Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.2241641621560.0
CAGL0K06831g35836216830.0
KLLA0F09603g35434216780.0
YBR221C (PDB1)36636716760.0
Sklu_2171.436234716660.0
AAR167C35936116650.0
Kwal_14.178936333516450.0
Sklu_2101.356869740.44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.22
         (416 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.22                                                           835   0.0  
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   652   0.0  
KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   650   0.0  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   650   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           646   0.0  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   645   0.0  
Kwal_14.1789                                                          638   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            33   0.44 

>Scas_686.22
          Length = 416

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/416 (97%), Positives = 407/416 (97%)

Query: 1   MAHYMYLFTLPVNKRGPCNIKAMNSHXXXXXXXXXHIKVKTAADPIAPVHKSKQLKMSFR 60
           MAHYMYLFTLPVNKRGPCNIKAMNSH         HIKVKTAADPIAPVHKSKQLKMSFR
Sbjct: 1   MAHYMYLFTLPVNKRGPCNIKAMNSHRYNRRNNNRHIKVKTAADPIAPVHKSKQLKMSFR 60

Query: 61  LPFTNVTRRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYN 120
           LPFTNVTRRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYN
Sbjct: 61  LPFTNVTRRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYN 120

Query: 121 GAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVV 180
           GAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVV
Sbjct: 121 GAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVV 180

Query: 181 NSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDAR 240
           NSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDAR
Sbjct: 181 NSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDAR 240

Query: 241 GLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRN 300
           GLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRN
Sbjct: 241 GLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRN 300

Query: 301 VQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAE 360
           VQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAE
Sbjct: 301 VQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAE 360

Query: 361 IIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE 416
           IIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE
Sbjct: 361 IIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE 416

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/362 (88%), Positives = 337/362 (93%), Gaps = 7/362 (1%)

Query: 57  MSFRLPFTNVT--RRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGE 114
           + FR P T +T   R+A+ S     A+R AS+KTMTVREALN+A+AEELDRDDDVFIIGE
Sbjct: 2   LQFRTPLTRLTPMARLATRS-----AVRMASTKTMTVREALNSALAEELDRDDDVFIIGE 56

Query: 115 EVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQ 174
           EVAQYNGAYKVTKGLLDRFGERRVVDTPITE GF GLAVGAALKGLKPIVEFMSFNFSMQ
Sbjct: 57  EVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQ 116

Query: 175 AIDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY 234
           AID VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY
Sbjct: 117 AIDHVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPY 176

Query: 235 SAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISI 294
           SAEDARGLLKAAIRDPNPVVFLENELLYGE FE+S+EALSPDFTLPY AKVE+EG DISI
Sbjct: 177 SAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISI 236

Query: 295 ITYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPS 354
           ITYTRN +FSL AA ILE++YGVS EVINLRSIRPLD+DAIVKTVKKTNHLITVESTFPS
Sbjct: 237 ITYTRNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPS 296

Query: 355 FGVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLS 414
           FGVGAEIIA+VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDP+TIVRA KEVLS
Sbjct: 297 FGVGAEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAKEVLS 356

Query: 415 IE 416
           IE
Sbjct: 357 IE 358

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 332/342 (97%)

Query: 75  PLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG 134
           P   Q++R+AS+KTMTVREALN+AMAEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG
Sbjct: 13  PSVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG 72

Query: 135 ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTHYMSGGTQ 194
           ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQA+DQV+NSAAKT+YMSGGTQ
Sbjct: 73  ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSAAKTYYMSGGTQ 132

Query: 195 KCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVV 254
           KCQIVFRGPNGSAVGVAAQHSQDYSAWYGS+PG+KVLVPYSAEDARGLLKAAIRDPNPVV
Sbjct: 133 KCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLLKAAIRDPNPVV 192

Query: 255 FLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRNVQFSLEAAAILEKQ 314
           FLENELLYG+SFE+S+E+LS DFTLPYKAKVEREG+DISII+YTRNVQFSLEAA IL KQ
Sbjct: 193 FLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQFSLEAAEILSKQ 252

Query: 315 YGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAEIIARVMESEAFDYL 374
           YGVS EVINLR+IRPLDV+AI+ TVKKTNHLITVESTFP+FGVGAEIIA++MESEAFDYL
Sbjct: 253 YGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYL 312

Query: 375 DAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE 416
           DAPIQRVTGA+VPTPYAKELEDFAFPDPDTIVRA K VLSIE
Sbjct: 313 DAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAKSVLSIE 354

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/367 (86%), Positives = 341/367 (92%), Gaps = 8/367 (2%)

Query: 57  MSFRLPFTNVTRRIASSSPLRF-------QALRYASSKTMTVREALNTAMAEELDRDDDV 109
           M  RLP T++ R +A  +P  F        ALR++S+KTMTVREALN+AMAEELDRDDDV
Sbjct: 1   MFSRLP-TSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDV 59

Query: 110 FIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSF 169
           F+IGEEVAQYNGAYKV+KGLLDRFGERRVVDTPITE GFTGLAVGAALKGLKPIVEFMSF
Sbjct: 60  FLIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSF 119

Query: 170 NFSMQAIDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLK 229
           NFSMQAID VVNSAAKTHYMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGSIPGLK
Sbjct: 120 NFSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLK 179

Query: 230 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREG 289
           VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEIS+EALSP+FTLPYKAK+EREG
Sbjct: 180 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREG 239

Query: 290 TDISIITYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVE 349
           TDISI+TYTRNVQFSLEAA IL+K+YGVS EVINLRSIRPLD +AI+KTVKKTNHLITVE
Sbjct: 240 TDISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVE 299

Query: 350 STFPSFGVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAV 409
           STFPSFGVGAEI+A+VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPD  TIV+AV
Sbjct: 300 STFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAV 359

Query: 410 KEVLSIE 416
           KEVLSIE
Sbjct: 360 KEVLSIE 366

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/347 (88%), Positives = 333/347 (95%), Gaps = 2/347 (0%)

Query: 72  SSSPLRFQALRYASSKT--MTVREALNTAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGL 129
           +++P R  A R AS+KT  MTVREALN+AMAEELDRDDDVFIIGEEVAQYNGAYKVTKGL
Sbjct: 16  AAAPFRLNATRMASTKTTKMTVREALNSAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGL 75

Query: 130 LDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTHYM 189
           LDR+GERRVVDTPITEMGFTGLAVGAALKGLKP+VEFMSFNFSMQAID VVNSAAKT+YM
Sbjct: 76  LDRYGERRVVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNFSMQAIDHVVNSAAKTYYM 135

Query: 190 SGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRD 249
           SGGTQKCQIVFRGPNG+AVGV AQHSQDY+AWYGSIPGLKVL PYSAEDARGLLKAAIRD
Sbjct: 136 SGGTQKCQIVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVLSPYSAEDARGLLKAAIRD 195

Query: 250 PNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRNVQFSLEAAA 309
           PNPVVFLENELLYGESF++S+E LS DFTLPY AKVEREG+DISI+TYTRNVQFSL+AA 
Sbjct: 196 PNPVVFLENELLYGESFDVSEEVLSTDFTLPYTAKVEREGSDISIVTYTRNVQFSLQAAE 255

Query: 310 ILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAEIIARVMESE 369
           ILEKQ+GVSVEV+NLRSIRPLDVDAI+KTVKKTNHLITVESTFP+FGVG+EIIA++MESE
Sbjct: 256 ILEKQHGVSVEVVNLRSIRPLDVDAIIKTVKKTNHLITVESTFPAFGVGSEIIAQIMESE 315

Query: 370 AFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE 416
           AFDYLDAP+QRVTGADVPTPYAKELEDFAFPDPDTIVRAVK+VLSIE
Sbjct: 316 AFDYLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKKVLSIE 362

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/361 (85%), Positives = 338/361 (93%), Gaps = 3/361 (0%)

Query: 57  MSFRLPF-TNVTRRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEE 115
           MS R    +N+TR ++S    R Q +R+ASSK+MTVR+ALN+AMAEE+DRDDDVFIIGEE
Sbjct: 1   MSSRFSLVSNLTRSLSSVG--RMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEE 58

Query: 116 VAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQA 175
           VAQYNGAYKVTKGLLDRFGERRVVDTPITEMGF GLAVGAALKGLKPIVEFMSFNFSMQA
Sbjct: 59  VAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLKPIVEFMSFNFSMQA 118

Query: 176 IDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYS 235
           ID VVNSAAKT+YMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGSIPGLKVL PYS
Sbjct: 119 IDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYS 178

Query: 236 AEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISII 295
           AEDARGLLKAAIRDPNPVVFLENELLYGESFE+S+E LSPDFTLPY +KVEREGTDISII
Sbjct: 179 AEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISII 238

Query: 296 TYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSF 355
           TY+RNVQFSL AA IL+KQYGVS EVIN+RSIRPLD+DAI+KTVKKTNHLITVE+TFP+F
Sbjct: 239 TYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAF 298

Query: 356 GVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSI 415
           GVG+EIIA++MESEAFD+LDAP+QRVTGADVPTPYAKELEDFAFPDPDTIVRA K+VLSI
Sbjct: 299 GVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAAKQVLSI 358

Query: 416 E 416
           E
Sbjct: 359 E 359

>Kwal_14.1789
          Length = 363

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/335 (90%), Positives = 325/335 (97%)

Query: 82  RYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 141
           R AS+KTMTVR+ALN+AMAEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT
Sbjct: 29  RLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 88

Query: 142 PITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTHYMSGGTQKCQIVFR 201
           PITEMGFTGL+VGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKT+YMSGGTQKCQIVFR
Sbjct: 89  PITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFR 148

Query: 202 GPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 261
           GPNG+AVGV AQHSQD+SAWYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVFLENELL
Sbjct: 149 GPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 208

Query: 262 YGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRNVQFSLEAAAILEKQYGVSVEV 321
           YGESFE+S+E LS DFTLPY AKVEREGTDISIITYTRNVQFSL+AA IL+KQYGVS EV
Sbjct: 209 YGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEV 268

Query: 322 INLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAEIIARVMESEAFDYLDAPIQRV 381
           INLRSIRP+DV+AI+KTVKKTNHLITVESTFP+FGVG+EI+A++MESEAFDYLDAP++RV
Sbjct: 269 INLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRV 328

Query: 382 TGADVPTPYAKELEDFAFPDPDTIVRAVKEVLSIE 416
           TGADVPTPYAKELEDFAFPDPD IV AVK VLSIE
Sbjct: 329 TGADVPTPYAKELEDFAFPDPDVIVSAVKSVLSIE 363

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 230 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREG 289
           +L+P+ +ED++G+L   I D   + F+E E ++   F+       PD  LP    +    
Sbjct: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245

Query: 290 TDISIITYT 298
           T+I+ + Y 
Sbjct: 246 TEITFLNYN 254

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,170,381
Number of extensions: 486451
Number of successful extensions: 1202
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1217
Number of HSP's successfully gapped: 11
Length of query: 416
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 312
Effective length of database: 12,995,837
Effective search space: 4054701144
Effective search space used: 4054701144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)