Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_686.141521526032e-81
YMR002W1561643412e-41
CAGL0J11682g1591703143e-37
Sklu_2419.61581622995e-35
KLLA0C06094g1491562952e-34
Kwal_56.224921521572831e-32
ACL010C153962612e-29
Kwal_27.1069442143595.3
KLLA0E06875g41826595.7
ABR130W10934576.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_686.14
         (152 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_686.14                                                           236   2e-81
YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the DU...   135   2e-41
CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces...   125   3e-37
Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement        119   5e-35
KLLA0C06094g complement(535470..535919) similar to sp|Q03667 Sac...   118   2e-34
Kwal_56.22492                                                         113   1e-32
ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [...   105   2e-29
Kwal_27.10694                                                          27   5.3  
KLLA0E06875g complement(625608..626864) similar to sp|P38174 Sac...    27   5.7  
ABR130W [722] [Homologous to ScYHR116W - SH] complement(641040.....    27   6.1  

>Scas_686.14
          Length = 152

 Score =  236 bits (603), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 132/152 (86%), Positives = 132/152 (86%)

Query: 1   MARSRGSRSVSRPQRRSASTAAISRPAPPASNAYXXXXXXXXXXXXXXXXXXXXMFAQMA 60
           MARSRGSRSVSRPQRRSASTAAISRPAPPASNAY                    MFAQMA
Sbjct: 1   MARSRGSRSVSRPQRRSASTAAISRPAPPASNAYSQPPAASAGAGAGAQPRQPGMFAQMA 60

Query: 61  STAAGVAVGSTVGHAVSGLLFGGGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCDGAAKS 120
           STAAGVAVGSTVGHAVSGLLFGGGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCDGAAKS
Sbjct: 61  STAAGVAVGSTVGHAVSGLLFGGGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCDGAAKS 120

Query: 121 FTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
           FTKCLDENNGNFQICDYYLQQLKACQEAARQY
Sbjct: 121 FTKCLDENNGNFQICDYYLQQLKACQEAARQY 152

>YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the
           DUF657 protein of unknown function family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.159p [471 bp, 156 aa]
          Length = 156

 Score =  135 bits (341), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 101/164 (61%), Gaps = 20/164 (12%)

Query: 1   MARSRGSR---SVSRP-QRRSASTAA--ISRPAPPASNAYXXXXXXXXXXXXXXXXXXXX 54
           MARSRGS    S SRP Q RSAST A  +        NAY                    
Sbjct: 1   MARSRGSSRPISRSRPTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPG------ 54

Query: 55  MFAQMASTAAGVAVGSTVGH----AVSGLLFGGGS--APAEQPVQQQAMDPYASQRTLDQ 108
           MFAQMASTAAGVAVGST+GH     ++G+  G GS  AP EQ  QQQ M   + Q   DQ
Sbjct: 55  MFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQ--QQQNMANTSGQTQTDQ 112

Query: 109 EPAQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
           +  ++C+  A++FT+CLDENNGNFQICDYYLQQLKACQEAARQY
Sbjct: 113 QLGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQEAARQY 156

>CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces
           cerevisiae YMR002w, start by similarity
          Length = 159

 Score =  125 bits (314), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 102/170 (60%), Gaps = 29/170 (17%)

Query: 1   MARSRG-------SRSVSRPQR-RSASTAAI------SRPAPPASNAYXXXXXXXXXXXX 46
           MARSRG       S + SRPQ+ RSASTAA        +P  PA NA+            
Sbjct: 1   MARSRGGSRPAGRSSAFSRPQQSRSASTAAYPAAPPRQQPVAPA-NAHPQAGAQPQQPG- 58

Query: 47  XXXXXXXXMFAQMASTAAGVAVGSTVGH----AVSGLLFGGGSAPAEQPVQQQAMDPYAS 102
                   +FAQMASTAAGVAVGST+GH     ++G+  G GS+      QQQ M  + +
Sbjct: 59  --------LFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSD-QQQQPMQNFDA 109

Query: 103 QRTLDQEPAQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
                Q+  ++CD  AK+FT+CLDENNGNFQICDYYLQQLKACQEAARQY
Sbjct: 110 AAQQQQQQFRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAARQY 159

>Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement
          Length = 158

 Score =  119 bits (299), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 99/162 (61%), Gaps = 14/162 (8%)

Query: 1   MARSRGS-RSVSRP-QRRSASTAAISRPAPPASNAYXXXXXXXXX---XXXXXXXXXXXM 55
           MARSRGS RS +RP   RSAST A    APP S+A+                       +
Sbjct: 1   MARSRGSARSAARPTHTRSASTMA----APPPSSAHVQPQQTAYSHPPAAAGAQPQQPGL 56

Query: 56  FAQMASTAAGVAVGSTVGHAV----SGLLFGGGSAPAEQPVQQQAMDPYASQR-TLDQEP 110
           FAQMASTAAGVAVGS VGH V    +GL  G GS+ A    QQQ     A  + +L Q  
Sbjct: 57  FAQMASTAAGVAVGSAVGHTVGAGLTGLFSGSGSSAAPAEQQQQQQLAAAPAQQSLAQNQ 116

Query: 111 AQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
           A  CD  A++FT+CL+EN+GNFQICD+YLQQLKACQEAARQY
Sbjct: 117 ATHCDVDARNFTRCLEENDGNFQICDFYLQQLKACQEAARQY 158

>KLLA0C06094g complement(535470..535919) similar to sp|Q03667
           Saccharomyces cerevisiae YMR002w singleton, start by
           similarity
          Length = 149

 Score =  118 bits (295), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 94/156 (60%), Gaps = 11/156 (7%)

Query: 1   MARSRGS-RSVSRPQRRSASTAAISRPAPPAS-NAYXXXXXXXXXXXXXXXXXXXXMFAQ 58
           MARSRGS R VSRPQ RSAST A   PA   + NAY                    MFAQ
Sbjct: 1   MARSRGSARPVSRPQTRSASTVAAPAPAQHQAPNAYSHPPHTAQPQQPG-------MFAQ 53

Query: 59  MASTAAGVAVGSTVGHAVSGLLFG--GGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCDG 116
           MASTAAGVAVGST+GH +   + G   GS+ A    QQQ +       T   + A  CD 
Sbjct: 54  MASTAAGVAVGSTIGHTLGAGITGMFSGSSSAPAEQQQQQVAAPVQADTFQNQQATHCDV 113

Query: 117 AAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
            A++FT+CL++N GN QICDYYLQQLKACQEAARQY
Sbjct: 114 DARNFTRCLEDNGGNMQICDYYLQQLKACQEAARQY 149

>Kwal_56.22492
          Length = 152

 Score =  113 bits (283), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 93/157 (59%), Gaps = 10/157 (6%)

Query: 1   MARSRGSRSVSRP---QRRSASTAAISRPAPPASNAYXXXXXXXXXXXXXXXXXXXXMFA 57
           MARSRG    SRP   Q RSAST A    A P +  +                    +FA
Sbjct: 1   MARSRGGVR-SRPAPAQTRSASTMA----AHPPAQQHAAPSSAYSHPQSAAQPRQPGLFA 55

Query: 58  QMASTAAGVAVGSTVGHAVSGLLFG--GGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCD 115
           QMASTAAGVAVGS VGH V   L G   GS+ A    QQQ +    +Q+   QE  ++CD
Sbjct: 56  QMASTAAGVAVGSAVGHTVGAGLTGMFSGSSSAPAEQQQQQLAAAPAQQGFAQEQGRACD 115

Query: 116 GAAKSFTKCLDENNGNFQICDYYLQQLKACQEAARQY 152
             A+SFT+CL+ENNGN QICD+YLQQLKACQEAARQY
Sbjct: 116 VDARSFTRCLEENNGNMQICDFYLQQLKACQEAARQY 152

>ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [462
           bp, 153 aa]
          Length = 153

 Score =  105 bits (261), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 67/96 (69%), Gaps = 6/96 (6%)

Query: 55  MFAQMASTAAGVAVGSTVGHAV----SGLLFGGGSAPAEQPVQQQAMDPYASQRTLDQEP 110
           +FAQMASTAAGVAVGS VGH +    +GL  G GSAPAE   QQ A  P   Q+   Q  
Sbjct: 50  LFAQMASTAAGVAVGSAVGHTIGAGLTGLFSGSGSAPAEAQPQQLAAAPV--QQDTFQTQ 107

Query: 111 AQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKACQ 146
           A+ CD  A++FT+CL++NNGNFQICDYYLQQ +  Q
Sbjct: 108 ARHCDTDARNFTRCLEDNNGNFQICDYYLQQFEGLQ 143

>Kwal_27.10694
          Length = 421

 Score = 27.3 bits (59), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 100 YASQRTLDQEPAQSCDGAAKSFTKCLDENNGNFQICDYYLQQL 142
           YA     D  PA S    AK+  K +D+N G    C  YL +L
Sbjct: 325 YAKSSEADSLPAPSL-SRAKALLKTIDDNFGTLPFCRRYLDRL 366

>KLLA0E06875g complement(625608..626864) similar to sp|P38174
           Saccharomyces cerevisiae YBL091c MAP2 methionine
           aminopeptidase, isoform 2 singleton, start by similarity
          Length = 418

 Score = 27.3 bits (59), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 117 AAKSFTKCLDENNGNFQICDYYLQQL 142
           +AK+  K +DEN G    C  YL +L
Sbjct: 338 SAKNLLKVIDENFGTIPFCRRYLDRL 363

>ABR130W [722] [Homologous to ScYHR116W - SH]
           complement(641040..641375) [336 bp, 111 aa]
          Length = 109

 Score = 26.6 bits (57), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 114 CDGAAKSFTKCLDENNGNFQICDYYLQQLKACQE 147
           C  +A    KCL+ NN +  +C  Y    + C++
Sbjct: 62  CQESANMSMKCLERNNYDRDLCREYFDAYRECKK 95

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.124    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,634,519
Number of extensions: 114688
Number of successful extensions: 505
Number of sequences better than 10.0: 16
Number of HSP's gapped: 489
Number of HSP's successfully gapped: 16
Length of query: 152
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 59
Effective length of database: 13,376,635
Effective search space: 789221465
Effective search space used: 789221465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)