Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.181801598431e-117
YBR217W (ATG12)1861614192e-52
CAGL0K06765g1811463819e-47
Sklu_752.22001723715e-45
Kwal_14.18111961733333e-39
KLLA0C05720g1891043305e-39
AAR160W1891602984e-34
Scas_592.1525476641.6
CAGL0D04180g70059606.2
KLLA0F03949g47562589.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.18
         (180 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.18                                                           329   e-117
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   166   2e-52
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   151   9e-47
Sklu_752.2 YBR217W, Contig c752 791-1393                              147   5e-45
Kwal_14.1811                                                          132   3e-39
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   131   5e-39
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   119   4e-34
Scas_592.15                                                            29   1.6  
CAGL0D04180g complement(411498..413600) similar to sp|P40498 Sac...    28   6.2  
KLLA0F03949g complement(372819..374246) similar to sp|P40486 Sac...    27   9.3  

>Scas_686.18
          Length = 180

 Score =  329 bits (843), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%)

Query: 22  KVLDSHTPDNSVSRGQNNEIPSLALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAE 81
           KVLDSHTPDNSVSRGQNNEIPSLALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAE
Sbjct: 22  KVLDSHTPDNSVSRGQNNEIPSLALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAE 81

Query: 82  KEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVY 141
           KEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVY
Sbjct: 82  KEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVY 141

Query: 142 CYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
           CYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG
Sbjct: 142 CYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  166 bits (419), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 115/161 (71%), Gaps = 12/161 (7%)

Query: 32  SVSRGQNN-EIPS--LALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKI--- 85
           ++ R +NN E+ S    ++NRLEL+SRRLSQLGL     +  + +++S    E+E+    
Sbjct: 26  AMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLASDISVDQQVEDSSSGTYEQEETIKT 85

Query: 86  ------KNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMEN 139
                 +     + N  K++IKFQPIGS+ Q+KP VCKIS +QSF+ +I FL++RL+M++
Sbjct: 86  NAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDH 145

Query: 140 VYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
           VYCY+N+SFAP+PQQN+G+LW QFK NDELI+SYC +VAFG
Sbjct: 146 VYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVAFG 186

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  151 bits (381), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 77/146 (52%), Positives = 99/146 (67%), Gaps = 9/146 (6%)

Query: 44  LALRNRLELYSRRLSQLGLEETPQIPLETDNTSL--------SQAEKEKIKNE-EGPDVN 94
           L + NRLE YSRRLSQL L +T +    ++   +         Q+ K  I++   G    
Sbjct: 36  LGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSSSHGHTGA 95

Query: 95  SFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVYCYVNSSFAPTPQQ 154
             KV IKFQ IGS+  I P VC+IS  + FS IISFL+++L+MEN++CY+N+SFAP P Q
Sbjct: 96  PQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQ 155

Query: 155 NVGDLWTQFKVNDELIISYCGAVAFG 180
           NVGDLW QFKVNDELI+SYCG+VAFG
Sbjct: 156 NVGDLWNQFKVNDELIVSYCGSVAFG 181

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  147 bits (371), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 110/172 (63%), Gaps = 37/172 (21%)

Query: 43  SLALRNRLELYSRRLSQLGLEETPQIPLETDNTSL-SQAEKEKIKNEEGP---------- 91
           S  ++++LELYS+RLSQL ++   +   E D  S  SQ+++ +   E+GP          
Sbjct: 32  SYMVQSKLELYSKRLSQLRMQSDDE---EEDELSRPSQSDRSQGTIEDGPVPRQEIPLTT 88

Query: 92  --DVNSF---------------------KVKIKFQPIGSVPQIKPPVCKISATQSFSSII 128
              +N+                      K++IKFQPIGS+ QI P VCKIS TQSFS +I
Sbjct: 89  SLILNNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVI 148

Query: 129 SFLRKRLRMENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
           +FLR++L++  VYCY+N+SFAPTPQQNVGDLWTQFK+ +EL++SYC +VAFG
Sbjct: 149 TFLRRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200

>Kwal_14.1811
          Length = 196

 Score =  132 bits (333), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 99/173 (57%), Gaps = 40/173 (23%)

Query: 44  LALRNRLELYSRRLSQLGLEETPQIPLET----------DNTS----------------- 76
             +R+ LE YS RL+ LGL+   QI   T          DN S                 
Sbjct: 28  FTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTSA 87

Query: 77  ----LSQAEKEKIKN-----EEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSI 127
               LS A  + +K      +E P     K+ I+F+PIGSVPQ+ P + +ISA+Q FS +
Sbjct: 88  ILGHLSVAGDQALKKMAEREQELPT----KIPIRFKPIGSVPQVAPQLARISASQPFSVV 143

Query: 128 ISFLRKRLRMENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
           ++FL KRL++ NVYCY+N+SF+P PQQ+VGDLW  F++ DEL++SYC  VAFG
Sbjct: 144 VTFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVAFG 196

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  131 bits (330), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 81/104 (77%), Gaps = 7/104 (6%)

Query: 77  LSQAEKEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLR 136
           +S  E+E++K++        KVKI+ QPIG++PQI+P VC+ISA Q F ++  FL KRL+
Sbjct: 93  VSSVEREQLKSQ-------VKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLK 145

Query: 137 MENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
            ++++CY+N++FAP+  QN+GDLWTQFKVNDELI+SYC  VAFG
Sbjct: 146 RKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETVAFG 189

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  119 bits (298), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 99/160 (61%), Gaps = 30/160 (18%)

Query: 45  ALRNRLELYSRRLSQLGLEETPQ----------------IPLETDNTSLSQA-------- 80
           +L+NRLE Y  RLS+L L  +                  +PL T +  L+ A        
Sbjct: 36  SLQNRLEEYHERLSRLQLPSSSDSECSDIEQESLELEQEVPLST-SVYLAGARSAGGLPS 94

Query: 81  EKEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMENV 140
             E  +  E P     KV I+FQPIGSV Q+ P VC+IS+ QSF +++ FLR+RLR++ V
Sbjct: 95  SSELSETPEPP-----KVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRRRLRLDTV 149

Query: 141 YCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180
           +CYV++SFAPTPQQNVG LW QFKVNDEL++SYC  VAFG
Sbjct: 150 HCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATVAFG 189

>Scas_592.15
          Length = 254

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 10/76 (13%)

Query: 30  DNSVSRGQNNEIPSLALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKIKNEE 89
           D  +S  +  E+P     NR  L + + + L  E +P IPLE D   + +  ++ +++ +
Sbjct: 169 DGHMSAARTLELPP----NRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVK 224

Query: 90  GPDVNSFKVKIKFQPI 105
            PD     +K+K+ PI
Sbjct: 225 -PD-----IKLKYNPI 234

>CAGL0D04180g complement(411498..413600) similar to sp|P40498
           Saccharomyces cerevisiae YIL091c, hypothetical start
          Length = 700

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 6/59 (10%)

Query: 106 GSVPQIKPPVCKISATQSFSSIISFLRKRLRMENVYCYVNSSFAPTPQQNVGDLWTQFK 164
           G  P+I+ P  K S +  F      L+KRLR++N      S+     Q+ + D   Q+K
Sbjct: 189 GETPKIEDPKLKCSLSSYF------LKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYK 241

>KLLA0F03949g complement(372819..374246) similar to sp|P40486
           Saccharomyces cerevisiae YIL104c singleton, start by
           similarity
          Length = 475

 Score = 26.9 bits (58), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 9/62 (14%)

Query: 33  VSRGQNNEIPSLALRNRLELYSRRLSQLGL-------EETPQIPLETDNTSLSQ--AEKE 83
           +S+G +N I SLAL+ + EL S   S +         EET ++  ET N S  +  AE+E
Sbjct: 412 ISQGNDNVIQSLALQAKKELESITKSDIEFECISGMNEETGEVEWETLNISEIEYLAEQE 471

Query: 84  KI 85
           +I
Sbjct: 472 EI 473

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,565,703
Number of extensions: 234735
Number of successful extensions: 634
Number of sequences better than 10.0: 22
Number of HSP's gapped: 630
Number of HSP's successfully gapped: 22
Length of query: 180
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 85
Effective length of database: 13,307,399
Effective search space: 1131128915
Effective search space used: 1131128915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 58 (26.9 bits)