Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.2051551515710.0
YBR215W (HPC2)623753265e-32
KLLA0C05676g511683086e-30
Kwal_14.1817547643025e-29
AAR158W571682921e-27
CAGL0K06721g438492341e-20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.20
         (515 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.20                                                           609   0.0  
YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for ...   130   5e-32
KLLA0C05676g 506539..508074 weakly similar to sp|Q01448 Saccharo...   123   6e-30
Kwal_14.1817                                                          120   5e-29
AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH] complement(6...   117   1e-27
CAGL0K06721g 654788..656104 some similarities with sp|Q01448 Sac...    95   1e-20

>Scas_686.20
          Length = 515

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/515 (65%), Positives = 339/515 (65%)

Query: 1   MSSLKRSNEQSQEPQSPXXXXXXXXXXXXXXXXXXXXXXNATSISNAKKIPNIAEELAKN 60
           MSSLKRSNEQSQEPQSP                      NATSISNAKKIPNIAEELAKN
Sbjct: 1   MSSLKRSNEQSQEPQSPAKKVKSETSSSSTPAATSSVGSNATSISNAKKIPNIAEELAKN 60

Query: 61  RNFVKVQXXXXXXXXXXXXXXXXXTAATVIHNTVSSSSSLNQILNHSEVSIPEVEQKQTT 120
           RNFVKVQ                 TAATVIHNTVSSSSSLNQILNHSEVSIPEVEQKQTT
Sbjct: 61  RNFVKVQSPSLSPPLPFSSSVSSSTAATVIHNTVSSSSSLNQILNHSEVSIPEVEQKQTT 120

Query: 121 TATPAASITDSXXXXXXXXXXXXXXXXXXDGDASAIPKKKQTTTKPRAKKVKQENANTQK 180
           TATPAASITDS                  DGDASAIPKKKQTTTKPRAKKVKQENANTQK
Sbjct: 121 TATPAASITDSKPKPKPRAKPKPKPKPKADGDASAIPKKKQTTTKPRAKKVKQENANTQK 180

Query: 181 PGDSQLPKVILPTQKKQQASTPVIKKXXXXXXXXXXXRNSPVNIIPTITKKAPSLKRXXX 240
           PGDSQLPKVILPTQKKQQASTPVIKK           RNSPVNIIPTITKKAPSLKR   
Sbjct: 181 PGDSQLPKVILPTQKKQQASTPVIKKDEDDNNIIIANRNSPVNIIPTITKKAPSLKRSQS 240

Query: 241 XXXXXXXXXXXXXXAEKAKKSNSISAIPRQIXXXXXXXXQSXXXXXXXXXXXXXXXXXXX 300
                         AEKAKKSNSISAIPRQI        QS                   
Sbjct: 241 SLSSSTSNSTATPTAEKAKKSNSISAIPRQIKKKTPKKKQSETPAVTETTSTSTKPKLVA 300

Query: 301 XXXXXXXXXXXXXTDETANNDDEKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKK 360
                        TDETANNDDEKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKK
Sbjct: 301 PPPVEPPSLLKQPTDETANNDDEKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKK 360

Query: 361 VNSNDLQNLKKMKRNLFTQLXXXXXXXXXXXXSVTFXXXXXXXXXXXXXXXXXXXXXXXX 420
           VNSNDLQNLKKMKRNLFTQL            SVTF                        
Sbjct: 361 VNSNDLQNLKKMKRNLFTQLNTTNDDTKETKKSVTFEQGEDGEEGDDVIIIDEEEEEEEN 420

Query: 421 XXXXXXXXXXXXXXXHADTTTPKKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTK 480
                          HADTTTPKKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTK
Sbjct: 421 ENENDNENEIMDEEEHADTTTPKKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTK 480

Query: 481 EGFFVYFGPLIEKGQLASIEKVSSNTKRSSSVRNK 515
           EGFFVYFGPLIEKGQLASIEKVSSNTKRSSSVRNK
Sbjct: 481 EGFFVYFGPLIEKGQLASIEKVSSNTKRSSSVRNK 515

>YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for
           regulation of histone gene transcription throughout the
           cell cycle [1872 bp, 623 aa]
          Length = 623

 Score =  130 bits (326), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 1/75 (1%)

Query: 441 TPKKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIE 500
           +PKK+SHPMKGK++IGKYD+EDPFIDDSELLWEEQ+A+TK+GFFVYFGPLIEKG  AS+E
Sbjct: 550 SPKKKSHPMKGKNLIGKYDVEDPFIDDSELLWEEQRAATKDGFFVYFGPLIEKGHYASLE 609

Query: 501 KVSSNTKRSSSVRNK 515
           + +   KR   V+NK
Sbjct: 610 RANGTMKR-GGVKNK 623

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%)

Query: 323 EKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKKVNSNDLQNLKKMKRNLFTQL 380
           E ++++++PLY    N+YLDENG V+FN+  LI+E     S +L  LK  KRNL  QL
Sbjct: 447 EPSILIDVPLYQADTNDYLDENGQVIFNLSTLIKEKYHPKSKELAQLKDSKRNLLMQL 504

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/18 (88%), Positives = 18/18 (100%)

Query: 48 KKIPNIAEELAKNRNFVK 65
          +KIPNIAEELAKNRN+VK
Sbjct: 61 RKIPNIAEELAKNRNYVK 78

>KLLA0C05676g 506539..508074 weakly similar to sp|Q01448
           Saccharomyces cerevisiae YBR215w HPC2 cell cycle
           regulatory protein singleton, start by similarity
          Length = 511

 Score =  123 bits (308), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 50/68 (73%), Positives = 58/68 (85%)

Query: 443 KKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKV 502
           KKR HP+KGKS IGKYDIEDPFIDDSELLWEEQ+A+T++GFFVYFGPLIEKGQ AS ++V
Sbjct: 439 KKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRV 498

Query: 503 SSNTKRSS 510
               K+  
Sbjct: 499 DGTMKKGG 506

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 6/55 (10%)

Query: 326 VILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKKVNSNDLQNLKKMKRNLFTQL 380
           V+L+IPL+   +N+YLDENG VVFNV+ LIQE  K  S     L K KRNL   L
Sbjct: 334 VVLDIPLHDVSSNDYLDENGQVVFNVYNLIQE--KYGS----QLNKAKRNLMVDL 382

>Kwal_14.1817
          Length = 547

 Score =  120 bits (302), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (85%)

Query: 447 HPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKVSSNT 506
           HPMKG+S+IGKYD EDPFIDDSELLWEEQ+ +TK+GFFVYFGPLIEKGQ AS E+V+   
Sbjct: 479 HPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTM 538

Query: 507 KRSS 510
           KR  
Sbjct: 539 KRGG 542

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 9/68 (13%)

Query: 315 DETANNDD--EKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKKVNSNDLQNLKKM 372
           DET N DD  E  +++++PLY  ++N YLDENG VVFN +KL+       ++      K 
Sbjct: 371 DETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFYKLV-------NDKFGQPAKA 423

Query: 373 KRNLFTQL 380
           KRNL T+L
Sbjct: 424 KRNLITEL 431

>AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH]
           complement(628892..628910,628995..630691) [1716 bp, 571
           aa]
          Length = 571

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 1/68 (1%)

Query: 447 HPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKVSSNT 506
           +PMKGKS +GKYDIEDPFIDDSELLWEEQ+A+TK+GFFVYFGPLI+KGQ A+ E+V    
Sbjct: 503 NPMKGKSRVGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDGTM 562

Query: 507 KRSSSVRN 514
           K+   VRN
Sbjct: 563 KK-GGVRN 569

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 318 ANNDDEKAVILNIPLYSTQNNEYLDENGSVVFNVFKLIQE 357
           A  +D+  +++++PLY    N+YLDENG VVFN + L+ E
Sbjct: 400 AAEEDDPVIVVDVPLYQVDTNDYLDENGQVVFNFYNLVHE 439

>CAGL0K06721g 654788..656104 some similarities with sp|Q01448
           Saccharomyces cerevisiae YBR215w Histone promoter
           control 2 protein, hypothetical start
          Length = 438

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (91%)

Query: 444 KRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIE 492
           K+ HP KGK++IGKYDIEDPFIDDSEL WEE +A+T++GFFV+FGPL+E
Sbjct: 367 KKPHPSKGKNLIGKYDIEDPFIDDSELQWEEYRAATRDGFFVFFGPLVE 415

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 326 VILNIPLYSTQNNEYLDENGSVVFNVFKLIQE 357
           +I+++PL    +N YL E+  V+FN  KLI E
Sbjct: 273 IIIDVPLSLDDSNAYLSEDNQVIFNFQKLIDE 304

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 45 SNAKKIPNIAEELAKNRNFVK 65
          + AKKIPNIAEELA NR  V+
Sbjct: 38 TGAKKIPNIAEELAMNRQNVR 58

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.305    0.121    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,932,355
Number of extensions: 375156
Number of successful extensions: 969
Number of sequences better than 10.0: 9
Number of HSP's gapped: 962
Number of HSP's successfully gapped: 18
Length of query: 515
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 409
Effective length of database: 12,926,601
Effective search space: 5286979809
Effective search space used: 5286979809
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 64 (29.3 bits)