Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.2159659631080.0
YBR220C56057419900.0
CAGL0K06809g56757218720.0
Kwal_14.179354756616610.0
AAR166C58558515220.0
KLLA0F09581g51756413401e-180
Sklu_1471.22983028631e-112
YBR219C1271003392e-37
Sklu_1996.212088740.19
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.21
         (596 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.21                                                          1201   0.0  
YBR220C (YBR220C) [401] chr2 complement(662952..664634) Protein ...   771   0.0  
CAGL0K06809g complement(663435..665138) highly similar to sp|P38...   725   0.0  
Kwal_14.1793                                                          644   0.0  
AAR166C [354] [Homologous to ScYBR220C - SH] (640457..642214) [1...   590   0.0  
KLLA0F09581g complement(879983..881536) similar to sp|P38318 Sac...   520   e-180
Sklu_1471.2 YBR220C, Contig c1471 1586-2478 reverse complement        337   e-112
YBR219C (YBR219C) [400] chr2 complement(662456..662538,662960..6...   135   2e-37
Sklu_1996.2 , Contig c1996 5033-5395                                   33   0.19 

>Scas_686.21
          Length = 596

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/596 (98%), Positives = 585/596 (98%)

Query: 1   MTVDEQWKMLPIHPPRAGNTAMEPRSNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAF 60
           MTVDEQWKMLPIHPPRAGNTAMEPRSNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAF
Sbjct: 1   MTVDEQWKMLPIHPPRAGNTAMEPRSNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAF 60

Query: 61  GTIPFLLKSMAKETSFASLGVFSIATYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLT 120
           GTIPFLLKSMAKETSFASLGVFSIATYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLT
Sbjct: 61  GTIPFLLKSMAKETSFASLGVFSIATYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLT 120

Query: 121 SGIMLYTLGLCISKGYIFQGVDAAFHSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAV 180
           SGIMLYTLGLCISKGYIFQGVDAAFHSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAV
Sbjct: 121 SGIMLYTLGLCISKGYIFQGVDAAFHSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAV 180

Query: 181 DGWALTILSTQSLSYASTAQTVGLNMGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSL 240
           DGWALTILSTQSLSYASTAQTVGLNMGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSL
Sbjct: 181 DGWALTILSTQSLSYASTAQTVGLNMGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSL 240

Query: 241 GGYMKFSGLVYILVTIYVVFATRENPFNSNRNILPSFDKEHEKKQEMIIVEHXXXXXXXX 300
           GGYMKFSGLVYILVTIYVVFATRENPFNSNRNILPSFDKEHEKKQEMIIVEH        
Sbjct: 241 GGYMKFSGLVYILVTIYVVFATRENPFNSNRNILPSFDKEHEKKQEMIIVEHGGGGDDDY 300

Query: 301 XXXKTRNIMYIYRCFIKVLQLKTVRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLA 360
              KTRNIMYIYRCFIKVLQLKTVRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLA
Sbjct: 301 DNDKTRNIMYIYRCFIKVLQLKTVRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLA 360

Query: 361 VTVLIDVPFEIIFGYYVAKWSSDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAG 420
           VTVLIDVPFEIIFGYYVAKWSSDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAG
Sbjct: 361 VTVLIDVPFEIIFGYYVAKWSSDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAG 420

Query: 421 VLTPWLWGFLGRLLSATLGSYVVHQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISS 480
           VLTPWLWGFLGRLLSATLGSYVVHQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISS
Sbjct: 421 VLTPWLWGFLGRLLSATLGSYVVHQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISS 480

Query: 481 FHTRIADPILGGTYMTLLNTLSNFGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGN 540
           FHTRIADPILGGTYMTLLNTLSNFGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGN
Sbjct: 481 FHTRIADPILGGTYMTLLNTLSNFGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGN 540

Query: 541 MDVCTKGLNGEVIILRDGYYLTNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWRCK 596
           MDVCTKGLNGEVIILRDGYYLTNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWRCK
Sbjct: 541 MDVCTKGLNGEVIILRDGYYLTNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWRCK 596

>YBR220C (YBR220C) [401] chr2 complement(662952..664634) Protein
           with similarity to human acetyl coenzyme A transporter,
           E. coli ampG protein, and other acetyl-CoA transporter
           proteins [1683 bp, 560 aa]
          Length = 560

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/574 (65%), Positives = 455/574 (79%), Gaps = 15/574 (2%)

Query: 22  MEPRSNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGV 81
           MEP+  S    S+AKHDLPQF+LLI LY  QG+PVGLAFGT+PFLLKS+AKETSF SLG+
Sbjct: 1   MEPKRKSG---SLAKHDLPQFYLLIMLYLAQGIPVGLAFGTVPFLLKSLAKETSFTSLGI 57

Query: 82  FSIATYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGV 141
           FS+ATYPYSLKI+WSPIVDS Y+K+IGRRRSWIIP+Q  SG +L+ LG CIS+G IF GV
Sbjct: 58  FSMATYPYSLKIIWSPIVDSLYNKRIGRRRSWIIPVQFVSGFVLWALGWCISQGIIFDGV 117

Query: 142 DAAFHSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQT 201
           D AFH+   +  +H+V+I  L W+FG LVFLCATQDIAVDGWALTILS +SLSYASTAQT
Sbjct: 118 DDAFHN-RGNGTLHSVSIKNLTWWFGLLVFLCATQDIAVDGWALTILSKESLSYASTAQT 176

Query: 202 VGLNMGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFA 261
           +GLN+GYF+SFT+FLSLNS++F NKYFR IP ++G++SLGGYMKFSG++YI++TIY++F 
Sbjct: 177 IGLNIGYFMSFTIFLSLNSSDFANKYFRNIPLDHGFISLGGYMKFSGMLYIVITIYIIFC 236

Query: 262 TRENPFNSNRNILPSFDKEHEKKQEMIIVEHXXXXXXXXXXXKTRNIMYIYRCFIKVLQL 321
           T+E P+      LP  +  +        +              T +I YIYRCFIKVL+L
Sbjct: 237 TKEKPY---VEYLPKVEPINTSDGGSKPISIEYDDGDVVSTQNTSSIKYIYRCFIKVLKL 293

Query: 322 KTVRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLAVTVLIDVPFEIIFGYYVAKWS 381
           K+VR+LAFIH+ISK AFQCNE ATNLKLLE+GFKREDLAVTVLID+PFEIIFGYYV KWS
Sbjct: 294 KSVRSLAFIHMISKFAFQCNEAATNLKLLEQGFKREDLAVTVLIDLPFEIIFGYYVVKWS 353

Query: 382 SDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAGVLTPWLWGFLGRLLSATLGSY 441
           SD +   M   NR      R  ++T +NK+I+ LVGDAGVLTPWLWGFLGRL +A LGSY
Sbjct: 354 SDKD--PMIRDNR------RLRNSTGTNKVIKFLVGDAGVLTPWLWGFLGRLAAAVLGSY 405

Query: 442 VVHQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISSFHTRIADPILGGTYMTLLNTL 501
           VV QFP+DG+++ GYF LVI QHLLGSFM TVQF+GIS+FHTR+ADP+LGGTYMTLLNTL
Sbjct: 406 VVKQFPKDGEISTGYFCLVIFQHLLGSFMNTVQFIGISAFHTRVADPVLGGTYMTLLNTL 465

Query: 502 SNFGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGNMDVCTKGLNGEVIILRDGYYL 561
           SNFGGTWPR+ +M +INY T+Y+C  P T K  +  GG+M  CT+ LNG V ILRDGYY+
Sbjct: 466 SNFGGTWPRLIIMSMINYFTVYQCTIPGTNKVYVTHGGSMQACTELLNGTVTILRDGYYI 525

Query: 562 TNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWRC 595
           TN IC+ +GL LY  YLK+K   LQSLP+++WRC
Sbjct: 526 TNLICIVVGLFLYFGYLKRKILHLQSLPISSWRC 559

>CAGL0K06809g complement(663435..665138) highly similar to sp|P38318
           Saccharomyces cerevisiae YBR220c, hypothetical start
          Length = 567

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/572 (61%), Positives = 437/572 (76%), Gaps = 19/572 (3%)

Query: 32  KSIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGVFSIATYPYSL 91
           K++AK D+PQF+LLI LYF+QG+PVGLAFGT+PFLLKSMAKET+F  LG+FS+ATYPYSL
Sbjct: 6   KTLAKRDIPQFYLLICLYFLQGIPVGLAFGTVPFLLKSMAKETTFTQLGIFSMATYPYSL 65

Query: 92  KILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGVDAAFHSGESS 151
           KILWSP+VDS Y KKIGRRRSWIIPIQL SG+ML+ LG CIS+G +F GVD AFH G +S
Sbjct: 66  KILWSPLVDSVYFKKIGRRRSWIIPIQLVSGVMLFFLGTCISRGKVFNGVDDAFH-GRNS 124

Query: 152 EKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQTVGLNMGYFLS 211
             +HNVN+  L W FG+LVFLCATQDIAVDGWALTILS  S+SY+STAQT+GLNMGYFLS
Sbjct: 125 GGLHNVNVPFLTWCFGTLVFLCATQDIAVDGWALTILSRDSISYSSTAQTIGLNMGYFLS 184

Query: 212 FTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFATRENPFNSNR 271
           FTVF++LNS+EF NKY R +P  +G +SLGGYMK +G +Y+L+T+YV+F T+E P NS  
Sbjct: 185 FTVFIALNSSEFANKYVRNMPLPHGLISLGGYMKTAGALYVLLTLYVIFFTKEVP-NSVY 243

Query: 272 NILPSFDKEHEKKQEM--------IIVEHXXXXXXXXXXXKTRNIMYIYRCFIKVLQLKT 323
           + LP  DK  EK +E+         I               T +I Y+YR F+K+L+L++
Sbjct: 244 D-LPITDKVKEKDRELSADKALSPTITNIEYPDHVTIKTENTSSIAYVYRGFLKILKLRS 302

Query: 324 VRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLAVTVLIDVPFEIIFGYYVAKWSSD 383
           VRTLA IH++SK AFQCNE ATNLKLLEKGFKREDLAVTVLID PFEIIFGYYV KWSS 
Sbjct: 303 VRTLATIHMVSKFAFQCNEAATNLKLLEKGFKREDLAVTVLIDFPFEIIFGYYVVKWSSA 362

Query: 384 SEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAGVLTPWLWGFLGRLLSATLGSYVV 443
           +E  R    +R         +  ++N++++ LVGD G+LTPWLWGFLGRL +A  G+Y+V
Sbjct: 363 NEQKRKLNLSR--------GNHHKTNRIVKFLVGDGGLLTPWLWGFLGRLTAAMFGNYIV 414

Query: 444 HQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISSFHTRIADPILGGTYMTLLNTLSN 503
             FP+DGQ++ GYFLLVIIQHLLGSFM+TVQFV IS+FH++IADP+LGGTYMTLLNTLSN
Sbjct: 415 SMFPKDGQISTGYFLLVIIQHLLGSFMSTVQFVAISAFHSKIADPVLGGTYMTLLNTLSN 474

Query: 504 FGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGNMDVCTKGLNGEVIILRDGYYLTN 563
           FGGTWPR+ +M +INY T+Y C   +    I+  G N+  CT  L G   ++ DGYY+ N
Sbjct: 475 FGGTWPRLMIMSMINYFTVYSCTLENGSVAILNRGSNIQACTTALRGTAKVVTDGYYIAN 534

Query: 564 AICVSIGLCLYVFYLKKKAHQLQSLPVTAWRC 595
             C+ IG  LY  ++KKK   LQ+LP+ +WRC
Sbjct: 535 MFCIIIGTLLYFMFIKKKMLFLQTLPIGSWRC 566

>Kwal_14.1793
          Length = 547

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/566 (57%), Positives = 410/566 (72%), Gaps = 27/566 (4%)

Query: 32  KSIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGVFSIATYPYSL 91
           + +AKHD     LLIALYF+QG+PVGLAFGTIPFLLKS  K+T+F  LG F++ATYPYSL
Sbjct: 6   RQLAKHDYKPLALLIALYFLQGIPVGLAFGTIPFLLKSTVKDTTFTQLGFFAMATYPYSL 65

Query: 92  KILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGVDAAFHSGES- 150
           KILWSPIVDS Y+KK GRRRSWIIPIQ  SG++L+ LGLC+S   +F G+D A+ +G   
Sbjct: 66  KILWSPIVDSIYNKKTGRRRSWIIPIQFASGVILWILGLCVSHNLVFAGIDDAYKTGVPV 125

Query: 151 -SEKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQTVGLNMGYF 209
                 ++NI TL   F  LVFLCATQDIAVDGWAL ILS  SLSYASTAQTVGLN GYF
Sbjct: 126 VPHDPSSLNITTLTACFLLLVFLCATQDIAVDGWALEILSKDSLSYASTAQTVGLNTGYF 185

Query: 210 LSFTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFATRENPFNS 269
           LSFTVFL+ NS++F+NKY R +PQ +G +SLGGY+KF+G VY+LVT+YV + T E P+ +
Sbjct: 186 LSFTVFLTFNSSDFMNKYIRNVPQEHGLISLGGYLKFAGTVYLLVTLYVAYFTTERPYET 245

Query: 270 NRNILPSFDKEHEKKQEMIIVEHXXXXXXXXXXXKTRNIMYIYRCFIKVLQLKTVRTLAF 329
              +LP+  K+ ++K     + H            T ++  +Y  F++VL+L  V++L  
Sbjct: 246 AI-VLPTTTKKSDEK-----LSHEALYDPDISAAST-SLKSVYSSFLRVLKLPNVQSLMA 298

Query: 330 IHLISKIAFQCNEGATNLKLLEKGFKREDLAVTVLIDVPFEIIFGYYVAKWSSDSEMGRM 389
           IHLISK AFQCNEGATNLKLLE+GFKREDLAVTVL+D PFEIIFGYYVAKWSSD+     
Sbjct: 299 IHLISKFAFQCNEGATNLKLLERGFKREDLAVTVLVDFPFEIIFGYYVAKWSSDANF--- 355

Query: 390 ETSNRYPNGMRRSSSATRSNKLIRALVGDAGVLTPWLWGFLGRLLSATLGSYVVHQFPQD 449
                       S + TRS+  +++LVGDAG+LTPWLWGFLGRLL+A +   +V +FP+D
Sbjct: 356 -----------NSEAVTRSSFFVKSLVGDAGILTPWLWGFLGRLLAALMAGVLVARFPKD 404

Query: 450 GQMTRGYFLLVIIQHLLGSFMATVQFVGISSFHTRIADPILGGTYMTLLNTLSNFGGTWP 509
           G++T  YF+LVI+QHLLGSFM+TVQFVGI++FHTRIADP +GGTYMTLLNTLSN GGTWP
Sbjct: 405 GEITTTYFILVILQHLLGSFMSTVQFVGITAFHTRIADPTIGGTYMTLLNTLSNLGGTWP 464

Query: 510 RIFVMWLINYLTIYECKTPDTEKNIIFSGGNMDVCTKGLNGEVIILRDGYYLTNAICVSI 569
           RI VM +I+  + YEC +   +      G       +  +GE  I++DGY++TN  C+  
Sbjct: 465 RILVMAMIDRFSEYECSSYGNK----LPGIKSIAGCQAASGEWNIIKDGYFITNYFCIIA 520

Query: 570 GLCLYVFYLKKKAHQLQSLPVTAWRC 595
           G  LY  Y+K  A +LQ +P ++W+C
Sbjct: 521 GCLLYFGYIKNCAQRLQRVPKSSWQC 546

>AAR166C [354] [Homologous to ScYBR220C - SH] (640457..642214) [1758
           bp, 585 aa]
          Length = 585

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/585 (52%), Positives = 415/585 (70%), Gaps = 41/585 (7%)

Query: 22  MEPRSNSNRDKS---IAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFAS 78
           M P  N    K+   +A HD+PQF+LL+ALYF+QG+PVGLAFGT+PFLLKS+AK+TSF  
Sbjct: 29  MTPGGNMEVHKASSQLAAHDVPQFYLLVALYFLQGIPVGLAFGTVPFLLKSIAKDTSFTK 88

Query: 79  LGVFSIATYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIF 138
           L +F IATYPYSLKI WSP+VDSF+SKKIGRRRSWIIP+QL SG+ML+ +G  +++G++F
Sbjct: 89  LRLFGIATYPYSLKIHWSPLVDSFFSKKIGRRRSWIIPVQLASGVMLWCVGHAVAQGWVF 148

Query: 139 QGVDAAFHSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYAST 198
           +GVDA++ +    +    +NI +L   F  LVF CATQDIAVDGWALTILS QSLSYAST
Sbjct: 149 EGVDASYGAPSLGDGA-KINITSLTVCFLVLVFFCATQDIAVDGWALTILSRQSLSYAST 207

Query: 199 AQTVGLNMGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYV 258
           AQTVGLN GYFLSF++FL+ NS +F+N+YFR +P ++G +S   Y+K SG +Y+++T YV
Sbjct: 208 AQTVGLNTGYFLSFSIFLAFNSGDFVNRYFRALPLDHGIISFSSYLKLSGWMYLILTAYV 267

Query: 259 VFATRENPF-NSNRNILPSFDKEHEKKQEMIIV---EHXXXXXXXXXXXKTRNIMYIYRC 314
           VF T+E P+ +S   ++ +  K+ ++K  ++                     ++  +YR 
Sbjct: 268 VFFTQEYPYAHSGLPVVSTKPKDDDEKGHIVTSTTKNSAHIEYNEDSSISKTSLGAVYRS 327

Query: 315 FIKVLQLKTVRTLAFIHLISKIAFQCNEGATNLKLLEKGFKREDLAVTVLIDVPFEIIFG 374
           F+KVL+L  VR+L  +H +SK  FQC+EGATNLKLLEKG K+EDLA+TVL+D PFEIIFG
Sbjct: 328 FVKVLRLPAVRSLIILHFVSKFPFQCSEGATNLKLLEKGLKKEDLAITVLVDFPFEIIFG 387

Query: 375 YYVAKWSSDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAGVLTPWLWGFLGRLL 434
           YYVAKWSS+S                  S   +    +  L+G  G+LTPW+ G++GRL+
Sbjct: 388 YYVAKWSSESH----------------HSHQRKLPAFLTLLIGQPGILTPWIIGYIGRLI 431

Query: 435 SATLGSYVVHQFPQDGQMTRGYFLLVIIQHLLGSFMATVQFVGISSFHTRIADPILGGTY 494
           ++ LGS+++ QFP++G +T+GYFLLV+ Q+LLGSFM+TVQFVG+S+FHTRIADP +GGTY
Sbjct: 432 ASMLGSFILSQFPENGNITKGYFLLVVTQNLLGSFMSTVQFVGVSAFHTRIADPAIGGTY 491

Query: 495 MTLLNTLSNFGGTWPRIFVMWLINYLTIYECKTP-----DTEKNIIFSGGNMDVCTKGLN 549
           MTLLNTLSN GGTW RI VM +I++ T   C+         E   + SGG +        
Sbjct: 492 MTLLNTLSNLGGTWSRIVVMAMIDFFTSKVCQNSAIGMFPPEAKCLESGGTL-------- 543

Query: 550 GEVIILRDGYYLTNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWR 594
              +ILRDGYY+TN +C+  GL ++  ++++KA  LQSLP+++WR
Sbjct: 544 ---VILRDGYYMTNLLCIGFGLLIFP-HIRRKAQHLQSLPISSWR 584

>KLLA0F09581g complement(879983..881536) similar to sp|P38318
           Saccharomyces cerevisiae YBR220c singleton, hypothetical
           start
          Length = 517

 Score =  520 bits (1340), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 276/564 (48%), Positives = 379/564 (67%), Gaps = 53/564 (9%)

Query: 33  SIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGVFSIATYPYSLK 92
           ++  HD  QF+LL+ LY +QG+PVGL FGTIPF+LKS  ++TSF ++G+FS+ATYPYS K
Sbjct: 2   ALPPHDRKQFYLLVVLYLLQGIPVGLTFGTIPFILKSSQRQTSFVTIGLFSMATYPYSFK 61

Query: 93  ILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGVDAAFHSGESSE 152
           ILWSPIVDS+YS+K+GRRRSWIIP+Q  +GI L TLG CISK  I              +
Sbjct: 62  ILWSPIVDSWYSQKVGRRRSWIIPVQFVTGITLLTLGYCISKDKIL------------PK 109

Query: 153 KIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQTVGLNMGYFLSF 212
            +  V++  L   F  LV LC+TQDIAVDGWAL ILS +SLSYASTAQT+GLN+GYF+SF
Sbjct: 110 DVSKVDMKALTSVFLFLVILCSTQDIAVDGWALNILSKESLSYASTAQTIGLNIGYFMSF 169

Query: 213 TVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFATRENPFNSNRN 272
           T+FLSL+S+EF+ KYF +         L  Y+ F+GL+Y+ VT YV   T E       +
Sbjct: 170 TIFLSLSSDEFMQKYFHR----DRLFQLSSYLTFTGLLYLAVTFYVSLFTSEKVHVETHS 225

Query: 273 ILPSFDKEHEKKQEMIIVEHXXXXXXXXXXXKTRNIMYIYRCFIKVLQLKTVRTLAFIHL 332
            +   D E        ++E+           ++ +++ IYR FIKV++L +V+TLA +HL
Sbjct: 226 HIKKDDDEK-------MIEY---QPDEEEDNESHDLINIYRLFIKVMKLPSVQTLAIVHL 275

Query: 333 ISKIAFQCNEGATNLKLLEKGFKREDLAVTVLIDVPFEIIFGYYVAKWSSDSEMGRMETS 392
           ISK AFQCN+ ATNLKLLEKG KREDLA+TVLI+ PFE++FG+YVA+ S           
Sbjct: 276 ISKFAFQCNDAATNLKLLEKGLKREDLAITVLINFPFELLFGFYVARLS----------- 324

Query: 393 NRYPNGMRRSSSATRSNKLIRALVGDAGVLTPWLWGFLGRLLSATLGSYVVHQFPQD-GQ 451
                     +  + +NK+IRA+ GDA  LTPW+ GF+GRL +A LG+ VV+ FP+D  +
Sbjct: 325 ---------RAGYSFNNKIIRAVAGDARTLTPWIIGFIGRLSAAILGNVVVYLFPEDESE 375

Query: 452 MTRGYFLLVIIQHLLGSFMATVQFVGISSFHTRIADPILGGTYMTLLNTLSNFGGTWPRI 511
           ++  +FLLV+ QHLLGSFM+T QFV +S+FHT++ADP++GGTYMTLLNTLSN GGTWPR+
Sbjct: 376 ISMSFFLLVLCQHLLGSFMSTFQFVSMSAFHTQVADPVIGGTYMTLLNTLSNLGGTWPRL 435

Query: 512 FVMWLINYLTIYECK-TPDTEKNIIFSGGNMDVCTKGLNGEVIILRDGYYLTNAICVSIG 570
            +M +I++ + Y+C   P  +   +      + C   + G++  +RDGYY+TN  C+  G
Sbjct: 436 LIMSMIDFFSKYDCTGVPLIQGQSL----TKEQCV-SIGGQLNTIRDGYYITNLFCIVSG 490

Query: 571 LCLYVFYLKKKAHQLQSLPVTAWR 594
           L ++  YLK  A +L  +P+  W+
Sbjct: 491 LLIFTTYLKPTAIKLCKVPLDQWK 514

>Sklu_1471.2 YBR220C, Contig c1471 1586-2478 reverse complement
          Length = 298

 Score =  337 bits (863), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 172/302 (56%), Positives = 223/302 (73%), Gaps = 8/302 (2%)

Query: 26  SNSNRDKSIAKHDLPQFFLLIALYFVQGVPVGLAFGTIPFLLKSMAKETSFASLGVFSIA 85
           SN    + +AKHD+PQF+LL+ LYF+QG+PVGLAFGT+PFLLKS+A  TSF  LG+FS+A
Sbjct: 3   SNYKPSQQLAKHDVPQFYLLVCLYFLQGIPVGLAFGTVPFLLKSVASTTSFTRLGLFSMA 62

Query: 86  TYPYSLKILWSPIVDSFYSKKIGRRRSWIIPIQLTSGIMLYTLGLCISKGYIFQGVDAAF 145
           TYPYSLKILWSPIVDSFY KK GRRRSWIIP+QL SGIML+ LG CI+   IF GVD A+
Sbjct: 63  TYPYSLKILWSPIVDSFYIKKTGRRRSWIIPVQLVSGIMLWALGWCINHNIIFAGVDDAY 122

Query: 146 HSGESSEKIHNVNILTLAWYFGSLVFLCATQDIAVDGWALTILSTQSLSYASTAQTVGLN 205
           +   ++    N+NI  L   F  L+FLCATQDIAVDGWALTILS +SLSYASTAQTVGLN
Sbjct: 123 YPHRATTSHANLNISALTLCFLLLIFLCATQDIAVDGWALTILSKRSLSYASTAQTVGLN 182

Query: 206 MGYFLSFTVFLSLNSNEFINKYFRKIPQNYGWVSLGGYMKFSGLVYILVTIYVVFATREN 265
            GYFLSFT+FL+ NS++F+N+Y R  P +YG +S GGY+K +G++YI+ TIYV++ T E+
Sbjct: 183 TGYFLSFTIFLTFNSSDFMNRYLRNEPLDYGLISFGGYLKLAGIIYIIATIYVIWYTTEH 242

Query: 266 PFNSNRNILPSFDKEHEKKQEMIIVEHXXXXXXXXXXXKTRNIMYIYRCFIKVLQLKTVR 325
           P  +NR +  S  K+ EK   +   E               +++++YR F K+L+L +V+
Sbjct: 243 PAANNRPLPLSMKKDDEKSTAIEYNED--------VTSGNTSLLHVYRSFFKILRLPSVK 294

Query: 326 TL 327
           +L
Sbjct: 295 SL 296

>YBR219C (YBR219C) [400] chr2
           complement(662456..662538,662960..663260) Protein of
           unknown function, has low similarity to a region of C.
           elegans T26C5.3, which is a member of the
           acetyl-coenzyme A transporter (AcCoAT) protein family
           [384 bp, 127 aa]
          Length = 127

 Score =  135 bits (339), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%)

Query: 495 MTLLNTLSNFGGTWPRIFVMWLINYLTIYECKTPDTEKNIIFSGGNMDVCTKGLNGEVII 554
           MTLLNTLSNFGGTWPR+ +M +INY T+Y+C  P T K  +  GG+M  CT+ LNG V I
Sbjct: 1   MTLLNTLSNFGGTWPRLIIMSMINYFTVYQCTIPGTNKVYVTHGGSMQACTELLNGTVTI 60

Query: 555 LRDGYYLTNAICVSIGLCLYVFYLKKKAHQLQSLPVTAWR 594
           LRDGYY+TN IC+ +GL LY  YLK+K   LQSLP+++WR
Sbjct: 61  LRDGYYITNLICIVVGLFLYFGYLKRKILHLQSLPISSWR 100

>Sklu_1996.2 , Contig c1996 5033-5395
          Length = 120

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 373 FGYYVAKWSSDSEMGRMETSNRYPNGMRRSSSATRSNKLIRALVGDAGVL--TPWLWGFL 430
           FGY   KWS  S+  + +    Y N  +     ++SN + R+L  D  V   +P+++G L
Sbjct: 29  FGY--KKWSDLSKNDKQKFITSYVNLYKEKHPCSKSNVMYRSLANDMDVYDDSPYVFGIL 86

Query: 431 -GRLLSATLGSYVVHQFPQDGQMTRGYF 457
              + + TLG    ++  + G M+   F
Sbjct: 87  YNEIRAVTLGESTDNKQGEGGPMSDPDF 114

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,704,904
Number of extensions: 783192
Number of successful extensions: 2335
Number of sequences better than 10.0: 10
Number of HSP's gapped: 2357
Number of HSP's successfully gapped: 10
Length of query: 596
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 489
Effective length of database: 12,891,983
Effective search space: 6304179687
Effective search space used: 6304179687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)