Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.171176117659830.0
YBR218C (PYC2)1180117354120.0
YGL062W (PYC1)1178117653820.0
Scas_563.121216117452910.0
CAGL0F06941g1180117252340.0
KLLA0C05764g1173116852130.0
CAGL0K06787g1175116651720.0
Kwal_14.18031174117051540.0
AAR162C1171116450390.0
Sklu_1458.11132113050320.0
CAGL0M05533g18344567752e-84
YBR208C (DUR1,2)18354717326e-79
KLLA0E08107g18294467103e-76
Sklu_2124.118304597093e-76
Scas_721.4018344387068e-76
ADR051C18194616773e-72
Kwal_27.1195118694596755e-72
Scas_720.7422315184883e-49
AAR071W22315664856e-49
CAGL0L10780g22335344821e-48
KLLA0F06072g22315614695e-47
YNR016C (ACC1)22335184661e-46
YMR207C (HFA1)21234624652e-46
Kwal_23.615722305344642e-46
Sklu_2331.122203321143e-05
CAGL0L05676g22113341063e-04
Kwal_33.1406122213321063e-04
Scas_582.4*21931731029e-04
YJL130C (URA2)22141731000.002
ACR263C2240332980.003
KLLA0E23782g393216920.011
ABR157W1113280910.015
Kwal_27.12090394229870.043
KLLA0F03190g1117176860.058
Sklu_2431.2394120850.059
KLLA0E15444g2228303860.074
KLLA0F05489g44175840.10
Kwal_55.197831121219840.11
Scas_701.3543075830.13
CAGL0J09240g437120810.18
YDL131W (LYS21)44075810.19
ADR107W442248810.19
CAGL0J06402g431120810.21
YDL182W (LYS20)42875810.23
Scas_704.343875800.24
Kwal_56.2440144175770.63
Sklu_2413.41122219770.84
YLR432W (IMD3)523131731.8
YJR109C (CPA2)1118221732.4
YAR075W157131692.5
Scas_714.51460100713.9
CAGL0K10780g52781696.5
YHR216W (IMD2)523131696.7
YML056C (IMD4)52481687.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.17
         (1176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.17                                                          2309   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2089   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2077   0.0  
Scas_563.12                                                          2042   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2020   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  2012   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  1996   0.0  
Kwal_14.1803                                                         1989   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1945   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1942   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   303   2e-84
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   286   6e-79
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   278   3e-76
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          277   3e-76
Scas_721.40                                                           276   8e-76
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   265   3e-72
Kwal_27.11951                                                         264   5e-72
Scas_720.74                                                           192   3e-49
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   191   6e-49
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   190   1e-48
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   185   5e-47
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   184   1e-46
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   183   2e-46
Kwal_23.6157                                                          183   2e-46
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            49   3e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    45   3e-04
Kwal_33.14061                                                          45   3e-04
Scas_582.4*                                                            44   9e-04
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    43   0.002
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    42   0.003
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    40   0.011
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    40   0.015
Kwal_27.12090                                                          38   0.043
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    38   0.058
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            37   0.059
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    38   0.074
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    37   0.10 
Kwal_55.19783                                                          37   0.11 
Scas_701.35                                                            37   0.13 
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    36   0.18 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    36   0.19 
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    36   0.19 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    36   0.21 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    36   0.23 
Scas_704.3                                                             35   0.24 
Kwal_56.24401                                                          34   0.63 
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          34   0.84 
YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly si...    33   1.8  
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    33   2.4  
YAR075W (YAR075W) [91] chr1 (228837..229310) Protein containing ...    31   2.5  
Scas_714.5                                                             32   3.9  
CAGL0K10780g join(1047904..1047925,1049093..1049539,1050106..105...    31   6.5  
YHR216W (IMD2) [2500] chr8 (554394..555965) Inosine-5'-monophosp...    31   6.7  
YML056C (IMD4) [3914] chr13 complement(162194..163308,163717..16...    31   7.7  

>Scas_686.17
          Length = 1176

 Score = 2309 bits (5983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1125/1176 (95%), Positives = 1125/1176 (95%)

Query: 1    MAHMKLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL 60
            MAHMKLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL
Sbjct: 1    MAHMKLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL 60

Query: 61   KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI 120
            KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI
Sbjct: 61   KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI 120

Query: 121  TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA 180
            TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA
Sbjct: 121  TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA 180

Query: 181  FXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN 240
            F              DINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN
Sbjct: 181  FGGGGRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN 240

Query: 241  VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
            VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
Sbjct: 241  VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300

Query: 301  QNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQC 360
            QNRHYFIEINPRIQVEHTITEEITGIDLV                   DRITTRGFAIQC
Sbjct: 301  QNRHYFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQC 360

Query: 361  RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY 420
            RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY
Sbjct: 361  RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY 420

Query: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR 480
            EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR
Sbjct: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR 480

Query: 481  AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLE 540
            AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLE
Sbjct: 481  AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLE 540

Query: 541  QGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECW 600
            QGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECW
Sbjct: 541  QGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECW 600

Query: 601  GGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 660
            GGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK
Sbjct: 601  GGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 660

Query: 661  DNGVDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTE 720
            DNGVDIFRVFDALNDLDQL                  CYSGDMLQPGKKYNLDYYLEVTE
Sbjct: 661  DNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTE 720

Query: 721  KIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAAL 780
            KIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAAL
Sbjct: 721  KIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAAL 780

Query: 781  SGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFE 840
            SGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFE
Sbjct: 781  SGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFE 840

Query: 841  ADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTS 900
            ADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTS
Sbjct: 841  ADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTS 900

Query: 901  KVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNK 960
            KVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNK
Sbjct: 901  KVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNK 960

Query: 961  RRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLS 1020
            RRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLS
Sbjct: 961  RRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLS 1020

Query: 1021 VLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVV 1080
            VLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVV
Sbjct: 1021 VLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVV 1080

Query: 1081 DRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVIS 1140
            DRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVIS
Sbjct: 1081 DRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVIS 1140

Query: 1141 SPADGQVKEVLVSNGNAVDASDLLVVLEDAVAPVEQ 1176
            SPADGQVKEVLVSNGNAVDASDLLVVLEDAVAPVEQ
Sbjct: 1141 SPADGQVKEVLVSNGNAVDASDLLVVLEDAVAPVEQ 1176

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2089 bits (5412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 994/1173 (84%), Positives = 1067/1173 (90%), Gaps = 1/1173 (0%)

Query: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64
            KL+GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRT+AIYSHEDRLS HRLKADE
Sbjct: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65

Query: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124
            +YVIGEEGQ+TPVGAYLA+DEII IAKKHKVDFIHPGYGFLSENSEFADKV KAGITWIG
Sbjct: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125

Query: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXX 184
            PPAEVIDSVGDKVSAR+LAARA+VPTVPGTPGPI++V+EA DFV +YGYPVIIKAAF   
Sbjct: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGG 185

Query: 185  XXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244
                       D+ DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GNVVHL
Sbjct: 186  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245

Query: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAK +PREVRDAILTDAVKLAK CGYRNAGTAEFLVDNQNRH
Sbjct: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305

Query: 305  YFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEITGID+V                   D+ITTRGF+IQCRITT
Sbjct: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITT 365

Query: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424
            EDP+KNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGA ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484
            RKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485

Query: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLLEQGP 543
            LHYLADLAVNGSSIKGQIGLPKLK NP VPHLHDA+GNVINV  + P +GWR+VLLE+GP
Sbjct: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545

Query: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603
            +EFAKQVR F GTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHAL+GAFALECWGGA
Sbjct: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605

Query: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663
            TFDVAMRFLHEDPW RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665

Query: 664  VDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIV 723
            VDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLEV EKIV
Sbjct: 666  VDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVEKIV 725

Query: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783
            QMGTHILGIKDMAGTMKPAAA+LLIGS+R +YPDLPIHVH+HDSAGTAV+SMT  AL+GA
Sbjct: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785

Query: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843
            DVVDVAINSMSGLTSQPSINALLASL+G IDTGINV++VRELDAYWAEMRLLYSCFEADL
Sbjct: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845

Query: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903
            KGPD EVYQHEIPGGQLTNLLFQAQQ GLGEQWAETKRAYREANYLLGDIVKVTPTSKVV
Sbjct: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905

Query: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963
            GDLAQFMV+NK  SDDI+RLAN+LDFPDS+MDFFEGLIGQPYGGFPEPLRSD+LRNKRRK
Sbjct: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965

Query: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023
            LT RPGLEL PF+++ IREDL+ RFGDIDECD+ASYNMYP+VYEDFQKI+E YGDLSVLP
Sbjct: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025

Query: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083
            TK+FL+P + DEEIEVTIEQGKTLI+KLQA+GDLNK TG REVYF+LNGELRKIRV D+S
Sbjct: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085

Query: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143
            Q ++++AKPKAD HD +QIGAPMAGV++EVKVHKGSLVKKGE++AVLSAMKMEMV+SSPA
Sbjct: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145

Query: 1144 DGQVKEVLVSNGNAVDASDLLVVLEDAVAPVEQ 1176
            DGQVK+V + +G +VDASDLLVVLE+   P  Q
Sbjct: 1146 DGQVKDVFIKDGESVDASDLLVVLEEETLPPSQ 1178

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2077 bits (5382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 991/1176 (84%), Positives = 1066/1176 (90%), Gaps = 2/1176 (0%)

Query: 1    MAHMKLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL 60
            M+  K +GLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLSTH+ 
Sbjct: 1    MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ 60

Query: 61   KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI 120
            KADE+YVIGE GQ+TPVGAYLAIDEII+IA+KH+VDFIHPGYGFLSENSEFADKV KAGI
Sbjct: 61   KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI 120

Query: 121  TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA 180
            TWIGPPAEVIDSVGDKVSAR LAA+A+VPTVPGTPGPI++V+EA DFV +YGYPVIIKAA
Sbjct: 121  TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA 180

Query: 181  FXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN 240
            F              D+ DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GN
Sbjct: 181  FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 240

Query: 241  VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
            VVHLFERDCSVQRRHQKVVEVAPAK +PREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
Sbjct: 241  VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300

Query: 301  QNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQC 360
            QNRHYFIEINPRIQVEHTITEEITGID+V                   D+ITTRGFAIQC
Sbjct: 301  QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC 360

Query: 361  RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY 420
            RITTEDPAKNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG +ISPHYDSMLVKCSCSGSTY
Sbjct: 361  RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY 420

Query: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR 480
            EIVRRKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MVSSQNR
Sbjct: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR 480

Query: 481  AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLL 539
            AQKLLHYLAD+AVNGSSIKGQIGLPKLK NP VPHLHDA+GNVINV  + P +GWR+VLL
Sbjct: 481  AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL 540

Query: 540  EQGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALEC 599
            E+GPAEFA+QVR F GTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHAL+G FALEC
Sbjct: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600

Query: 600  WGGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 659
            WGGATFDVAMRFLHEDPW RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660

Query: 660  KDNGVDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVT 719
            KDNGVDIFRVFDALNDL+QL                  C+SGDMLQPGKKYNLDYYLE+ 
Sbjct: 661  KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA 720

Query: 720  EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAA 779
            EKIVQMGTHILGIKDMAGTMKPAAA+LLIGS+RAKYPDLPIHVHTHDSAGTAV+SMT  A
Sbjct: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780

Query: 780  LSGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCF 839
            L+GADVVDVAINSMSGLTSQPSINALLASL+G IDTGINV++VRELDAYWAEMRLLYSCF
Sbjct: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840

Query: 840  EADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPT 899
            EADLKGPD EVYQHEIPGGQLTNLLFQAQQ GLGEQWAETKRAYREANYLLGDIVKVTPT
Sbjct: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900

Query: 900  SKVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRN 959
            SKVVGDLAQFMV+NK  SDD++RLAN+LDFPDS+MDFFEGLIGQPYGGFPEP RSD+LRN
Sbjct: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960

Query: 960  KRRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDL 1019
            KRRKLT RPGLEL PF+++ IREDL+ RFGD+DECD+ASYNMYP+VYEDFQK++E YGDL
Sbjct: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020

Query: 1020 SVLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRV 1079
            SVLPT+SFLSPL+ DEEIEV IEQGKTLI+KLQA+GDLNK TG REVYFDLNGE+RKIRV
Sbjct: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080

Query: 1080 VDRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVI 1139
             DRSQKVET+ K KAD HDP  IGAPMAGV+VEVKVHKGSL+KKG+ VAVLSAMKMEM+I
Sbjct: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140

Query: 1140 SSPADGQVKEVLVSNGNAVDASDLLVVLEDAVAPVE 1175
            SSP+DGQVKEV VS+G  VD+SDLLV+LED V PVE
Sbjct: 1141 SSPSDGQVKEVFVSDGENVDSSDLLVLLEDQV-PVE 1175

>Scas_563.12
          Length = 1216

 Score = 2042 bits (5291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1174 (83%), Positives = 1057/1174 (90%), Gaps = 5/1174 (0%)

Query: 5    KLSGLRDNFSLLGEKNK----ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL 60
            KL+G RDNF+LLG +N+    I+V +    P+  FRSAHELSM+TVAIYSHEDRLSTHRL
Sbjct: 42   KLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLSTHRL 101

Query: 61   KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI 120
            KADESYVIGE  QFTPVGAYLAIDEIINIAK+H VD+IHPGYGFLSENSEFADKVAKAGI
Sbjct: 102  KADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAKAGI 161

Query: 121  TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA 180
            TWIGPPA VIDSVGDKVSAR LA +A+VPTVPGTPGPI++V++A+DFV +YGYPVIIKAA
Sbjct: 162  TWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVIIKAA 221

Query: 181  FXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN 240
            F              D+ DAFQRASSEALTAFGDGTCFVERFL+ PKHIEVQLL D +GN
Sbjct: 222  FGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADTHGN 281

Query: 241  VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
            V+HLFERDCSVQRRHQKVVEVAPAK +PREVRDAILTDAVKLAKECGY+NAGTAEFLVD+
Sbjct: 282  VIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFLVDD 341

Query: 301  QNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQC 360
            QNRHYFIEINPRIQVEHTITEEITGID+V                   D+ITTRGFAIQC
Sbjct: 342  QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFAIQC 401

Query: 361  RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY 420
            RITTEDPAKNFQPDTGRLEVY SAGGNGVRLDGGNAYAGA+ISPHYDSMLVKCSCSGSTY
Sbjct: 402  RITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSGSTY 461

Query: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR 480
            E+VRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFI+GDYWTTFIDDTPQLFKMVSSQNR
Sbjct: 462  EVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSSQNR 521

Query: 481  AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVAT-PPTAGWRKVLL 539
            AQKLLHYLADLAVNGSSIKGQ+G+P+LKK PD+PH+HDA+GNVI+V   PP AGWR+VLL
Sbjct: 522  AQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQVLL 581

Query: 540  EQGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALEC 599
            EQGP EFAKQVR FQGTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHAL+ AFALEC
Sbjct: 582  EQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFALEC 641

Query: 600  WGGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 659
            WGGATFDVAMRFLHEDPW RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 642  WGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 701

Query: 660  KDNGVDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVT 719
            KDNGVDIFRVFDALNDLDQL                  CYSGDMLQPGKKYNLDYYLEVT
Sbjct: 702  KDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVT 761

Query: 720  EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAA 779
            EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAV+SM+ AA
Sbjct: 762  EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMSAAA 821

Query: 780  LSGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCF 839
             +GADV+DVA NSMSGLTSQPSINALLASLDG+I+T INVQ+VRELDAYWAEMRLLYSCF
Sbjct: 822  YAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLYSCF 881

Query: 840  EADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPT 899
             ADLKGPD EVY+HEIPGGQLTNLLFQAQQ GLGEQW ETKRAY+EAN LLGDIVKVTPT
Sbjct: 882  GADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKVTPT 941

Query: 900  SKVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRN 959
            SKVVGDLAQFMV+NK  S+D+KRLAN+LDFPDS+MDFFEGL+GQPYGGFPEPLRSDILRN
Sbjct: 942  SKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRN 1001

Query: 960  KRRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDL 1019
            KRRKLT RPGLEL PF + +I+EDL+TRFGDI+ECDIASYNMYPKVYEDFQK+KEKYGDL
Sbjct: 1002 KRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKYGDL 1061

Query: 1020 SVLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRV 1079
            SVLPTKSFL+P ++ EEI VTI+QGKTLI+KLQAIGDLNK TG REV+F+LNGE+RKI V
Sbjct: 1062 SVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRKISV 1121

Query: 1080 VDRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVI 1139
             D+SQKVET+AKPKAD HDP+QIGAPMAGV+VEVKVHKGSLVKKGEAVAVLSAMKMEMVI
Sbjct: 1122 TDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKMEMVI 1181

Query: 1140 SSPADGQVKEVLVSNGNAVDASDLLVVLEDAVAP 1173
            SSPADG VKEVLV+    VDASDLLV+LE++  P
Sbjct: 1182 SSPADGLVKEVLVNESENVDASDLLVLLEESTPP 1215

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2020 bits (5234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 965/1172 (82%), Positives = 1050/1172 (89%), Gaps = 1/1172 (0%)

Query: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64
            KL+GLR NF++LGEK+KILVANRGEIPIRIFR+AHELSMRTVAIYSHEDRLSTHRLKADE
Sbjct: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68

Query: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124
            +YVIGEEGQ+TPVGAYLAIDEII+IAKKH VDFIHPGYGFLSENSEFADKV KAGITWIG
Sbjct: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128

Query: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXX 184
            PP EVI+SVGDKVSAR LAA+A VPTVPGTPGPIK+V+EAE FVA+YGYPVIIKAA+   
Sbjct: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGG 188

Query: 185  XXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244
                       DI DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GNV+HL
Sbjct: 189  GRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248

Query: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAK +PR+VRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308

Query: 305  YFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEITGID+V                   DRITTRGFAIQCRITT
Sbjct: 309  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITT 368

Query: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424
            EDPAKNFQPDTGR+EVY S GGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484
            RK+IRALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLF MVSSQNRAQKL
Sbjct: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488

Query: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLLEQGP 543
            LHYLADLAVNGSSIKGQIGLPKL   P++PHLHD +G +I+V    P  GWR+VLLE+GP
Sbjct: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548

Query: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603
              FAK VR F+GTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHAL+GAFALECWGGA
Sbjct: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGGA 608

Query: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663
            TFDVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668

Query: 664  VDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIV 723
            VDIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLEVT+KIV
Sbjct: 669  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIV 728

Query: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783
            +MGTH+LGIKDMAGT+KP AA+LLIGSIRAKYPDLPIHVH+HDSAGTAV+SM   A +GA
Sbjct: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788

Query: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843
            DVVDVAINSMSG+TSQ SINALLASLDG+IDTG+NV++ RELDAYWAEMRLLYSCFEADL
Sbjct: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848

Query: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903
            KGPD EVY HEIPGGQLTNLLFQAQQ GLGE+W ETKRAY+EAN+LLGDIVKVTPTSKVV
Sbjct: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908

Query: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963
            GDLAQFMVTN+  S+D+KRLAN+LDFPDS+MDFFEGL+GQPYGGFPEPLRSDILRNKRRK
Sbjct: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968

Query: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023
            LT RPGLEL PF+++ IREDLE RFG+IDECD+ASYNMYPKVYEDFQK+KE YGDLSVLP
Sbjct: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028

Query: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083
            TK+FL+P  + E+IEV +EQGKTLI+KLQA+GDLNK TG+R+VYF+LNGE+RKIRV DRS
Sbjct: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088

Query: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143
            QKVE ++KPKAD HDP+QIGAPMAGV+VEVKVHKGSLVKKG+ VA+LSAMKMEMV+SS A
Sbjct: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148

Query: 1144 DGQVKEVLVSNGNAVDASDLLVVLEDAVAPVE 1175
            DGQVK+V V +   V+ASDLLV+LE+ + P E
Sbjct: 1149 DGQVKDVFVKDAENVEASDLLVLLEEEIPPQE 1180

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 2012 bits (5213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1168 (81%), Positives = 1048/1168 (89%)

Query: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64
            +L+GLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63

Query: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124
            +YVIGE+G++TPVGAYLAIDEIINIAK H V+FIHPGYGFLSENSEFA+KVA +GITW+G
Sbjct: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123

Query: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXX 184
            PPA VIDSVGDKVSAR LA +A+VP VPGTPGPI++V+EA+ FV +YG+PVIIKAAF   
Sbjct: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGG 183

Query: 185  XXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244
                       DI+DAFQRA SEA+TAFG+GTCF+ERFLD PKHIEVQLL DNYGNVVHL
Sbjct: 184  GRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243

Query: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAK +P EVRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303

Query: 305  YFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEITGID+V                   D+ITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITT 363

Query: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424
            EDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG+VISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483

Query: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPA 544
            LHYLADLAVNGSSIKGQIGLPKL  +P +PHLH+ +G++++V+  P AGWR VLL+ GP 
Sbjct: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDYGPE 543

Query: 545  EFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGAT 604
            EFAKQVR F GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA+SGAFALECWGGAT
Sbjct: 544  EFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGAT 603

Query: 605  FDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 664
            FDV+MRFLHEDPW RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV
Sbjct: 604  FDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 663

Query: 665  DIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIVQ 724
            DIFRVFDALNDL+QL                  CYSGDML PGKKYNLDYYL++TEKIV 
Sbjct: 664  DIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKIVN 723

Query: 725  MGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGAD 784
             GTHILGIKDMAGT+KP+AARLLIGSIRAKYP+LPIHVHTHDSAGT V+SM   ALSGAD
Sbjct: 724  SGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGAD 783

Query: 785  VVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLK 844
            VVDVA NSMSGLTSQPSINALLA+LDG+ID  +NV  VRELDAYWAEMRLLYSCFEADLK
Sbjct: 784  VVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADLK 843

Query: 845  GPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVG 904
            GPD EVY HEIPGGQLTNLLFQAQQ GLGE+WAETKRAYREAN LLGD+VKVTPTSKVVG
Sbjct: 844  GPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVVG 903

Query: 905  DLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKL 964
            DLAQFMV+NK  SDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLR+D+LRNKRRKL
Sbjct: 904  DLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRKL 963

Query: 965  TTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPT 1024
            T RPGLELAPF ++ I+EDL TRF DIDECD+ASYNMYPKVYEDF+KIKEKYGDLSVLPT
Sbjct: 964  TQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLPT 1023

Query: 1025 KSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQ 1084
            K+FLSP  + EEI VTIEQGKTLI+K QAIGDLNK TG+REVYF+LNGELRK+ V DRSQ
Sbjct: 1024 KNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRSQ 1083

Query: 1085 KVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPAD 1144
            KVE+++KPKADAHDP+QIG+PMAGVVVEVKVHKGSL+ KG+ VAVLSAMKMEMVISSPAD
Sbjct: 1084 KVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPAD 1143

Query: 1145 GQVKEVLVSNGNAVDASDLLVVLEDAVA 1172
            GQVKEVLV +G  VDASDLLVVLE+A A
Sbjct: 1144 GQVKEVLVKDGENVDASDLLVVLEEAPA 1171

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 1996 bits (5172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1166 (82%), Positives = 1041/1166 (89%)

Query: 6    LSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADES 65
            L+GLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE+
Sbjct: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66

Query: 66   YVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGP 125
            YVIG+EG++TPVGAYLAIDEII+IAKKH VDFIHPGYGFLSEN+EFADKV KAGITWIGP
Sbjct: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126

Query: 126  PAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXX 185
            P EVI+SVGDKVSAR LAA+A+VPTVPGTPGPI++V+EA+DFV +YGYPVIIKAA+    
Sbjct: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGG 186

Query: 186  XXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLF 245
                      D+ DAFQRA SEA+TAFG+GTCFVERFLD PKHIEVQLL DN+GNVVHLF
Sbjct: 187  RGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246

Query: 246  ERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRHY 305
            ERDCSVQRRHQKVVEVAPAK +PREVRD+ILTDAV+LAKE GYRNAGTAEFLVDNQNRHY
Sbjct: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306

Query: 306  FIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTE 365
            FIEINPRIQVEHTITEEITGIDLV                   DRITTRGFAIQCRITTE
Sbjct: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366

Query: 366  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 425
            DPAKNFQPDTGRLEVYRSAGGNGVRLDGG AYAGAVISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426

Query: 426  KMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKLL 485
            KM+RALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF MVSS+NRAQKLL
Sbjct: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486

Query: 486  HYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPAE 545
            HYLADLAVNGSSIKGQIG PKLK +P +P LHD +G+ ++V+ PP  GWR +L  +GP  
Sbjct: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEGPEA 546

Query: 546  FAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGATF 605
            FAK VR+ QGTL+MDTTWRDAHQSLLATRVRT+DLA IA TTAHA +GAFALECWGGATF
Sbjct: 547  FAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGGATF 606

Query: 606  DVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 665
            DVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD
Sbjct: 607  DVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 666

Query: 666  IFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIVQM 725
            IFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYL+VTEKIV M
Sbjct: 667  IFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKIVAM 726

Query: 726  GTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGADV 785
            GTHILGIKDMAGTMKPAAA+LLIG+IRAK+PDLPIHVH+HDSAGTAV+SM   AL+GADV
Sbjct: 727  GTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGADV 786

Query: 786  VDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLKG 845
            VDVAINSMSGLTSQ S+NA+LASLDGQIDTGINV++V ELDAYWAEMRLLYSCFEADLKG
Sbjct: 787  VDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLKG 846

Query: 846  PDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVGD 905
            PD EVY HEIPGGQLTNLLFQAQQ GLGE+W ETK+AY++AN LLGDIVKVTPTSKVVGD
Sbjct: 847  PDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGD 906

Query: 906  LAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKLT 965
            LAQFMV+N+   DDI+RLAN+LDFPDS+MDFFEGL+GQPYGGFPEPLR+DIL+NKRRKL 
Sbjct: 907  LAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRRKLN 966

Query: 966  TRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPTK 1025
             RPGLELAPF++  IREDLE RFGDI+ECD+ASYNMYPKVYEDFQKI E+YGDLSVLPT+
Sbjct: 967  RRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTR 1026

Query: 1026 SFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQK 1085
            +FL+   V EEIEV IEQGKTLI+KLQA+GDLN+ TG+REVYF+LNGE RKIR+ D+SQ 
Sbjct: 1027 NFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQV 1086

Query: 1086 VETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADG 1145
            V+TIAKPKAD HDP QIGAPMAGV+VEVKVHKGS VKKG+ VAVLSAMKMEMVISS  +G
Sbjct: 1087 VQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEG 1146

Query: 1146 QVKEVLVSNGNAVDASDLLVVLEDAV 1171
             VK+VLV +G  VDASDLLVVLE+ V
Sbjct: 1147 LVKDVLVKDGENVDASDLLVVLEEEV 1172

>Kwal_14.1803
          Length = 1174

 Score = 1989 bits (5154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/1170 (81%), Positives = 1045/1170 (89%), Gaps = 1/1170 (0%)

Query: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64
            KL+GLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62

Query: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124
            +Y+IG++G++TPVGAYLAIDEI+ IAK+H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122

Query: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXX 184
            P AEVIDSVGDKVSAR LAA+A+VP VPGTPGPI SV+EA+ FVA+YGYPVIIKAAF   
Sbjct: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGG 182

Query: 185  XXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244
                       DI DAFQRA+SEA T+FG+GTCF+ERFL+ PKHIEVQLL D YGNVVHL
Sbjct: 183  GRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242

Query: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAK +P++VRDAILTDAVKLA    Y+NAGTAEFLVD+QNRH
Sbjct: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302

Query: 305  YFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEITGID+V                   DRITTRGFAIQCRITT
Sbjct: 303  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITT 362

Query: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424
            EDPAKNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LFKMVSSQNRAQKL
Sbjct: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482

Query: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINV-ATPPTAGWRKVLLEQGP 543
            LHYLADLAVNGSSIKGQ+GLPKL   P VP +HDA+GNVI+V  T P +GWR+VLLE+GP
Sbjct: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542

Query: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603
            AEFAK VR   GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHALSGAFALECWGGA
Sbjct: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602

Query: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663
            TFDVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 664  VDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIV 723
            VDIFRVFDALNDL+QL                  CYSGDMLQ GKKYNLDYYLE+T+KIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKIV 722

Query: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783
             MGTHILGIKDMAGT+KP+AA+LLIGSIRAKYPDLPIHVHTHDSAGTAV+SM   A +GA
Sbjct: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782

Query: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843
            DVVDVA NSMSGLTSQPSINALLASLDG+I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842

Query: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903
            KGPD EVYQHEIPGGQLTNLLFQAQQ GLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902

Query: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963
            GDLAQFMV+NK +SDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLRSD+L+NKRRK
Sbjct: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962

Query: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023
            LT RPGLE+APF++  I+EDL+ RFGDI+ECD+ASYNMYPKVYEDF+KI+E YGDLSVLP
Sbjct: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083
            TK+FLSP  V EEI VTIE+GKTLI+K QAIG+LNK TG+REVYFDLNGELRK+ VVD+S
Sbjct: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082

Query: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143
            QKV+ I+KPKADAHD YQIGAPMAGV++EVKVH GSLVK+G+ VAVLSAMKMEMVISSP 
Sbjct: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142

Query: 1144 DGQVKEVLVSNGNAVDASDLLVVLEDAVAP 1173
            DGQVKEVLV +G  VDASDLLV LE++V P
Sbjct: 1143 DGQVKEVLVKDGENVDASDLLVYLEESVPP 1172

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1945 bits (5039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1164 (80%), Positives = 1019/1164 (87%)

Query: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64
            +L+G R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLS HR KADE
Sbjct: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63

Query: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124
            +Y+IG EGQ+TPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123

Query: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXX 184
            PPA VI++VGDKVSAR LAA ADVPTVPGT GPI SV+EAE+FV +YGYPVIIKAAF   
Sbjct: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGG 183

Query: 185  XXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244
                       DI DAFQRA SEA TAFG+GTCFVERFLD PKHIEVQLL DNYGNVVHL
Sbjct: 184  GRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243

Query: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAK + +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303

Query: 305  YFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEITG+D+V                   DRITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITT 363

Query: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424
            EDP+KNFQPDTGRL+VYRSAGGNGVRLDGGNA+AGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483

Query: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPA 544
            L YL+DLAVNGSSIKGQ+G+PKL   P +P LH+A+G VI+V + P AGWR+VLLE GP 
Sbjct: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEHGPE 543

Query: 545  EFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGAT 604
             FAK+VR F GTLL DTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+GAFALECWGGAT
Sbjct: 544  VFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGAT 603

Query: 605  FDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 664
            FDVAMRFLHEDPW RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGV
Sbjct: 604  FDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGV 663

Query: 665  DIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGDMLQPGKKYNLDYYLEVTEKIVQ 724
            DIFRVFDALNDL+QL                  CYSGDMLQPGKKYNLDYYLE+TEKIV 
Sbjct: 664  DIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIVA 723

Query: 725  MGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGAD 784
            MGTHILGIKDMAGTMKP AA+LLIGSIRAKYPDLPIHVHTHDSAGT V+SM   A+SGAD
Sbjct: 724  MGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGAD 783

Query: 785  VVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLK 844
            VVDVA NSMSGLTSQPSI AL ASL G I TG++  +  ELDAYWAEMRLLYSCFEADLK
Sbjct: 784  VVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADLK 843

Query: 845  GPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVG 904
            GPD EVY+HEIPGGQLTNLLFQAQQ GLGEQWAETKRAY EAN LLGD+VKVTPTSKVVG
Sbjct: 844  GPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVVG 903

Query: 905  DLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKL 964
            DLAQFMV+N+ NSDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLRSD+LRNKRRKL
Sbjct: 904  DLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRKL 963

Query: 965  TTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPT 1024
              RPGLELAPF++  IRE+L +RF +IDECD+ASYNMYPKVYEDF+KI+E YGDLSVLPT
Sbjct: 964  KVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLPT 1023

Query: 1025 KSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQ 1084
             +FLSP  + EEI VTIEQGK LI+KLQAIGDLNK TG REVYF+LNGELRK+ V D+SQ
Sbjct: 1024 HNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKSQ 1083

Query: 1085 KVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPAD 1144
            K+ET++K KADAHD +Q+GAPMAGV++EVKVHKGS V KG+ VAVLSAMKMEMVISSP+D
Sbjct: 1084 KLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSD 1143

Query: 1145 GQVKEVLVSNGNAVDASDLLVVLE 1168
            GQVK+V VS+G  V+ASDLLV LE
Sbjct: 1144 GQVKDVFVSDGETVEASDLLVQLE 1167

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1942 bits (5032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/1130 (82%), Positives = 1011/1130 (89%)

Query: 43   MRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGY 102
            M+TVAIYS+EDRLS HRLKADE+Y+IGE G++TPVGAYLAIDEII+IAK+H V FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 103  GFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVK 162
            GFLSEN+EFA KV  AGITWIGPP EVI+SVGDKVSAR LAA+A+VPTVPGTPGPI+SV+
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 163  EAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERF 222
            EAE FVA+YGYPVIIKAAF              DI DAFQRA+SEA TAFG+GTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 223  LDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKL 282
            LD PKHIEVQLL DNYGNV+HLFERDCSVQRRHQKVVEVAPAK +P+EVRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 283  AKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXX 342
            AKE  YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEITG+D+V             
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 343  XXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVI 402
                  D+ITTRGFAIQCRITTEDP+KNFQPDTGR+EVYRSAGGNGVRLDGGNAYAGAVI
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 403  SPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWT 462
            SPHYDSMLVKCSCSGSTYEIVRRKM+RALIEFRIRGVKTNIPFLLTLLTH VF SG+YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 463  TFIDDTPQLFKMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGN 522
            TFIDDTPQLF+MVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKL   P VP LHD+ GN
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 523  VINVATPPTAGWRKVLLEQGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLAT 582
            V++V   P AGWR VLLEQGP  FAKQVR + GTLLMDTTWRDAHQSLLATRVRTHDLAT
Sbjct: 481  VVDVLAAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLAT 540

Query: 583  IAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGV 642
            IAPTTAHAL+GAFALECWGGATF VAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGV
Sbjct: 541  IAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGV 600

Query: 643  AYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLDQLXXXXXXXXXXXXXXXXXXCYSGD 702
            AYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDL+QL                  CYSGD
Sbjct: 601  AYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGD 660

Query: 703  MLQPGKKYNLDYYLEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHV 762
            MLQPGKKYNLDYYLE+T+KIV+MGTHILGIKDMAGT+KP+AA+LLIGSIRAKYPDLPIHV
Sbjct: 661  MLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHV 720

Query: 763  HTHDSAGTAVSSMTVAALSGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNV 822
            HTHDSAGTAV+SM   AL+GADVVDVA NSMSGLTSQPSINALLASLDG+I+  ++V  V
Sbjct: 721  HTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNMV 780

Query: 823  RELDAYWAEMRLLYSCFEADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRA 882
            RELDAYWA+MRLLYSCFEADLKGPD EVYQHEIPGGQLTNLLFQAQQ GLGE+WAETKRA
Sbjct: 781  RELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKRA 840

Query: 883  YREANYLLGDIVKVTPTSKVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIG 942
            YREANYLLGD+VKVTPTSKVVGDLAQFMVTNK NSDD++RLA++LDFPDS+MDFFEGLIG
Sbjct: 841  YREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLIG 900

Query: 943  QPYGGFPEPLRSDILRNKRRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMY 1002
            QPYGGFPEPLR+D+L+NKRRKLT RPGLEL PF+++ I+EDL +RFGDIDECD+ASYNMY
Sbjct: 901  QPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNMY 960

Query: 1003 PKVYEDFQKIKEKYGDLSVLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATG 1062
            PKVYEDF+KI+E+YGDLSVLPTK+FLSP  V EEI VTIEQGKTLI+K QAIGDLNK TG
Sbjct: 961  PKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDTG 1020

Query: 1063 VREVYFDLNGELRKIRVVDRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVK 1122
            +REVYF+LNGELRK+ VVDRSQKVETI+KPKADAHDPYQ+GAPMAGVVVEVKVHKGSLVK
Sbjct: 1021 IREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLVK 1080

Query: 1123 KGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLEDAVA 1172
            KG+ VAVLSAMKMEMVISSPA G VK+VL+ +G  VD+SDLLVVLEDA A
Sbjct: 1081 KGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGENVDSSDLLVVLEDAPA 1130

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  303 bits (775), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 177/456 (38%), Positives = 256/456 (56%), Gaps = 11/456 (2%)

Query: 12   NFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEE 71
            N S  G    +LVANRGEI +RI ++   + ++++AIYS  D+ S H L  D +  +  +
Sbjct: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQAL--D 680

Query: 72   GQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVID 131
            G  T    YL +++II+IAKK+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I 
Sbjct: 681  GH-TVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739

Query: 132  SVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXX 191
             +G K SAR +A  A VP VPG+P  +K+  EA       GYPV++K+            
Sbjct: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798

Query: 192  XXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSV 251
                D+  AF+    +  + FGD   F+E+F+D+ +H+EVQ++GD  G  + L ERDCS+
Sbjct: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858

Query: 252  QRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEIN 310
            QRR+QKV+E  PA N+PRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918

Query: 311  PRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKN 370
             R+QVEH ITE +TG+DLV                     I+  G +I+ R+  E+P K+
Sbjct: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEF---NISQNGASIEVRVYAENPLKD 975

Query: 371  FQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
            F+P  G  E+      N  R+D      G  ISP +D  L K    G        KM +A
Sbjct: 976  FRPSPG--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKA 1032

Query: 431  LIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 466
            L E +I G  TN+ +L +L++  +F +    T +++
Sbjct: 1033 LNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (62%)

Query: 1102 IGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDAS 1161
            I +  AG   +  V  G+ ++K + VAV+ AMK EM++SS   G++K+ L  NG+ VDA 
Sbjct: 1766 IFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFLFKNGDMVDAG 1825

Query: 1162 DLLVVLE 1168
            D + +++
Sbjct: 1826 DPVAIIQ 1832

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  286 bits (732), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 172/471 (36%), Positives = 256/471 (54%), Gaps = 19/471 (4%)

Query: 5    KLSGLRDNFSLLGEK--------NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLS 56
            K  G R  F +L +K        + +L+ANRGEI +RI ++  +L +R+VA+YS  D+ S
Sbjct: 611  KYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670

Query: 57   THRLKADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVA 116
             H   AD S  +      T    YL +++II+ AK+     I PGYGFLSEN++F+D   
Sbjct: 671  QHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727

Query: 117  KAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVI 176
             AGIT++GP  ++I  +G K SAR +A +A VP VPG+   I SV+EA+   A+  YPV+
Sbjct: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVM 786

Query: 177  IKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGD 236
            +K+                DI   F+    +  T FGD   F+ERF+++ +H+EVQL+GD
Sbjct: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846

Query: 237  NYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEF 296
             +G  + L ERDCS+QRR+QKV+E  PA N+P + R A+   A  L     Y+ AGT EF
Sbjct: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906

Query: 297  LVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRG 355
            + D  ++  YF+E+N R+QVEH ITE +TG+DLV                    ++   G
Sbjct: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDST---KVEVNG 963

Query: 356  FAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSC 415
             +++ R+  E+P KNF+P  G L   +    +  R+D      G  ISP YD  L K   
Sbjct: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020

Query: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 466
             G   +    K+ +AL E ++ G  TNI +L +++T   F      T  ++
Sbjct: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 36/51 (70%)

Query: 1118 GSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLE 1168
            G +++ G+ + ++ AMK EM+IS+P  G++ ++   NG+ VD+ D++ V+E
Sbjct: 1782 GDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDMVDSGDIVAVIE 1832

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  278 bits (710), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 160/446 (35%), Positives = 244/446 (54%), Gaps = 11/446 (2%)

Query: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81
            +L+ANRGEI +RI ++   + +++VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141
             ID+IIN AKK     I PGYGFLSEN++F+D+ ++  I ++GP  + I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAF 201
            +A RA VP VPG+ G IK  KEA++   +  YPV++K+                DI   F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261
            +    +  + FGD   F+ERF+++ +H+E+Q++GD +G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 320
             PA N+P   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 321  EEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 380
            E +TG+DLV                    +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 923  EMVTGLDLVEWMLRIAANDSPDFDNT---KIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 381  YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 441  TNIPFLLTLLTHPVFISGDYWTTFID 466
            TNI +L ++ +  +F      T  +D
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 11/99 (11%)

Query: 1071 NGELRKIRVVDRSQKVETIAKPKADAHDPY--QIGAPMAGVVVEVKVHKGSLVKKGEAVA 1128
            N EL+K    D+ Q VE         +  Y  +   P+A V        G  V+ G+ V 
Sbjct: 1739 NAELKK-SGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAV--------GDHVEAGDGVI 1789

Query: 1129 VLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVL 1167
            ++ AMK EMV+ +   G+V ++L  NG+ V+A DL+ V+
Sbjct: 1790 IIEAMKTEMVVGATKSGKVYKILHKNGDMVEAGDLVAVI 1828

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  277 bits (709), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 165/459 (35%), Positives = 243/459 (52%), Gaps = 14/459 (3%)

Query: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81
            +L+ANRGEI +RI ++  +L++R+VA+YS  D+ S H + AD    +      T    YL
Sbjct: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685

Query: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141
             ID+II  AK      I PGYGFLSEN+EFADK  + GI ++GP  E I  +G K SAR 
Sbjct: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745

Query: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAF 201
            +A +A VP VPG+ G + S KEA++   +  YPV++K+                +I   F
Sbjct: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804

Query: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261
            +    +    FGD   F+ERF+++ +H+E+Q++GD YG  + + ERDCS+QRR+QK++E 
Sbjct: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864

Query: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320
             PA N+    R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924

Query: 321  EEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 380
            E +TG+DLV                     I   G +I+ R+  E+PAK+F+P  G L  
Sbjct: 925  EMVTGLDLVEWMLRIAADDAPDFESA---NIVVTGASIEARLYAENPAKDFRPSPGLLTD 981

Query: 381  YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440
                     R+D   +  G  +S  YD  L K    G        KM +AL E  + G  
Sbjct: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038

Query: 441  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKMVS 476
            TNI +L ++ +  +F +    T  +D     P  F++ S
Sbjct: 1039 TNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 1075 RKIRVVDRSQKVETIAKPKADAHDPYQIGAPM-----AGVVVEVKVHKGSLVKKGEAVAV 1129
            R I+V +  Q++E+    K+   + Y   A M     +G   +  V  G  V KG+ + +
Sbjct: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791

Query: 1130 LSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLE 1168
            + AMK EMV+ +   G+V +++  NG+ VDA  ++ V++
Sbjct: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGDMVDAGGIVAVIQ 1830

>Scas_721.40
          Length = 1834

 Score =  276 bits (706), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 157/438 (35%), Positives = 247/438 (56%), Gaps = 17/438 (3%)

Query: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686

Query: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141
             I++II+ AKK     I PGYGFLSEN++F+++    GIT++GP  +V+  +G K SAR 
Sbjct: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746

Query: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAF 201
            +A +A+VP VPG+   I +  EA++  A+  YP+++K+                DI   F
Sbjct: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805

Query: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261
            +    +    FGD   F+ERF+++ +H+EVQ++GD  GN + + ERDCS+QRR+QK++E 
Sbjct: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865

Query: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320
             PA N+P   R  +   A +L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925

Query: 321  EEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRL-- 378
            E +TGIDLV                    +I   G A++ R+  E+P  +F+P  G+L  
Sbjct: 926  EMVTGIDLVEWMLVIAADMAPDFNQL---KIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982

Query: 379  -EVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIR 437
             E  + A     R+D   +  G +++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036

Query: 438  GVKTNIPFLLTLLTHPVF 455
            G  TNI +L ++ +  +F
Sbjct: 1037 GCITNIDYLRSISSSEMF 1054

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 39/58 (67%)

Query: 1115 VHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLEDAVA 1172
            V +G  VK G+ + ++ AMK EM++ +  DG+V +++  NG+ VD+ DL+VV+E   A
Sbjct: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNGSMVDSGDLVVVIEPIFA 1834

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  265 bits (677), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 163/461 (35%), Positives = 239/461 (51%), Gaps = 19/461 (4%)

Query: 20   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGA 79
            + +LVANRGEI +RI R+   L +R+VA+YS  DR S H   AD +  +G     +    
Sbjct: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679

Query: 80   YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSA 139
            YL ID+I+  AKK     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739

Query: 140  RYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDIND 199
            R LAA A VP   GT G ++S   A +   + GYP+++K+                ++  
Sbjct: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798

Query: 200  AFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVV 259
            AF++   +    F D   F+E F+   +H+EVQ++GD +G  V L ERDCS+QRR+QK++
Sbjct: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858

Query: 260  EVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 318
            E  PA N+P   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918

Query: 319  ITEEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRL 378
            ITE +TG+DLV                     +   G +++ R+  E+P K F P  G L
Sbjct: 919  ITEMVTGLDLVEWMLRIAANTPPDFDAG----VEIEGVSMEARVYVENPVKGFTPSPGLL 974

Query: 379  E--VYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 436
               V+ S      R+D      G  ++  YD  L K    G   E    K++ AL E RI
Sbjct: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029

Query: 437  RGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKM 474
             G  TN+ +L ++ +   F     +T  ++D   TP  F++
Sbjct: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1074 LRKIRVVDRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAM 1133
            L K+   D    V   A+P     D + + +  AG   +  V  G  VK+G+ + ++ AM
Sbjct: 1723 LIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAM 1782

Query: 1134 KMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLEDA 1170
            K EMV+S+ ADG+V  +L +NG+ VDA +L+VVL++ 
Sbjct: 1783 KTEMVVSATADGEVINILHANGDMVDAGNLVVVLKNC 1819

>Kwal_27.11951
          Length = 1869

 Score =  264 bits (675), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 164/459 (35%), Positives = 251/459 (54%), Gaps = 14/459 (3%)

Query: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81
            +LVANRGEI +RI ++  +L +++VA+YS  D+ S H   AD +  +  +G+ T    YL
Sbjct: 668  VLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVAL--KGR-TAAETYL 724

Query: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141
             ID+II  AK+   + I PGYGFLSEN++F+D+ A  GI ++GP  + I  +G K SAR 
Sbjct: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784

Query: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAF 201
            +A +A VP VPG+ G +K+ +EA +      YPV++K+                DI   F
Sbjct: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843

Query: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261
            +    +    FGD   F+ERF+++ +H+E+Q++GD  G  + + ERDCS+QRR+QKV+E 
Sbjct: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903

Query: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320
             PA N+  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963

Query: 321  EEITGIDLVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 380
            E +TG+DLV                    +IT  G +I+ R+  E+P K+F+P  G+L  
Sbjct: 964  EMVTGLDLVEWMLLIAAGTPPDFDAT---KITVTGASIEARLYAENPVKDFRPSPGQLT- 1019

Query: 381  YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440
               +     R+D   +  G  IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077

Query: 441  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKMVS 476
            TNI +L ++ +  +F +    T  +D     P  F++ S
Sbjct: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 39/54 (72%)

Query: 1115 VHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNAVDASDLLVVLE 1168
            V  G +VK G+ + V+ AMK EM++S+P  G+V +V+  NG+ V+A D++VV++
Sbjct: 1816 VSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGDMVEAGDVVVVIQ 1869

>Scas_720.74
          Length = 2231

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 235/518 (45%), Gaps = 83/518 (16%)

Query: 20  NKILVANRGEIPIRIFRS---------AHELSMRTVAIYSHEDRLSTHRLKADESYV-IG 69
           +KIL+AN G   ++  RS          +E +++ VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMA 113

Query: 70  EEGQFTPVGA----YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVA--KAGITWI 123
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K+A  K  + +I
Sbjct: 114 DQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFI 173

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKE---------AEDFVAQ---- 170
           GPP   + S+GDK+S+  +A  A VP +P +   I  V+          A++  AQ    
Sbjct: 174 GPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCS 233

Query: 171 -----------YGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFV 219
                       G+PV+IKA+               D    + +A++E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 220 ERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDA 279
            +     +H+EVQLL D YGN + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSA 349

Query: 280 VKLAKECGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITGIDL---------- 328
           V+L K  GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +TG++L          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMG 409

Query: 329 ----------VXXXXXXXXXXXXXXXXXXXDRITT------RGFAIQCRITTEDPAKNFQ 372
                     V                   + + T      +G    CRIT+EDP + F+
Sbjct: 410 IPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFK 469

Query: 373 PDTGRLEV--YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGSLHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 431 LIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 467
           L E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V+  V  G  +  G+  A +  MKM+M + +   G + ++L   G+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETG-IIQLLKQPGS 756

Query: 1157 AVDASDLLVVL 1167
             + A D++ +L
Sbjct: 757  TLSAGDIIAIL 767

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  191 bits (485), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 161/566 (28%), Positives = 248/566 (43%), Gaps = 86/566 (15%)

Query: 7   SGLRDNFSLLGEK---NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHED- 53
           S LRD   L G     +KIL+AN G   ++  RS  + +  T         V + + ED 
Sbjct: 44  SPLRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDL 103

Query: 54  RLSTHRLKADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFAD 113
             +T  ++  + YV    G  T    Y  +D I+++A++  VD +  G+G  SEN    +
Sbjct: 104 EANTEYIRMADQYVEVPGG--TNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPE 161

Query: 114 KVAKAG--ITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPI---------KSVK 162
           K+A++   + +IGPP   + S+GDK+S+  +A  A VP +P +   +         K V 
Sbjct: 162 KLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVS 221

Query: 163 EAEDF---------------VAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSE 207
            A+D                  Q G+PV++KA+               D    +Q+A++E
Sbjct: 222 VADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE 281

Query: 208 ALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNI 267
                     F+ +     +H+EVQLL D YG  + LF RDCSVQRRHQK++E AP    
Sbjct: 282 ----IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIA 337

Query: 268 PREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEITGI 326
             +    +   AV+L K  GY +AGT E+L  + +++ YF+E+NPR+QVEH  TE +TG+
Sbjct: 338 KPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGV 397

Query: 327 DLVXXXXXXXX--------------------------XXXXXXXXXXXDRITTRGFAIQC 360
           +L                                               R   +G    C
Sbjct: 398 NLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTAC 457

Query: 361 RITTEDPAKNFQPDTGRLEV--YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGS 418
           RIT+EDP + F+P  G L    +RS+         GN      I    DS        G 
Sbjct: 458 RITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGE 514

Query: 419 TYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSS 477
             +  R+ M+ AL E  IRG  +T + +L+ LL    F      T ++DD      ++S 
Sbjct: 515 NRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQ 568

Query: 478 QNRAQKLLHYLADLAVNGSSIKGQIG 503
           +  A+K    LA   + G++ K  I 
Sbjct: 569 KISAEKPDPMLA--VICGATTKAHIA 592

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V   V  G  ++ G+  A +  MKM+M + +   G V ++L   G+
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESG-VLQLLRQPGS 756

Query: 1157 AVDASDLLVVL 1167
             + A D+L +L
Sbjct: 757  TLAAGDILAIL 767

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 154/534 (28%), Positives = 239/534 (44%), Gaps = 89/534 (16%)

Query: 20  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADESYV-IG 69
           +K+L+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMA 113

Query: 70  EEGQFTPVGA----YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAG--ITWI 123
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K+A++   I +I
Sbjct: 114 DQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFI 173

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVP--GT----------------------PGPIK 159
           GPP   + S+GDK+S+  +A  A VP +P  GT                       G   
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCS 233

Query: 160 SVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFV 219
           S ++  +   + G+PV+IKA+               D  + + +A++E          F+
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFI 289

Query: 220 ERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDA 279
            +     +H+EVQLL D YG  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAA 349

Query: 280 VKLAKECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDL---------- 328
           V+L K  GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +TG++L          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMG 409

Query: 329 ----------VXXXXXXXXXXXXXXXXXXXDRITT------RGFAIQCRITTEDPAKNFQ 372
                     +                   D + T      +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFK 469

Query: 373 PDTGRLEV--YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLNELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 431 LIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQK 483
           L E  IRG  +T + +L+ LL    F      T ++DD      ++S++  A+K
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTAKK 574

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V+  V  G  +  G+A A +  MKM+M + S  +G V ++L   G+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKMQMPLLSQENGIV-QLLKQPGS 756

Query: 1157 AVDASDLLVVL 1167
             + A D++ +L
Sbjct: 757  TIAAGDIIAIL 767

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  185 bits (469), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 154/561 (27%), Positives = 249/561 (44%), Gaps = 91/561 (16%)

Query: 20  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADESYV-IG 69
           +K+L+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMA 114

Query: 70  EEGQFTPVGA----YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKA--GITWI 123
           ++    P G     Y  +D I+ +A++  VD +  G+G  SEN    +++A +   I +I
Sbjct: 115 DQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFI 174

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSV---KEA-----EDFVAQ----- 170
           GPP   + S+GDK+S+  +A  A VP +P +   +  V   KE      ED V Q     
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCS 234

Query: 171 -----------YGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFV 219
                       G+P+++KA+               +    +Q+A++E          F+
Sbjct: 235 SPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFI 290

Query: 220 ERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDA 279
            +     +H+EVQLL D YG  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAA 350

Query: 280 VKLAKECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXX- 337
           V+L +  GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +TG++L          
Sbjct: 351 VRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMG 410

Query: 338 -------------------------XXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQ 372
                                                + T +G    CRIT+EDP + F+
Sbjct: 411 IPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFK 470

Query: 373 PDTGRLEV--YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 471 PSGGALHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 431 LIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKLLHYLA 489
           L E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A+K    L+
Sbjct: 528 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEKPDRTLS 581

Query: 490 DLAVNGSSIKGQIGLPKLKKN 510
              + G++ K  I   K +++
Sbjct: 582 --VICGAATKAHIASQKARED 600

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V+  V  G  V  G+  A +  MKM+M + S  +G V ++L   G+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVV-QLLKQPGS 757

Query: 1157 AVDASDLLVVL 1167
             + A D+L +L
Sbjct: 758  TLAAGDILAIL 768

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 149/518 (28%), Positives = 225/518 (43%), Gaps = 83/518 (16%)

Query: 20  NKILVANRGEIPIRIFRSAHELSMRT---------VAIYSHEDRLSTHRLKADESYV-IG 69
           +KIL+AN G   ++  RS  + +  T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMA 113

Query: 70  EEGQFTPVGA----YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVA--KAGITWI 123
           ++    P G     Y  +D I++IA++  VD +  G+G  SEN    +K++  K  + +I
Sbjct: 114 DQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFI 173

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVP--GTPGPIKSVKEAEDFVA------------ 169
           GPP   + S+GDK+S+  +A  A VP +P  GT      V E    V+            
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCT 233

Query: 170 ----------QYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFV 219
                     + G+PV+IKA+               D    + +A++E          F+
Sbjct: 234 SPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 220 ERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDA 279
            +     +H+EVQLL D YG  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAA 349

Query: 280 VKLAKECGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXX- 337
           V+L K  GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++G++L          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 409

Query: 338 -------------------------XXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQ 372
                                                R   +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK 469

Query: 373 PDTGRLEV--YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
           P  G L    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLHELNFRSSSNVWGYFSVGN---NGNIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 431 LIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 467
           L E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V+  V  G  + KG+  A +  MKM+M + S  +G V ++L   G+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIV-QLLKQPGS 756

Query: 1157 AVDASDLLVVL 1167
             + A D++ ++
Sbjct: 757  TIVAGDIMAIM 767

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  183 bits (465), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 135/462 (29%), Positives = 213/462 (46%), Gaps = 57/462 (12%)

Query: 80  YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKA--GITWIGPPAEVIDSVGDKV 137
           Y  ID I+++A++  VD +  G+G  SEN    + +A +   I +IGPP   + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 138 SARYLAARADVPTVPGTPGPIKSV------------------------KEAEDFVAQYGY 173
           S+  +A  A +P +P +   I ++                        ++A +     G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 174 PVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQL 233
           PV+IKA+               D  D F     +A+        FV + +   +H+EVQL
Sbjct: 174 PVMIKAS----EGGGGKGIRRVDNEDDFIALYRQAVNETPGSPMFVMKVVTDARHLEVQL 229

Query: 234 LGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGT 293
           L D YG  + LF RDCS+QRRHQK++E AP      E    +   A++L +  GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 294 AEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDL------------------VXXXXX 334
            E+L     ++ YF+E+NPR+QVEH  TE I+G++L                  +     
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 335 XXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV--YRSAGGNGVRLD 392
                          R + +G  I CRIT+EDP + F+P TG++    +RS+        
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 393 GGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLT 451
            GN      I    DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL 
Sbjct: 410 VGN---NGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLE 466

Query: 452 HPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKLLHYLADLAV 493
              F S +  T ++DD   + K +SS ++    L  +   A+
Sbjct: 467 TRDFESNNISTGWLDDL--ILKNLSSDSKLDPTLAIICGAAM 506

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 1098 DPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGNA 1157
            +P Q+ +P  G +V+  V  G  V  G+  A +  MKM+M + + +DG V E+L   G+ 
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDG-VIELLRQPGSI 676

Query: 1158 VDASDLLVVL 1167
            ++A D++  L
Sbjct: 677  IEAGDVIAKL 686

>Kwal_23.6157
          Length = 2230

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 149/534 (27%), Positives = 237/534 (44%), Gaps = 89/534 (16%)

Query: 20  NKILVANRGEIPIRIFRS---------AHELSMRTVAIYSHED-RLSTHRLKADESYVIG 69
           +K+L+AN G   ++  RS          +E +++ VA+ + ED   +   L+  + YV  
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEV 120

Query: 70  EEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKA--GITWIGPPA 127
             G  T    Y  +D I+ +A++  VD +  G+G  SEN    +++A +   + +IGPP 
Sbjct: 121 PGG--TNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPG 178

Query: 128 EVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVK---------------------EAED 166
             + S+GDK+S+  +A  A VP +P +   +  V                        ED
Sbjct: 179 NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPED 238

Query: 167 FVAQ---YGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFL 223
            +A+    G+PV++KA+               D    +++A++E          F+ +  
Sbjct: 239 GLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFIMKLA 294

Query: 224 DHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLA 283
            + +H+EVQLL D YG  + LF RDCSVQRRHQK++E AP      +    +   AV+L 
Sbjct: 295 GNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLG 354

Query: 284 KECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITGIDLVXXXXXXXXXX--- 339
           K  GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++G++L              
Sbjct: 355 KLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMH 414

Query: 340 -----------------------XXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTG 376
                                            R T +G    CRIT+EDP + F+P  G
Sbjct: 415 RIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGG 474

Query: 377 RLEV--YRSA----GGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
            L    +RS+    G   V   GG       I    DS        G   +  R+ M+ A
Sbjct: 475 SLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 431 LIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQK 483
           L E  IRG  +T + +L+ LL    F      T ++DD      ++S +  A+K
Sbjct: 528 LKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1097 HDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPADGQVKEVLVSNGN 1156
            +DP Q+  P  G +V+     G  V  G+  A +  MKM+M + S   G + ++L   G+
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESG-IIQLLKQPGS 757

Query: 1157 AVDASDLLVVL 1167
             V A D+L +L
Sbjct: 758  TVSAGDILAIL 768

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 133/332 (40%), Gaps = 44/332 (13%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS   E  D+    G+  +
Sbjct: 497 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVL 545

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXX 183
           G P + + +  D+    +  A  ++           +VKEA + V + G+PVI++AA+  
Sbjct: 546 GTPIDTVITTEDR--ELFSNAMDEINEKCAKSKAASTVKEALEAVKEIGFPVIVRAAYAL 603

Query: 184 XXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVH 243
                       ++ D    A + +          VER +   K +E +++ D + N + 
Sbjct: 604 GGLGSGFASNETELVDLCNVAFASS------PQVLVERSMKGWKEVEYEVVRDAFDNCIT 657

Query: 244 LFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
           +    C+++            + VAP++ +  E  + + T AV + +  G       ++ 
Sbjct: 658 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 713

Query: 298 VDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 714 LNPFSKEYCIIEVNARLSRSSALASKATGYPL 745

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 68/173 (39%), Gaps = 6/173 (3%)

Query: 158  IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
            + S+ EAE F    GYPV+++ ++              D+        ++A+    D   
Sbjct: 1115 LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPV 1170

Query: 218  FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
             + +++++ K IE+  +  +   V+H+          H      + P +++  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIV 1230

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                K+ K          +F+  N N    IE N R         ++ G++L+
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVRASRSFPFISKVVGVNLI 1282

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 132/334 (39%), Gaps = 48/334 (14%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 435 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 494

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS   E  D+    G+  +
Sbjct: 495 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVL 543

Query: 124 GPPAEVIDSVGDKVSARYLAARA--DVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAF 181
           G P + I +  D    R L A A  ++           SV+EA   V   G+PVI++AA+
Sbjct: 544 GTPIDTIITTED----RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAY 599

Query: 182 XXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNV 241
                         ++ D    A + +          VER +   K +E +++ D + N 
Sbjct: 600 ALGGLGSGFANNEQELIDLCNVAFASS------PQVLVERSMKGWKEVEYEVVRDAFDNC 653

Query: 242 VHLFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAE 295
           + +    C+++            + VAP++ +  E  + + T AV + +  G       +
Sbjct: 654 ITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQ 709

Query: 296 FLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           + ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 710 YALNPFSKEYCIIEVNARLSRSSALASKATGYPL 743

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 70/173 (40%), Gaps = 6/173 (3%)

Query: 158  IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
            + S+ EAEDF  + GYPV+++ ++              D+        ++A+    D   
Sbjct: 1113 LTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRDYPV 1168

Query: 218  FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
             + +++++ K IE+  +  N   V+H+          H      + P +++  E  D I+
Sbjct: 1169 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1228

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                K+ K          +F+  + N    IE N R         ++ G++L+
Sbjct: 1229 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>Kwal_33.14061
          Length = 2221

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 132/332 (39%), Gaps = 44/332 (13%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS   E  D+    G+  +
Sbjct: 497 -------FLPVNAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVL 545

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXX 183
           G P + + +  D+    +  A  ++           +V+EA + V + G+PVI +AA+  
Sbjct: 546 GTPIDTVITTEDR--ELFSNAMDEINEKCAKSKAAATVEEALEAVKEIGFPVICRAAYAL 603

Query: 184 XXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVH 243
                       ++ D    A + +          VER +   K +E +++ D + N + 
Sbjct: 604 GGLGSGFANNEKELVDLCNIAFASS------PQVLVERSMKGWKEVEYEVVRDAFDNCIT 657

Query: 244 LFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
           +    C+++            + VAP++ +  E  + + T AV + +  G       ++ 
Sbjct: 658 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 713

Query: 298 VDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 714 LNPFSKEYCIIEVNARLSRSSALASKATGYPL 745

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/173 (16%), Positives = 67/173 (38%), Gaps = 6/173 (3%)

Query: 158  IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
            + S++EAE F     +PV+++ ++              D+        ++A+    D   
Sbjct: 1115 LTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPV 1170

Query: 218  FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
             + +++++ K IE+  +  +   V+H+          H      + P +++  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVERIV 1230

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                K+ K          +F+  N N    IE N R         ++  ++L+
Sbjct: 1231 VATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVRASRSFPFISKVVNVNLI 1282

>Scas_582.4*
          Length = 2193

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 6/173 (3%)

Query: 158  IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
            + S+ EAE F  + GYPV+++ ++              D+        ++A+    D   
Sbjct: 1090 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRDYPV 1145

Query: 218  FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
             + +++++ K IE+  +  N   V+H+          H      + P +++ +E  D I+
Sbjct: 1146 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDRIV 1205

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                K+ K          +F+  + N    IE N R         ++ G++L+
Sbjct: 1206 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1257

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 130/334 (38%), Gaps = 48/334 (14%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 432 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 491

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS   E  D+    G+  +
Sbjct: 492 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVL 540

Query: 124 GPPAEVIDSVGDKVSARYLAARA--DVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAF 181
           G   + I +  D    R L A A  ++           SV+EA   V   G+PVI++AA+
Sbjct: 541 GTQIDTIITTED----RELFANAIDEINEKCAKSHAANSVEEALTAVKDIGFPVIVRAAY 596

Query: 182 XXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNV 241
                         ++ D    A + +          VER +   K IE +++ D + N 
Sbjct: 597 ALGGLGSGFANNEQELIDLCNVAFASS------PQVLVERSMKGWKEIEYEVVRDAFDNC 650

Query: 242 VHLFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAE 295
           V +    C+++            + VAP++ +  E  + +   AV + +  G       +
Sbjct: 651 VTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQ 706

Query: 296 FLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           + ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 707 YALNPFSKEYCIIEVNARLSRSSALASKATGYPL 740

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 69/173 (39%), Gaps = 6/173 (3%)

Query: 158  IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
            + S+ EAE F  + GYPV+++ ++              D+        ++A+    D   
Sbjct: 1115 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRDYPV 1170

Query: 218  FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
             + +++++ K IE+  +  N   V+H+          H      + P +++  E  D I+
Sbjct: 1171 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1230

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                K+ K          +F+  + N    IE N R         ++ G++L+
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1282

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 130/332 (39%), Gaps = 44/332 (13%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS      D+    G+  +
Sbjct: 497 -------FVPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVL 545

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXX 183
           G P + I +  D+    +  A  ++           SV EA   V + G+PVI++AA+  
Sbjct: 546 GTPIDTIITTEDR--ELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAAYAL 603

Query: 184 XXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVH 243
                       ++ D    A S +          VE+ +   K +E +++ D + N + 
Sbjct: 604 GGLGSGFANNEKELVDLCNVAFSSS------PQVLVEKSMKGWKEVEYEVVRDAFDNCIT 657

Query: 244 LFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
           +    C+++            + VAP++ +  E  + + T AV + +  G       ++ 
Sbjct: 658 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 713

Query: 298 VDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 714 LNPVSKDYCIIEVNARLSRSSALASKATGYPL 745

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 130/332 (39%), Gaps = 44/332 (13%)

Query: 18  EKNKILVANRGEIPI-----------RIFRSAHELSMRTVAIYSHEDRLSTHRLKADESY 66
           E  K+LV   G + I           +  ++  E  + T+ I  +   + T +  AD+ Y
Sbjct: 453 EPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 512

Query: 67  VIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYG---FLSENSEFADKVAKAGITWI 123
                  F PV A      I++     + D I+  +G    LS   E  D+    G+  +
Sbjct: 513 -------FLPVTAEFVRKVILH----ERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVL 561

Query: 124 GPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFXX 183
           G   + I +  D+    +  A  ++           +V EA + V   G+PVI++AA+  
Sbjct: 562 GTSIDTIITTEDR--ELFANAMDEINEKCAKSKAASTVDEALEAVKDIGFPVIVRAAYAL 619

Query: 184 XXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVH 243
                       ++ D    A + +          VER +   K +E +++ D + N + 
Sbjct: 620 GGLGSGFASNEQELVDLCNVAFASS------PQVLVERSMKGWKEVEYEVVRDAFDNCIT 673

Query: 244 LFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
           +    C+++            + VAP++ +  E  + + T AV + +  G       ++ 
Sbjct: 674 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 729

Query: 298 VDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
           ++  ++ Y  IE+N R+     +  + TG  L
Sbjct: 730 LNPFSKEYCIIEVNARLSRSSALASKATGYPL 761

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/225 (16%), Positives = 90/225 (40%), Gaps = 12/225 (5%)

Query: 108  NSEFADKVAKAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPG--PIKSVKEAE 165
            ++  A  + +  +  +G   E+IDS  ++     +  + +V      P    + S++EAE
Sbjct: 1083 SNNIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEV----DQPAWKELTSMEEAE 1138

Query: 166  DFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDH 225
            DF  + GYPV+++ ++              D+        ++A+    +    + +++++
Sbjct: 1139 DFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSREYPVVITKYIEN 1194

Query: 226  PKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAILTDAVKLAK 284
             K IE+  +  +   ++H+          H      + P +++  E    I+    K+ +
Sbjct: 1195 AKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIVDATAKIGR 1254

Query: 285  ECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                      +F+  N N    IE N R         ++ G++L+
Sbjct: 1255 ALKITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVIGVNLI 1298

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 88/216 (40%), Gaps = 21/216 (9%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 776 TVAALSGADVVDVA---INSMSGLTSQPSINA-LLASLDGQIDTGINVQNVRELDAYWAE 831
             A  +GA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   A+
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPEYVKSKYKLHKLRDLENLVAD 283

Query: 832 MRLLYSCFEADLKG-----PDAEVYQHEIPGGQLTNLLFQAQQQGLGEQ---------WA 877
              +   F   + G       A ++   I     T  +   +  G+            W 
Sbjct: 284 AVSVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPEDFGMKRYIHFANRLTGWN 343

Query: 878 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMV 911
             K    + N  L D  I +VT   K +GD+ Q  +
Sbjct: 344 AIKSRVEQLNLHLSDDQIKEVTSKIKQIGDVRQLSI 379

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 113/280 (40%), Gaps = 36/280 (12%)

Query: 65  SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENS-----EFADKVAKAG 119
           SY + +E  F PV        I ++ K+ + D I   +G  +  +     + A  + K G
Sbjct: 78  SYSLADEVYFLPVTPEF----ITHVIKRERPDGILLTFGGQTGLNCGVALQRAVTLEKYG 133

Query: 120 ITWIGPPAEVIDSVGDKVSARYLAARA----DVPTVPGTPGPIKSVKEAEDFVAQYGYPV 175
           +T +G P  V+++  D    R L ARA    ++P          +V++A       GYPV
Sbjct: 134 VTVLGTPISVLETTED----RELFARALKEINMPIAESVA--CSTVEDAVAAANDIGYPV 187

Query: 176 IIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLG 235
           I+++A+                +D  Q     A +        VE+ L   K IE +++ 
Sbjct: 188 IVRSAYALGGLGSGFA------DDDLQLRQLCAQSLALSPQVLVEKSLKGWKEIEYEVVR 241

Query: 236 DNYGNVVHLFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYR 289
           D  GN + +    C+++            + +AP++ +  E    + T A+++ +  G  
Sbjct: 242 DRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHLGVV 297

Query: 290 NAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
                ++ +      +  IE+N R+     +  + TG  L
Sbjct: 298 GECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPL 337

>Kwal_27.12090
          Length = 394

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 27/229 (11%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + +  +G + +GI D  G   P     L+ +++       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 776 TVAALSGADVVDVA---INSMSGLTSQPSINA-LLASLDGQIDTGINVQNVRELDAYWAE 831
             A  +GA ++DV+   I   +G+T    + A ++ +    + +   +  +R+++   AE
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 283

Query: 832 MRLLYSCFEADLKG-----PDAEVYQHEIPGGQLTNLLFQAQQQGLGEQ---------WA 877
              +   F   + G       A ++   I     T  +   Q  GL            W 
Sbjct: 284 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPQDFGLKRYIHFANRLTGWN 343

Query: 878 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMVTN------KFNSD 918
             K    + N  L D  I  VT   K +GD+ Q  + +      +F+SD
Sbjct: 344 AIKSRVEQLNLHLTDDQIKDVTQKIKKIGDVRQLSIDDVDSIIKEFHSD 392

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 70/176 (39%), Gaps = 8/176 (4%)

Query: 158 IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
           + SV+EA+ F  Q GYPV+I+ ++              ++      AS  +     D   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVS----PDHPV 769

Query: 218 FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
            + +F++  + I+V  +  N   +VH           H      V P +N+ + ++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 277 TDAVKLAKECGYRNAGTAEFLVDNQNRHY---FIEINPRIQVEHTITEEITGIDLV 329
             A K+AK          + + D+++       IE N R         ++ G++ +
Sbjct: 830 EIADKVAKAWNITGPFNMQIIKDDRDEGVSLKVIECNIRASRSFPFVSKVLGVNFI 885

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G   +GI D  G   P     L+ ++++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 776 TVAALSGADVVDVA---INSMSGLTSQPSINA-LLASLDGQIDTGINVQNVRELDAYWAE 831
             A  +GA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   AE
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPDYVKSKYKLHKLRDLETLVAE 283

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 60/303 (19%), Positives = 122/303 (40%), Gaps = 33/303 (10%)

Query: 36  RSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKV 95
           ++  E  + T+ I  +   + T +  AD+ Y       F PV A      I++     + 
Sbjct: 464 KALKEEGIYTILINPNIATIQTSKGLADKVY-------FLPVTAEFVRKVILH----ERP 512

Query: 96  DFIHPGYG---FLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVP 152
           D I+  +G    LS   E  D+    G+  +G P + + +  D+    +  A  ++    
Sbjct: 513 DAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDR--ELFANAMDEINEKC 570

Query: 153 GTPGPIKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAF 212
                  +V EA + V   G+PVI++AA+              ++ D    A + +    
Sbjct: 571 AKSAAAATVAEALEAVKDIGFPVIVRAAYALGGLGSGFASNEKELVDLCNVAFASS---- 626

Query: 213 GDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQR------RHQKVVEVAPAKN 266
                 VER +   K IE +++ D + N + +    C+++            + +AP++ 
Sbjct: 627 --PQVLVERSMKGWKEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQT 680

Query: 267 IPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITG 325
           +  E  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 681 LSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATG 740

Query: 326 IDL 328
             L
Sbjct: 741 YPL 743

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/225 (16%), Positives = 88/225 (39%), Gaps = 12/225 (5%)

Query: 108  NSEFADKVAKAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPG--PIKSVKEAE 165
            ++  A  + +  +  +G   E+IDS  ++     +  + DV      P    + S+ EAE
Sbjct: 1065 SNNIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDV----DQPAWKELTSMDEAE 1120

Query: 166  DFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDH 225
            DF  +  YPV+++ ++              D+        ++A+    +    + +++++
Sbjct: 1121 DFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSREYPVVITKYIEN 1176

Query: 226  PKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAILTDAVKLAK 284
             K IE+  +  +   ++H+          H      + P +++  E    I+    K+ +
Sbjct: 1177 AKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIVEATAKIGR 1236

Query: 285  ECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
                      +F+  N N    IE N R         ++ G++L+
Sbjct: 1237 ALQITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+++ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DVA+
Sbjct: 241 YTALEGGARLIDVAV 255

>Kwal_55.19783
          Length = 1121

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/219 (18%), Positives = 88/219 (40%), Gaps = 19/219 (8%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVI 176
           K G+  +G P + +++  D+          ++PT        ++V EA    ++ GYPVI
Sbjct: 134 KYGVKVLGTPIKTLETSEDRDLFAQALKEINIPTAESFA--CETVDEALSAASRVGYPVI 191

Query: 177 IKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGD 236
           +++A+              ++ +   +A S +          VE+ L   K +E +++ D
Sbjct: 192 VRSAYALGGLGSGFAENEAEMKELAAQALSLS------PQILVEKSLKGWKEVEYEVVRD 245

Query: 237 NYGNVVHLFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRN 290
              N + +    C+++            +  AP++ +  E    + T A+K+ +  G   
Sbjct: 246 RVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHLGVVG 301

Query: 291 AGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
               ++ +      Y  IE+N R+     +  + TG  L
Sbjct: 302 ECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL 340

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 67/178 (37%), Gaps = 12/178 (6%)

Query: 158 IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
           + SV EA+DF    GYPV+I+ ++              ++      AS  +     D   
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDELETKLTNASDVS----PDHPV 772

Query: 218 FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKNIPREVRDAIL 276
            + +F++  + I+V  +  N   +VH           H      + P +++   +++ + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSESIKERLY 832

Query: 277 TDAVKLAKECGYRNAGTAEFLVDNQNRH-----YFIEINPRIQVEHTITEEITGIDLV 329
             A K+A    ++  G     +   +RH       IE N R         ++ G + +
Sbjct: 833 DIAKKVAH--AWKITGPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCNFI 888

>Scas_701.35
          Length = 430

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + +  +G + +GI D  G   P     L+ ++R+      I  H H+  G A+++ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DV++
Sbjct: 229 YTALEGGARLIDVSV 243

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+++ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 776 TVAALSGADVVDVA---INSMSGLTSQPSINA-LLASLDGQIDTGINVQNVRELDAYWAE 831
             A   GA ++DV+   I   +G+T    + A ++ +    + +   +  +R+++   AE
Sbjct: 236 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 295

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     LI ++++      I  H H+  G A+++ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DV++
Sbjct: 239 YTALEGGARLIDVSV 253

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 92/248 (37%), Gaps = 35/248 (14%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      +  H H+  G A+++ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 776 TVAALSGADVVDVAINSMSGLTSQPSINALLASL----DGQIDTGINVQNVRELDAYWAE 831
             A   GA +VDV++  +        +  L+A +       + +   +  +R+++   AE
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 300

Query: 832 MRLLYSCFEADLKG-----PDAEVYQHEIPGGQLTNLLFQAQQQGLGEQ---------WA 877
              +   F   + G       A ++   I     T  +      G+            W 
Sbjct: 301 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGMTRYIHFANRLTGWN 360

Query: 878 ETKRAYREAN-YLLGDIVKVTPTSKVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDF 936
             K    + N +L  D VK     +V   + QF  +   N DD+          DSI+  
Sbjct: 361 AIKSRVDQLNLHLTDDQVK-----EVTAKIKQFGTSRPLNIDDV----------DSIIKA 405

Query: 937 FEGLIGQP 944
           F   I  P
Sbjct: 406 FHAQIATP 413

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+++ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 776 TVAALSGADVVDVA---INSMSGLTSQPSINA-LLASLDGQIDTGINVQNVRELDAYWAE 831
             A   GA ++DV+   I   +G+T    + A ++ +    + +   +  +R+++   AE
Sbjct: 224 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 283

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     LI ++++      I  H H+  G A+++ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DV++
Sbjct: 225 YTALEGGARLIDVSV 239

>Scas_704.3
          Length = 438

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + + ++G + +GI D  G   P     L+ ++++      I  H H+  G A+++ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DV++
Sbjct: 238 YTALEGGARLIDVSV 252

>Kwal_56.24401
          Length = 441

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 716 LEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSM 775
           L + + +  +G + +GI D  G   P     L+ +++       +  H H+  G A+++ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 776 TVAALSGADVVDVAI 790
             A   GA ++DVA+
Sbjct: 238 YTALEGGAKLIDVAV 252

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 39/219 (17%), Positives = 88/219 (40%), Gaps = 19/219 (8%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVI 176
           K G+  +G P + +++  D+          ++P         +++ +A +  A+  YPVI
Sbjct: 134 KYGVKVLGTPIKTLETSEDRDLFAQALKEINIPIAESFA--CETIDQALEAAAKVKYPVI 191

Query: 177 IKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGD 236
           +++A+              ++ +   ++ S A          VE+ L   K IE +++ D
Sbjct: 192 VRSAYALGGLGSGFANDEQEMKELASQSLSLA------PQILVEKSLKGWKEIEYEVVRD 245

Query: 237 NYGNVVHLFERDCSVQR------RHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRN 290
             GN + +    C+++            +  AP++ +  E    + + A+K+ +  G   
Sbjct: 246 RVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVG 301

Query: 291 AGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
               ++ +      Y  IE+N R+     +  + TG  L
Sbjct: 302 ECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL 340

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 68/176 (38%), Gaps = 8/176 (4%)

Query: 158 IKSVKEAEDFVAQYGYPVIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTC 217
           + SV EA+ F ++ GYPV+I+ ++              ++      AS  +     D   
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELEVKLTNASDVS----PDHPV 772

Query: 218 FVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVE-VAPAKNIPREVRDAIL 276
            + +F++  + I+V  +  +   +VH           H      + P +++  E +  + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLILPPQHLSEETKQRLK 832

Query: 277 TDAVKLAKE---CGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLV 329
             A K+AK    CG  N    +   D+      IE N R         ++ GI+ +
Sbjct: 833 DIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGINFI 888

>YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly
           similar to Imd2p and inosine-5'-monophosphate
           dehydrogenase of human and E. coli [1572 bp, 523 aa]
          Length = 523

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 363 TTEDPAKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGAVISPHYDSMLVKCSCSGST 419
           TTE P + F  D  RL+ YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFS-ESDSVLVAQGVSGA- 454

Query: 420 YEIVRRKMIRALIEFRIRGVKTNIPFL----LTLLTHPVFISGDYWTTFIDDTPQLFKMV 475
             +V +  I+  I +   G++ +   +    LTLL   V  SG     F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENV-QSGKVRFEFRTASAQLEGGV 511

Query: 476 SSQNRAQKLLH 486
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 89/221 (40%), Gaps = 19/221 (8%)

Query: 115 VAKAGITWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYP 174
           +AK  +  +G P + + +  D+    + +A  D+          ++V EA +   +  YP
Sbjct: 129 LAKYNVKVLGTPIKTLITSEDR--DLFASALKDINIPIAESFACETVDEALEAAERVKYP 186

Query: 175 VIIKAAFXXXXXXXXXXXXXXDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLL 234
           VI+++A+              ++ +   ++ S A          VE+ L   K +E +++
Sbjct: 187 VIVRSAYALGGLGSGFANNASEMKELAAQSLSLA------PQILVEKSLKGWKEVEYEVV 240

Query: 235 GDNYGNVVHLFERDCSVQRRHQKVVEV------APAKNIPREVRDAILTDAVKLAKECGY 288
            D  GN + +    C+++      V        AP++ +  E    + + A+K+ +  G 
Sbjct: 241 RDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGV 296

Query: 289 RNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITGIDL 328
                 ++ +      Y  IE+N R+     +  + TG  L
Sbjct: 297 IGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL 337

>YAR075W (YAR075W) [91] chr1 (228837..229310) Protein containing an
           IMP dehydrogenase or GMP reductase C terminus domain,
           has very strong similarity to a region of
           inosine-5'-monophosphate dehydrogenase (S. cerevisiae
           Imd2p), which catalyzes the conversion of inosine
           5'-phosphate and NAD(+) [474 bp, 157 aa]
          Length = 157

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 363 TTEDPAKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGAVISPHYDSMLVKCSCSGST 419
           TTE P +    D  RL+ YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 31  TTESPGEYLYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSES-DSVLVAQGVSGA- 88

Query: 420 YEIVRRKMIRALIEFRIRGVKTNIPFL----LTLLTHPVFISGDYWTTFIDDTPQLFKMV 475
             +V +  I+  I +   G++ +   +    LTLL   V  SG     F   + QL   V
Sbjct: 89  --VVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKENV-QSGKVRFEFRTASAQLEGGV 145

Query: 476 SSQNRAQKLLH 486
           ++ +  +K LH
Sbjct: 146 NNLHSYEKRLH 156

>Scas_714.5
          Length = 1460

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 709  KYNLDYYLEVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSA 768
            K+++D   ++TEK VQ    I   K     ++P  A   IG+     P   + + T   A
Sbjct: 1053 KHSVDQLYKITEKSVQTFLEIALYKYRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1112

Query: 769  GTAVSSMTVAALSGADVVDVAINSMSGLTSQPSINALLAS 808
            G A  ++T+    G   +   IN+ S + S P INA+L +
Sbjct: 1113 GVASMNVTL----GVPRIKEIINA-SKVISTPIINAVLVN 1147

>CAGL0K10780g
           join(1047904..1047925,1049093..1049539,1050106..1051220)
           highly similar to sp|P50094 Saccharomyces cerevisiae
           YML056c IMD4 or sp|P50095 Saccharomyces cerevisiae
           YLR432w IMD3 or sp|P38697 Saccharomyces cerevisiae
           YHR216w PUR5
          Length = 527

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 363 TTEDPAKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGAVISPHYDSMLVKCSCSGST 419
           TTE P   F  D  RL+VYR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 401 TTESPGDYFYRDGKRLKVYRGMGSIDAMQKTGKKGNASTSRYFS-ETDSVLVAQGVSGA- 458

Query: 420 YEIVRRKMIRALIEFRIRGVK 440
             +V +  I+  I +   G++
Sbjct: 459 --VVDKGSIKKFIPYLYNGLQ 477

>YHR216W (IMD2) [2500] chr8 (554394..555965)
           Inosine-5'-monophosphate dehydrogenase, catalyzes the
           conversion of inosine 5'-phosphate and NAD(+) to
           xanthosine 5'-phosphate and NADH, the first reaction
           unique to GMP biosynthesis [1572 bp, 523 aa]
          Length = 523

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 363 TTEDPAKNFQPDTGRLEVYRSAGG-NGVRLDG--GNAYAGAVISPHYDSMLVKCSCSGST 419
           TTE P + F  D  RL+ YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFS-ESDSVLVAQGVSGA- 454

Query: 420 YEIVRRKMIRALIEFRIRGVKTNIPFL----LTLLTHPVFISGDYWTTFIDDTPQLFKMV 475
             +V +  I+  I +   G++ +   +    LTLL + V   G     F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNV-QRGKVRFEFRTASAQLEGGV 511

Query: 476 SSQNRAQKLLH 486
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

>YML056C (IMD4) [3914] chr13
           complement(162194..163308,163717..164176) Protein with
           similarity to inosine-5'-monophosphate dehydrogenase
           [1575 bp, 524 aa]
          Length = 524

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 363 TTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHY---DSMLVKCSCSGST 419
           TTE P + F  D  RL+ YR  G        GN    A  S ++   DS+LV    SG+ 
Sbjct: 398 TTESPGEYFYKDGKRLKAYRGMGSIDAMQKTGNK-GNASTSRYFSESDSVLVAQGVSGA- 455

Query: 420 YEIVRRKMIRALIEFRIRGVK 440
             +V +  I+  I +   G++
Sbjct: 456 --VVDKGSIKKFIPYLYNGLQ 474

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,525,698
Number of extensions: 1485377
Number of successful extensions: 3868
Number of sequences better than 10.0: 67
Number of HSP's gapped: 3867
Number of HSP's successfully gapped: 98
Length of query: 1176
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1063
Effective length of database: 12,684,275
Effective search space: 13483384325
Effective search space used: 13483384325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)