGGVHEFLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDY
Sbjct: 61  RFLPGGVHEFLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDY 120

Query: 121 EHALVLKNISYSVFIIGLSLNQAYHHWCKLFKRSGRKKNTLVFKVXXXXXXXXXXXXXXX 180
           EHALVLKNISYSVFIIGLSLNQAYHHWCKLFKRSGRKKNTLVFKV               
Sbjct: 121 EHALVLKNISYSVFIIGLSLNQAYHHWCKLFKRSGRKKNTLVFKVNNLLGSPLLYLSEYY 180

Query: 181 XXXXXVQNPNFHSTPXXXXXXXXXXXXXXXXALAVYRNQAYK 222
                VQNPNFHSTP                ALAVYRNQAYK
Sbjct: 181 LLLLNVQNPNFHSTPLLDIINRIILIIYFPIALAVYRNQAYK 222

>Kwal_47.19203
          Length = 235

 Score =  184 bits (466), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 1/174 (0%)

Query: 21  PIEPKTPFI-YKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHEFLCYLMIYAS 79
           P  P T  +  +LYQY++LS+S        RW ++FPL G++FLPGG+HEFLCYLM+YA 
Sbjct: 32  PANPGTSALKSRLYQYFRLSSSLLFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAG 91

Query: 80  VGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLS 139
             EI+W + F   K  + S+TLLKD++F+Y+V +LHFYDDYEHALVLKNISYS FI+ L 
Sbjct: 92  FFEIVWTYAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLG 151

Query: 140 LNQAYHHWCKLFKRSGRKKNTLVFKVXXXXXXXXXXXXXXXXXXXXVQNPNFHS 193
           L+Q Y HWCKLFK   + +NT+++K+                    VQ PNFHS
Sbjct: 152 LSQTYCHWCKLFKSPSKNRNTILWKIDTFLTLPILYLSEFYLLLLNVQTPNFHS 205

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  182 bits (462), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 96/166 (57%), Positives = 115/166 (69%)

Query: 30  YKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHEFLCYLMIYASVGEIIWLFKF 89
           +KLYQYYQL+TS        RWLI+ PL G+RFLPGG+HEFL YLM Y+S+ E+IWL +F
Sbjct: 8   HKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLLRF 67

Query: 90  YPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLSLNQAYHHWCK 149
           +  K  + S+T LKDLNFIY V V+HFYDDYEHAL+LKN SYS FII LSL+QAY HWCK
Sbjct: 68  HGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQAYCHWCK 127

Query: 150 LFKRSGRKKNTLVFKVXXXXXXXXXXXXXXXXXXXXVQNPNFHSTP 195
           LFKR G K+ TLV+KV                    +Q  N+HSTP
Sbjct: 128 LFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTP 173

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  174 bits (442), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 108/166 (65%)

Query: 29  IYKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHEFLCYLMIYASVGEIIWLFK 88
           + +LYQYY+LS S        RWL++ PL G +FLPGG+HE+LCYL++YAS GE+  LF 
Sbjct: 16  VSRLYQYYRLSASFLFAALLARWLVLLPLVGTKFLPGGIHEYLCYLILYASFGELFCLFG 75

Query: 89  FYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLSLNQAYHHWC 148
           F+ L   + S TLLK+LN +YFV V+HFYDDYEHA VLKN SYS FIIGLS  Q Y HW 
Sbjct: 76  FHGLFGALTSSTLLKNLNMLYFVAVMHFYDDYEHAPVLKNSSYSSFIIGLSFTQMYCHWK 135

Query: 149 KLFKRSGRKKNTLVFKVXXXXXXXXXXXXXXXXXXXXVQNPNFHST 194
           KLFK +  +KN++  KV                    VQNPNFHST
Sbjct: 136 KLFKHTHGRKNSIWRKVDTLAMMPLFYLSEFYLFLLNVQNPNFHST 181

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  138 bits (347), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 94/136 (69%), Gaps = 2/136 (1%)

Query: 17  ASRRPIEPKTPFIYKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHEFLCYLMI 76
           A+RR  +P+   + KLYQ++ +S++        RWL++ PL   ++LPGG+H FLC LM+
Sbjct: 3   ATRRQ-QPRR-LVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRKYLPGGIHRFLCCLMV 60

Query: 77  YASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFII 136
           Y++VG I+W  K   L   IF++  LK++N IY V +LHFYDD+EH+ +LKN SYS FI+
Sbjct: 61  YSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIV 120

Query: 137 GLSLNQAYHHWCKLFK 152
           GLS  Q Y+HW ++FK
Sbjct: 121 GLSFTQMYYHWNRIFK 136

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  137 bits (344), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 109/193 (56%), Gaps = 2/193 (1%)

Query: 28  FIYKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHEFLCYLMIYASVGEIIWLF 87
           F +KL+Q YQL T+        RWL++ PL G+R+LPGG+HE+LCYL++  SV E++W  
Sbjct: 2   FTHKLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSL 61

Query: 88  KFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLSLNQAYHHW 147
            F+ L+  I S+ +LK LN++Y VL LHFYDDYEHA +LK  +YS FIIG+SL ++Y HW
Sbjct: 62  YFHGLRGFI-SQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHW 120

Query: 148 CKLFKRS-GRKKNTLVFKVXXXXXXXXXXXXXXXXXXXXVQNPNFHSTPXXXXXXXXXXX 206
           C+LFKR    K+ T  +K                      Q PN H+T            
Sbjct: 121 CRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLI 180

Query: 207 XXXXXALAVYRNQ 219
                AL VY+  
Sbjct: 181 LYFPMALTVYKRH 193

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  135 bits (339), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 110/216 (50%), Gaps = 15/216 (6%)

Query: 10  AAVTGDPASRRPIEPKTPFIYKLYQYYQLSTSXXXXXXXXRWLIIFPLAGARFLPGGVHE 69
           A + G P   +P       + + YQ+Y+LS          RWL +FPL G R++PGG+H 
Sbjct: 2   ADLQGIPG--KPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHG 59

Query: 70  FLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNI 129
           FL YL+  ++V E++W+  FY     ++++TLLK  N +YFV V+HFYDDYEHA VLKNI
Sbjct: 60  FLIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNI 119

Query: 130 SYSVFIIGLSLNQAYHH------WCKLFKRSGRKKNTLVFKVXXXXXXXXXXXXXXXXXX 183
            YS+FI+ + +NQA HH        +  +    + +T V +                   
Sbjct: 120 GYSIFILSIGMNQALHHGGRLFRGRRRRRSWWWRSDTFVLQ-------PALYISQFYLLL 172

Query: 184 XXVQNPNFHSTPXXXXXXXXXXXXXXXXALAVYRNQ 219
             VQNP+FHSTP                AL  +R Q
Sbjct: 173 LNVQNPSFHSTPKLDIINRTVLVAYVPLALQCFRRQ 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,849,998
Number of extensions: 213847
Number of successful extensions: 595
Number of sequences better than 10.0: 8
Number of HSP's gapped: 588
Number of HSP's successfully gapped: 8
Length of query: 222
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 124
Effective length of database: 13,203,545
Effective search space: 1637239580
Effective search space used: 1637239580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)