Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.1966366333670.0
YBR216C (YBP1)67467012441e-163
Scas_563.1066664511821e-153
YGL060W (YBP2)64165410171e-129
Kwal_14.18126846569891e-125
CAGL0K06743g6556739811e-124
KLLA0C05698g7026829241e-115
AAR159C6136386184e-71
CAGL0F06985g6304913751e-37
Scas_548.757355750.55
KLLA0F11319g84360711.8
Scas_594.4172292702.5
YDL190C (UFD2)961231684.8
Sklu_2422.1192056684.9
CAGL0C01859g33835675.0
ADL189W85540676.3
Scas_567.181029676.3
KLLA0F07689g61056659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.19
         (663 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.19                                                          1301   0.0  
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   483   e-163
Scas_563.10                                                           459   e-153
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   396   e-129
Kwal_14.1812                                                          385   e-125
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   382   e-124
KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...   360   e-115
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   242   4e-71
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   149   1e-37
Scas_548.7                                                             33   0.55 
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    32   1.8  
Scas_594.4                                                             32   2.5  
YDL190C (UFD2) [683] chr4 complement(118708..121593) Ubiquitin f...    31   4.8  
Sklu_2422.11 YDL239C, Contig c2422 22194-24956 reverse complement      31   4.9  
CAGL0C01859g complement(193730..194746) weakly similar to sp|P25...    30   5.0  
ADL189W [1552] [Homologous to ScYNL321W - SH] complement(364649....    30   6.3  
Scas_567.1                                                             30   6.3  
KLLA0F07689g 727832..729664 highly similar to sp|P31383 Saccharo...    30   9.0  

>Scas_686.19
          Length = 663

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/663 (95%), Positives = 635/663 (95%)

Query: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60
           MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP
Sbjct: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60

Query: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCX 120
           DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGC 
Sbjct: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCE 120

Query: 121 XXXXXXXXXXXXXXXMEQGDHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELI 180
                          MEQGDHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELI
Sbjct: 121 LLSNLSLENENIELEMEQGDHTNSKGQTHYSSAEIGKYHAERTPADFFVSVKMYILFELI 180

Query: 181 GTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPDTSLCV 240
           GTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPDTSLCV
Sbjct: 181 GTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPDTSLCV 240

Query: 241 IKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTL 300
           IKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTL
Sbjct: 241 IKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTL 300

Query: 301 AGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQ 360
           AGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQ
Sbjct: 301 AGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQ 360

Query: 361 TVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTT 420
           TVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTT
Sbjct: 361 TVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTT 420

Query: 421 PSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQP 480
           PSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQP
Sbjct: 421 PSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQP 480

Query: 481 NEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSCQD 540
           NEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSCQD
Sbjct: 481 NEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSCQD 540

Query: 541 LCANDNDEALSNSLAKLKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLALRAINSLEEEK 600
           LCANDNDEALSNSLAKLKINSKKNEGAG            RMNEIHHLALRAINSLEEEK
Sbjct: 541 LCANDNDEALSNSLAKLKINSKKNEGAGVESQVYVEVSEERMNEIHHLALRAINSLEEEK 600

Query: 601 TTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLKKQIKDANVKLYG 660
           TTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLKKQIKDANVKLYG
Sbjct: 601 TTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLKKQIKDANVKLYG 660

Query: 661 LIQ 663
           LIQ
Sbjct: 661 LIQ 663

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  483 bits (1244), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 251/670 (37%), Positives = 394/670 (58%), Gaps = 16/670 (2%)

Query: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60
           M  ++DI+ ++ +AF    +D + L  ++++Y +Q+N +G  ++K +F+  L  L++D+P
Sbjct: 1   MEPIDDILFEVTDAFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNP 60

Query: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCX 120
                I WD PK +LKFL+  NVDV  RLG ++I+  VMKCF  I+   EPK+CL+TG  
Sbjct: 61  STTGEIGWDLPKGLLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLE 120

Query: 121 XXXXXXXXXXXXXXXMEQGDHTNSKGQT---------HYSSAEIGKYHAERTPADFFVSV 171
                            + D  + K  T           +  +   Y   ++  +FF+ +
Sbjct: 121 LLSSLCSKDFSKSDQQNKEDFVDKKANTLPPEGVIENSSNRKDFPSYGESKSSNEFFLKL 180

Query: 172 KMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNY 231
           K YILFE IG +L+RI TL PSKYLG A S + +F+ ++ D   D   ++RR+++FCRNY
Sbjct: 181 KSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVYSHADTFEDALFLLRRVYTFCRNY 240

Query: 232 VPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFY 291
           +PPD    +  +   T+E   ++ E E   Q R+LR LCT G+ T +K +    DVKY+ 
Sbjct: 241 IPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRRLCTFGISTPIKTVTTNADVKYYC 300

Query: 292 FLSNTEFTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGS 351
            L+  +F L+ +Y +  E+  R++ +A S D+DI+ EF   +K    IYK +P++ S  +
Sbjct: 301 ALNQQKFELSAYYTEYLELFCRYYQMAFSLDVDIEGEFQNVIKECRIIYKSVPQEISAVN 360

Query: 352 EEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDA 411
           +EAK ++++ VYKLAY++E+Q+ AK KNV LD  G+++ SG++Y+ET++HL  ++ + DA
Sbjct: 361 DEAKLVLERMVYKLAYTFEVQKAAKEKNVGLDYNGVILFSGIHYLETNQHLVKEMNITDA 420

Query: 412 IYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQT 471
           IYLYLR TTPSL+SK Y N +VESV RYWLW +IT      ++KEL+ L  ++  T L  
Sbjct: 421 IYLYLRFTTPSLYSKVYYNVAVESVSRYWLWYAITTEPLEDVKKELKNLSVFVTKTLLHV 480

Query: 472 FLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDL 531
            L KNC Q N+++RM++FTL TR+LCLIPE V F+FIL+ L  S  P  K+SVL + KDL
Sbjct: 481 LLQKNCIQVNQQLRMITFTLLTRLLCLIPEKVAFEFILDVLKTSPLPLAKTSVLCVFKDL 540

Query: 532 MSKRRSCQDLCANDND-EALSNSLAKLKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLAL 590
             +R S +D   ND++ + +   L+KLK+N   N+               +M  +H   L
Sbjct: 541 SRRRISTKD---NDSETDLIVEKLSKLKVND-SNKAQQSNIRHYIQLDSSKMKAVHDCCL 596

Query: 591 RAINSLEEEKTTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLK-- 648
           + I         +++I+L+L YL  F  L   WD+ LL+ +  +I+  +++   + L   
Sbjct: 597 QTIQDSFTADAKKSDILLLLTYLNIFIVLKKTWDEDLLKIVCSKIDSNLKSVEPDKLPKY 656

Query: 649 KQIKDANVKL 658
           K+I D N  L
Sbjct: 657 KEIVDKNESL 666

>Scas_563.10
          Length = 666

 Score =  459 bits (1182), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/645 (39%), Positives = 376/645 (58%), Gaps = 19/645 (2%)

Query: 7   IIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARI 66
           I A L  AF+E  +D V+L  I++MY  +IN DG ID+K ++L  L  L+ D+P ++  I
Sbjct: 12  IYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREI 71

Query: 67  SWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCXXXXXXX 126
           SWD PK +L+FL+  N+DV KRL  S I+S VMKCFNEIA +  PKECLL  C       
Sbjct: 72  SWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECLLAACELLSELT 131

Query: 127 XX-XXXXXXXMEQGDHTNSKGQTHYSSAEIGKY-HAERTPADFFVSVKMYILFELIGTTL 184
                      E+G   N K     +  ++    + ER   +F  S+K+Y +F+L+ +TL
Sbjct: 132 VEPVMENETEEEEGGKDNKKTDGDETPTDLNSSDYIERDLTEFIPSLKVYAIFQLLNSTL 191

Query: 185 QRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNY--VPPDTSLCVIK 242
            RI TL PSK+L +A SA+++F+  N + I DV  ++RRI  FC NY    PD  L  I 
Sbjct: 192 GRIITLYPSKFLNMAISAIMKFMATNINDIADVTFLLRRIHEFCNNYDVHAPDRKL--ID 249

Query: 243 DRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTLAG 302
              L  E++ ++ + E   Q ++++ L    L  CLK      DVKYF  L++ +F  + 
Sbjct: 250 GSDLNDEEIKKLTDDEFDLQNKLIKELFCSALSICLKNQPTTFDVKYFESLTHQKFEESE 309

Query: 303 FYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQTV 362
            Y   + + +++  L   + IDIK+EFL+C++ S  IY+ LP D     E+ K  + Q +
Sbjct: 310 HY---AVIRTQYLGLVNKYKIDIKEEFLQCLQESRQIYESLPSDIDESDEKKKSALNQVI 366

Query: 363 YKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTTPS 422
           Y+L+Y Y++Q+I+    +++D   I++LSG YY ET  HL PQI+++DA+YLYLRC+T S
Sbjct: 367 YQLSYRYQMQKISNQDTLEIDFNSIILLSGSYYAETGLHLLPQISIQDAVYLYLRCSTIS 426

Query: 423 LFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNE 482
           L+S  + N +V+ V RYWLWV+IT      + + L ++PS+  T FLQ  L  NC + + 
Sbjct: 427 LYSDTFSNEAVKGVTRYWLWVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDG 486

Query: 483 EIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRRSCQDLC 542
           +IRM +FTL TRILCL+PE ++F+FIL+TL    Y   KSSVL ILKDLM K        
Sbjct: 487 KIRMATFTLLTRILCLMPEDLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKD------- 539

Query: 543 ANDNDEALSNSLAKLKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLALRAINSLE--EEK 600
            N   + L   L+ L I+S+KN+G              RM  +H +A   I++L+  +  
Sbjct: 540 -NQISKPLEEELSTLDISSEKNKGPTLPPRPYILINEDRMASLHSVASMCISNLKLLDNP 598

Query: 601 TTRANIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDE 645
             R  + L+LNY+ FF  L  +W+ +LLQ IHDE++ K+    DE
Sbjct: 599 NKRTELSLLLNYMNFFISLRYKWNVNLLQIIHDEVDAKLAGVEDE 643

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  396 bits (1017), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/654 (33%), Positives = 357/654 (54%), Gaps = 41/654 (6%)

Query: 31  MYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARISWDFPKEILKFLTTANVDVTKRLG 90
           MY +Q+N    I +KE++L ALL ++KD+P  +  I WD PK +L+F +  N++V   L 
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 91  YSVIISLVMKCFNEIAFSAEPKECLLTGCXXXXXXXXXXXXXXXXMEQGDHTNSKGQTHY 150
           +S ++S VM+CFNE+A +  PKECLLT C                 E+ +  N   +   
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHIVLTETGDSDEENEDLNDSNRNDA 120

Query: 151 S---------SAEIGKYHAERTPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATS 201
           S         + EIG Y A+ T  +F  ++K+Y+LFE +   L+R+ TL PSK+L + TS
Sbjct: 121 SNITDELSVITPEIGHYMAKNT-VEFIPNLKIYVLFEFMSLLLKRVDTLYPSKFLAMVTS 179

Query: 202 AMIRFIKANCDGINDVRIVMRRIFSFCRNYVP--PDTSLCVIKDRSLTKEDLIRIEEREL 259
           A+I+++  N   ++D   ++R +++FC NY P  P  SL       ++  DL +I + E 
Sbjct: 180 AIIKYVTTNVQAMDDPHFILRIVYNFCTNYSPAQPSASLT----DGISTNDLEKIHDDES 235

Query: 260 ASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTLAGFYKDISEVNSRFFNLAL 319
           A Q+++L NL    +  CLK   G  D  YF  L + +         + ++  +++    
Sbjct: 236 ALQKKLLANLSVFVISNCLKNHPGNIDKIYFKTLMHKKTDENEIDASVLQICHQYYEYVT 295

Query: 320 SFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKN 379
           S D+ +K+   +C+  S  IY  L  + +  + E K+ I Q VY+++Y+Y+++++A  KN
Sbjct: 296 SLDVHMKELLEKCLVESRSIYNSLLMNPAASTPEFKEEINQLVYEVSYAYQIKKLADEKN 355

Query: 380 VQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRY 439
           ++LD  G+VILS ++Y +   HL PQI ++ AIYLYLRCTT SLFS+ YEN  +ES VRY
Sbjct: 356 LELDQYGVVILSAIHYSKNGTHLLPQIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRY 415

Query: 440 WLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLI 499
           WLWVS T  S+  ++  L+ELP ++ T FLQ  L K C + N + ++   TL  R+L L+
Sbjct: 416 WLWVSTTETSTEKIKCALQELPGHITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLM 475

Query: 500 PEAVTFKFILETLTASSYPHVKSSVLGILKDLM------SKRRSCQDLCANDNDEALSNS 553
           PE+ +F FI ETL    Y   K +VL IL+D+M      + R     L    N    +NS
Sbjct: 476 PESTSFTFIFETLLHCPYITAKIAVLDILRDMMIRSPEAANRDETVGLIEQQNPGNTANS 535

Query: 554 LAKLKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLALRAINSLEEEKTTRANIILILNYL 613
           +  +     +                 RM  IH +AL   ++ +++K T+ +++L+L Y+
Sbjct: 536 VPIMPTLPPR---------PYITINEDRMASIHSIALICFSAAKQKKRTQGDLLLVLTYM 586

Query: 614 EFFNGLHSEWDKSLLQSIHDEIEDKVE----------NCSDEDLKKQIKDANVK 657
           +FF  L ++WD  LL  I+ EI +  +          N S+  L + I++ N++
Sbjct: 587 KFFVSLRNKWDLGLLTLINKEISESFQGEGEPELAFINISNNTLGEYIEEMNIR 640

>Kwal_14.1812
          Length = 684

 Score =  385 bits (989), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/656 (35%), Positives = 366/656 (55%), Gaps = 39/656 (5%)

Query: 1   MANVNDIIADLVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHP 60
           M + + ++  L +AFDE  +D +SL  I+++Y  ++N     ++K QFL  LL  ++D  
Sbjct: 1   MKSSSSLLDKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDH 60

Query: 61  DVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCX 120
            ++ ++ WD PK +++F+ T NVD+  RL Y+ +++  +KCFNEIA     KEC LTGC 
Sbjct: 61  HLIQQVGWDLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCE 120

Query: 121 XXXXXXXXXXXXXXXMEQGDHTNS---KGQTHYSSAEIG---KYHAE-----------RT 163
                            + D T +   + Q   S+ E     K +A+           R 
Sbjct: 121 LLGELELHPSEKVQEEHEEDATEAVEVEAQAIKSTPEEANGPKMNAQTSSRTVVRPLSRD 180

Query: 164 PADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRR 223
           P +  + VK+++L ELI +TL+RI T  PS++L +A S++  F+++N   I+D   V+RR
Sbjct: 181 PEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFSFVRSNSIDIDDTTFVLRR 240

Query: 224 IFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAING 283
           +++F RN++PP ++    KD  ++ E+++++ + E A QR++LR L T  +   ++    
Sbjct: 241 VYTFARNFIPPQSNAEAYKD--MSTEEILKVRDDEEALQRKLLRCLLTFSIGQLVRPRVL 298

Query: 284 RTDVKYFYFLSNTEFTLAGFYK---DISEVNSRFFNLALSFDIDIKKEFL-ECVKTSHDI 339
               +YF+ L N ++T    Y+   ++  + SR++ LA SFDID+K+EFL +CVK S  I
Sbjct: 299 NIATEYFFRLKN-KYTTDFEYEMRVNLKHILSRYYQLAYSFDIDVKEEFLKQCVKDSSAI 357

Query: 340 YKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETD 399
           Y+ LP DS + ++ A+  I Q VY+L+YSY LQR    KN+ LDP G+++L+  +Y+ET 
Sbjct: 358 YQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDPAGLLVLATQHYLETG 417

Query: 400 KHLYPQITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEE 459
           + L   I    AIY+YLR  TP +++   +N        +WLWV++T  S    ++ L+ 
Sbjct: 418 QILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWLWVAVTKSSCKDSKEALQN 477

Query: 460 LPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPH 519
           +PSYL  TFLQ  L K+  +  E  RMVSFTL TR+LCL+PE  TF+F  +TL +  +  
Sbjct: 478 IPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPEETTFEFAKDTLLSCPFID 537

Query: 520 VKSSVLGILKDLMSKRRSCQDLCANDNDEALSNSLAKLKI--NSKKNEGAGXXXXXXXXX 577
           +K  +LGILKDLM        L +      L+  L++LK+  + K +             
Sbjct: 538 LKCCMLGILKDLM--------LNSKIPVSNLATELSELKLSEDEKSHSKPPLPSRPFIMI 589

Query: 578 XXXRMNEIHHLALRAINSLEE--EKTTRANIILILNYLEFFNGLHSEWDKSLLQSI 631
              RM  IH LAL    S E+  E   + N+ L L Y+ FF GL  +WDK LL  +
Sbjct: 590 NEDRMATIHSLALL---SFEDTIENADKGNLRLSLTYINFFVGLRLKWDKHLLAEV 642

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  382 bits (981), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/673 (33%), Positives = 379/673 (56%), Gaps = 28/673 (4%)

Query: 1   MANVNDIIADLVNA-FDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDH 59
           M++  + + D + A F +  +DS++L  +++   ++++   E+ +KEQFL  LL L++  
Sbjct: 1   MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEAD 60

Query: 60  PDVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGC 119
            ++V+ + WD P+ +L+F    N+  + RL    ++++ M  FN +A  A+P+ECL+T  
Sbjct: 61  TELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVT-- 118

Query: 120 XXXXXXXXXXXXXXXXMEQGDHTNSKGQTHYSSAE----IGKYHAERTPADFFVSVKMYI 175
                           +E+    +  G  + ++ E    +  Y  +R   +    VK Y 
Sbjct: 119 ---TLELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRDQPEIIFGVKSYA 175

Query: 176 LFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPD 235
           LFEL G+ ++R+ TL+PSKYL  A +A+ +++  N + + DV+ ++RR+F+FCR Y+PP+
Sbjct: 176 LFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILRRVFAFCRGYIPPE 235

Query: 236 TSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSN 295
               +I D  +  E+   I   E+  Q R+LRNLCT  +  C+K +N +T+V YF+ L N
Sbjct: 236 PPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFLNDKTEVVYFHKLIN 295

Query: 296 TEFTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEAK 355
            +  L  FY+ + ++ SR++ +A SFDID+  EF + ++ +  IY+ + K  +  +   K
Sbjct: 296 KDLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIYEDVIKRINETNNTDK 355

Query: 356 KLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLY 415
                 + K  Y YE+Q+ A+ K +  D  GI++LSG  Y+E   HL   I + DA+YLY
Sbjct: 356 NAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENGDHLI-DIDIADALYLY 414

Query: 416 LRCTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSK 475
           LR  + SLFS    N ++E V RYW+W ++T   + +L+++L EL   +L + L   L K
Sbjct: 415 LRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAELSPLVLHSVLNLLLVK 474

Query: 476 NCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKR 535
           NC Q NEEIRM++FTL TRILCL+PE  +++F+++ L   +    KS VLGIL+DL+ K 
Sbjct: 475 NCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKV 534

Query: 536 RSCQDLCANDND-EALSNSLAKLKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLALRAIN 594
                + +N+ D E LS S+A+LKIN++K                 R  EI  LA++ + 
Sbjct: 535 D--HSVSSNNTDTEDLSESMAQLKINNEKR-----AKKTFITLDPKRAGEIEDLAIKTLK 587

Query: 595 SLEEEKTTRAN-IILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENCSDEDLKKQIK- 652
             E +K+ + + I+L+LNY++FF+    +W+KS L      +     N SD  +  +I  
Sbjct: 588 --ETKKSMKKDYILLVLNYIKFFSTFAHKWNKSKLNEFTTLV---ATNFSDSKMLPEINA 642

Query: 653 --DANVKLYGLIQ 663
             DAN KL  L +
Sbjct: 643 IIDANEKLRSLTE 655

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score =  360 bits (924), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 227/682 (33%), Positives = 351/682 (51%), Gaps = 58/682 (8%)

Query: 11  LVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARISWDF 70
           L+ AF E   D ++L  IL++Y +++N  G ++ K ++L+ +L L++ + DVV  I WD 
Sbjct: 15  LLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDL 74

Query: 71  PKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCXXXXXXXXXXX 130
           PK ++KF+   N +          ++++MKCFNE+A    PKEC   GC           
Sbjct: 75  PKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDE 134

Query: 131 XXXXXM------------EQGD--HTNSKGQTHYSSAEIGKYHAE--------------- 161
                +            + GD  +T  +G +  +  E  K   +               
Sbjct: 135 SLVRFIVEEEPVMDPENEDSGDETYTEDEGSSDKTEEEEEKNAVKDSPTPKSANESIPDL 194

Query: 162 --------RTPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDG 213
                   R P +    ++ Y + EL+G+TL+RI TL+PSK+L  A  A  RF   N + 
Sbjct: 195 KEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNED 254

Query: 214 INDVRIVMRRIFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIG 273
           ++D   ++RR++SF R Y+PP  S     D+ ++ E+L  I+  E   QR++L N+ T  
Sbjct: 255 VDDCLFILRRLYSFIRGYIPP--SPPPDADKQVSAEELEEIKVSEEVLQRKLLCNILTSA 312

Query: 274 LETCLKAINGRTDVKYFYFLSN--TEFTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLE 331
           L   LKA    + + Y   L    T  T + +   ++++ SR++ LA SFDID+  EF  
Sbjct: 313 LHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKR 372

Query: 332 -CVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVIL 390
            CV  S  IY+ LPKDS I S+E  K I   VY+LAY+YE+++IA  K + LDP GI+IL
Sbjct: 373 LCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILIL 432

Query: 391 SGVYYMETDKHLYP---QITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITN 447
                   +  L P   +IT+++AIY+YLR  TPS+FS  +EN S   + R W+  ++TN
Sbjct: 433 RS---FSNEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTN 489

Query: 448 HSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKF 507
           +S+  L   L++LPSY++T +LQT L + C Q N+ +R   F++ TRILCL+PE   F F
Sbjct: 490 NSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNF 549

Query: 508 ILETLTASSYPHVKSSVLGILKDLMSKRRSCQDLCANDNDEALSNSLAKLKINSKKNEGA 567
           I +TL +  Y   K   L ILKD+M   R        D+   L+  + KLKI   KN   
Sbjct: 550 IRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDD---LAKDMEKLKI---KNSPP 603

Query: 568 GXXXXXXXXXXXXRMNEIHHLALRAINSLEEEKTTRANIILILNYLEFFNGLHSEWDKSL 627
                        R+  +H + L AI+S   +  ++  +  +L YL F N   ++WD   
Sbjct: 604 PLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESK-KVKTLLTYLNFLNAFLTKWDSVF 662

Query: 628 LQSIHDEIEDKV---ENCSDED 646
           L+ I D + DK+   E   D+D
Sbjct: 663 LKEICDAVNDKLIKNEKVGDKD 684

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  242 bits (618), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 170/638 (26%), Positives = 302/638 (47%), Gaps = 80/638 (12%)

Query: 15  FDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARISWDFPKEI 74
           F E + D +SL A +E+  +Q    G       FL AL   +++HP +V  + WD PK +
Sbjct: 16  FAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGWDIPKVL 75

Query: 75  LKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCXXXXXXXXXXXXXXX 134
           ++ +   N ++ + LG  ++  L++ CF E+      +EC LTGC               
Sbjct: 76  VRCIRADNFNLNEGLGDDMVWRLLVGCFREVGREGNARECFLTGCQQL------------ 123

Query: 135 XMEQGDHTNSKGQTHYSSAEIGKYHAERTPADF---FVSVKMYILFELIGTTLQRIPTLN 191
                             AE+     E   AD      ++K ++L E + TTL R  T  
Sbjct: 124 ------------------AELSVAAEEEEDADLREEMFALKFHMLMEFVTTTLGRTTTAY 165

Query: 192 PSKYLGLATSAMIRFIKANCDGINDVRIVMRRIFSFCRNYVPPDTSLCVIKDRSLTKEDL 251
           PS++LG     +++ ++ N D + DV +++RR+++FCR+Y  P +S         ++++ 
Sbjct: 166 PSRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYTAPVSS---------SEDEE 216

Query: 252 IRIEERELASQRRILRNLCTIGLETCLKAINGRTDVKYFYFLSNTEFTLAGFYKDISEVN 311
           +R +E  L  QR + R+     L   L+  + R   +YF      EF L   + ++ E  
Sbjct: 217 LRAQEDYL--QRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRETL 274

Query: 312 SRFFNLALSFDIDIKKEFL-ECVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYE 370
            R+F LA SFDIDI+  F  +C+  S D+Y  +  D+       K    + +Y+LAY+YE
Sbjct: 275 GRYFQLAHSFDIDIEGAFQKQCILESRDVYACVSADAD------KADGAEVIYQLAYTYE 328

Query: 371 LQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITVKDAIYLYLRCTTPSLFSKFYEN 430
           L++IA+ +++ +D  GI +L+ +++ ET K +   + + DAIY++LR  TP ++SK + N
Sbjct: 329 LKKIAELQSMPIDARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSFGN 388

Query: 431 FSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFT 490
            +V     Y++ +++  +S     K + E P  +   F+Q  L   C+ P+ EI  ++ +
Sbjct: 389 IAVTDASLYFVLLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMTHS 448

Query: 491 LFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGILKDLMSKRR---SCQDLCANDND 547
           +  R+L L  E   F F+++TL    Y   K  +L I K +M   +     +D+ ++   
Sbjct: 449 ILARVLFLASETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYTICTRDVPSHTRT 508

Query: 548 EALSNSLAK---LKINSKKNEGAGXXXXXXXXXXXXRMNEIHHLALRAINSLEEEKTTRA 604
           +  +  L     +K+N                    RM   H LA+ +     E +  + 
Sbjct: 509 DTKAPPLPPRPFIKLNDD------------------RMAAFHTLAMMSAKFCTETEDPK- 549

Query: 605 NIILILNYLEFFNGLHSEWDKSLLQSIHDEIEDKVENC 642
            +  +L+YL     L  +WD+ LL+    E+   V NC
Sbjct: 550 QLTTLLSYLNLITVLRKKWDQVLLR----ELTVAVSNC 583

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 126/491 (25%), Positives = 228/491 (46%), Gaps = 52/491 (10%)

Query: 167 FFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDGINDVR---IVMRR 223
           F V V++ +L E I   L+ +   NPSK+L +  SA++  I  N     ++    I++  
Sbjct: 138 FKVRVEL-LLEEFILPALKTLGQTNPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDV 196

Query: 224 IFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIGLETCLKAING 283
           I  F  +Y  P   +    D ++  +D     E ++   ++IL +  +  +  C+K    
Sbjct: 197 IIRFYDSYELPSAKVTT-PDGAMANKD-----EEDIV--QKILESFWSFSIGRCIK---N 245

Query: 284 RTDVKYFYFLSNTEFTLAGFYKDISEVNSRFFNLALS--------FDIDIKKEFLECVKT 335
           ++    +  LS  +     F K   +V   F   + +          +D++K    C + 
Sbjct: 246 QSCFPEYILLS--QIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEACFEE 303

Query: 336 SHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKN-VQLDPLGIVILSGVY 394
           +  IY+ LP + ++  ++   L ++ +Y+++Y   +  + + K  + LD  G++ LSG+Y
Sbjct: 304 TRKIYELLPPNPTV--QDGNDLTEE-IYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLY 360

Query: 395 YMETDKHLYPQITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSI--TNHSSAV 452
           Y+  D  L  +I + DA+ LYLR ++ SL+S  ++N  VE + R+WLW      N     
Sbjct: 361 YIANDNKLNVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNT 420

Query: 453 LRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETL 512
           L+ EL  +P Y+L  F Q  L K C + +   + ++F L T++L      V F FI++T+
Sbjct: 421 LQSELMSVPDYVLKVFFQLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTI 480

Query: 513 TASSYPHVKSSVLGILKDLMSKRRSCQDLCANDNDEALSNSLAKLKINSKKNEGAGXXXX 572
            +  Y   K ++ GILKDLM+K+          +D  L  +       +  N        
Sbjct: 481 LSCPYLDAKIAIAGILKDLMAKKS---------DDIHLKEARQVKNEPNNHNCPPKLPDR 531

Query: 573 XXXXXXXXRMNEIHHLA-------LRAINSLEEEKTTRANIILILNYLEFFNGLHSEWDK 625
                   R+  IH L        L+ +N+      T+ N+IL+  Y+     L+ +WD 
Sbjct: 532 PPITVDEHRIASIHSLVKLCIEDCLKPLNN-----KTQGNLILLQYYINILITLYKQWDG 586

Query: 626 SLLQSIHDEIE 636
            LL+ I+DEI+
Sbjct: 587 FLLKEINDEIK 597

>Scas_548.7
          Length = 573

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 49  LTALLGLMKDHPDVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFN 103
           L  L+ L+ ++PD+     W+F   I + +   N D  K LG   +IS + K FN
Sbjct: 196 LPPLIDLLSENPDLSTNQDWEFISNIFQIIINDNQDSVKFLGVDCLIS-ISKFFN 249

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 335 TSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQ---RIAKHKNVQLDPLGIVILS 391
           + H++Y+ L K+  +  EE+KKL  Q    + Y++EL+   R  K +NV LD  G   L+
Sbjct: 111 SGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLT 170

>Scas_594.4
          Length = 1722

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 12/92 (13%)

Query: 444 SITNHSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAV 503
           +ITN+   ++ K    +PS++ T  L+ F  +  K         +F + + I C I   +
Sbjct: 346 TITNN--GIVGKTFGLVPSFISTAHLRVFKEEELKH--------NFAVGSNIPCRIIAVL 395

Query: 504 TFKFILETLTASSYPHVKS--SVLGILKDLMS 533
             K   +TL  S+ PH+KS  +VLG +++L +
Sbjct: 396 ITKENDKTLLLSTLPHIKSLKNVLGEVENLTA 427

>YDL190C (UFD2) [683] chr4 complement(118708..121593) Ubiquitin
           fusion degradation protein [2886 bp, 961 aa]
          Length = 961

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 86/231 (37%), Gaps = 65/231 (28%)

Query: 315 FNLALSFDIDIKKEFLECVK---TSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYEL 371
           F   +  +I   KE +E VK    +HD++           E+A K  +      +  + L
Sbjct: 403 FEEKMGSEIKALKEEIEKVKKIAANHDVFARFITAQLSKMEKALKTTE------SLRFAL 456

Query: 372 QRIAKHKNVQLDPLGIVILSGVYYMET--DKHLYP--QIT---VKDAIYL-------YLR 417
           Q    H+++QL+    +  +  + +     +H +P  QI    + D I +       +LR
Sbjct: 457 QGFFAHRSLQLEVFDFICGASTFLIRVVDPEHEFPFKQIKLPLIPDQIGVENVDNADFLR 516

Query: 418 CTTPSLFSKFYENFSVESVVRYWLWVSITNHSSAVLRKELEELPSYLLTTFLQTFLSKNC 477
              P  F K+Y  F VE  V Y L++S    +S + R                       
Sbjct: 517 AHAPVPF-KYYPEFVVEGPVNYSLYIS-KYQTSPIFRNP--------------------- 553

Query: 478 KQPNEEIRMVSFTLFTRILCLIPEAVTFKFILETLTASSYPHVKSSVLGIL 528
                  R+ SF  FT ++   PE V            S PH+K  ++ +L
Sbjct: 554 -------RLGSFVEFTTMVLRCPELV------------SNPHLKGKLVQLL 585

>Sklu_2422.11 YDL239C, Contig c2422 22194-24956 reverse complement
          Length = 920

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 353 EAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVILSGVYYMETDKHLYPQITV 408
           E  + I Q  ++L  S E  ++A+ KN+++D L   +   V  +ET K  Y Q+TV
Sbjct: 305 EKNEEIDQLKHQLHESVEHLKVAEEKNIEVDQLRNQLKELVNEVETHKAKYNQVTV 360

>CAGL0C01859g complement(193730..194746) weakly similar to sp|P25560
           Saccharomyces cerevisiae YCL001w RER1, hypothetical
           start
          Length = 338

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 320 SFDIDIKKEFLECVKTSHDIYKGLPKDSSIGSEEA 354
           +  I I   F+ C+   HDIY   PKD+S  + EA
Sbjct: 206 ALGISILDAFIMCLTRMHDIYSQQPKDNSQEANEA 240

>ADL189W [1552] [Homologous to ScYNL321W - SH]
           complement(364649..367216) [2568 bp, 855 aa]
          Length = 855

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 165 ADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMI 204
           A  F ++   IL + +   L+ IP+LNP K+LGL   A+I
Sbjct: 696 ATLFYAIIAEILVDCVDEVLKEIPSLNP-KFLGLTVFALI 734

>Scas_567.1
          Length = 810

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 393 VYYMETDKHLYPQITVKDAIYLYLRCTTP 421
           VY  E D H +P+ITVK+ I   L+C TP
Sbjct: 233 VYCPELDFH-FPKITVKETIDFALKCKTP 260

>KLLA0F07689g 727832..729664 highly similar to sp|P31383
           Saccharomyces cerevisiae YAL016w TPD3 ser/thr protein
           phosphatase 2A, regulatory chain A singleton, start by
           similarity
          Length = 610

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 49  LTALLGLMKDHPDVVARISWDFPKEILKFLTTANVDVTKRLGYSVIISLVMKCFNE 104
           L  L+  + +HP++     WD+   + + L   + D  K L   V+IS ++K FN+
Sbjct: 192 LPTLVDQLTEHPELSTDDEWDYISSMFQRLVNDSQDSVKFLAVDVLIS-ILKFFNK 246

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,451,443
Number of extensions: 860124
Number of successful extensions: 2768
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2822
Number of HSP's successfully gapped: 35
Length of query: 663
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 555
Effective length of database: 12,857,365
Effective search space: 7135837575
Effective search space used: 7135837575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)