Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.920020010561e-149
CAGL0L09867g2601918621e-118
Sklu_2380.52891958531e-116
Kwal_14.8682821958301e-113
YKL024C (URA6)2041947821e-107
KLLA0E08030g3021987831e-106
ACR170C2891937511e-101
Kwal_56.234892251982128e-21
Scas_681.182481942085e-20
KLLA0F13376g2272181997e-19
CAGL0L11902g2512101981e-18
AGR187W2772061931e-17
Scas_721.822212161892e-17
CAGL0K11418g2222131864e-17
AGR115C2512071851e-16
KLLA0C17754g2271881796e-16
YDR226W (ADK1)2222091771e-15
YER170W (ADK2)2251881743e-15
Kwal_27.116072271941717e-15
Sklu_2123.22281971691e-14
Sklu_2063.3208140830.007
ACL150W219153740.093
Scas_617.742064740.13
YFR019W (FAB1)227828710.36
AAR041W51452690.60
KLLA0D09020g53052661.4
YPR088C (SRP54)54150661.5
YBR062C11557621.6
Scas_677.33168528651.8
Scas_536.7105167652.1
YDL166C (FAP7)197153632.5
AER188C217442642.8
ADR282C221117622.9
Scas_628.130775624.0
Kwal_26.762857055615.3
YOR154W58776615.7
CAGL0K06083g31457598.6
Scas_591.3665102599.2
Sklu_2175.480075599.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.9
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.9                                                            411   e-149
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   336   e-118
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         333   e-116
Kwal_14.868                                                           324   e-113
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   305   e-107
KLLA0E08030g complement(724562..725470) some similarities with s...   306   e-106
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   293   e-101
Kwal_56.23489                                                          86   8e-21
Scas_681.18                                                            85   5e-20
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    81   7e-19
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    81   1e-18
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    79   1e-17
Scas_721.82                                                            77   2e-17
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    76   4e-17
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    76   1e-16
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    74   6e-16
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    73   1e-15
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    72   3e-15
Kwal_27.11607                                                          70   7e-15
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            70   1e-14
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            37   0.007
ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH] complement(8...    33   0.093
Scas_617.7                                                             33   0.13 
YFR019W (FAB1) [1700] chr6 (184490..191326) Phosphatidylinositol...    32   0.36 
AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH] complement(...    31   0.60 
KLLA0D09020g 758818..760410 similar to sp|P20424 Saccharomyces c...    30   1.4  
YPR088C (SRP54) [5513] chr16 complement(711399..713024) Signal r...    30   1.5  
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    28   1.6  
Scas_677.33                                                            30   1.8  
Scas_536.7                                                             30   2.1  
YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential p...    29   2.5  
AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..99...    29   2.8  
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    28   2.9  
Scas_628.1                                                             28   4.0  
Kwal_26.7628                                                           28   5.3  
YOR154W (YOR154W) [4953] chr15 (624729..626492) Protein of unkno...    28   5.7  
CAGL0K06083g complement(592576..593520) no similarity, hypotheti...    27   8.6  
Scas_591.3                                                             27   9.2  
Sklu_2175.4 YOL076W, Contig c2175 4893-7295                            27   9.3  

>Scas_685.9
          Length = 200

 Score =  411 bits (1056), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 200/200 (100%), Positives = 200/200 (100%)

Query: 1   MSTTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTL 60
           MSTTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTL
Sbjct: 1   MSTTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTL 60

Query: 61  IKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFI 120
           IKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFI
Sbjct: 61  IKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFI 120

Query: 121 LFFDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRC 180
           LFFDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRC
Sbjct: 121 LFFDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRC 180

Query: 181 DSPVDDVYKQVKAAVDERIN 200
           DSPVDDVYKQVKAAVDERIN
Sbjct: 181 DSPVDDVYKQVKAAVDERIN 200

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  336 bits (862), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 174/191 (91%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           AF+ DQVSVIFVLGGPGAGKGTQCAKLV DY FVHLSAGDLLRAEQNREGSEFG LIKHY
Sbjct: 64  AFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKHY 123

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124
           I EGLIVPQEITL+LL+ AI+ENY+K   KFLVDGFPRKMDQALSFE+QIVPSKF LFF+
Sbjct: 124 IKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFFE 183

Query: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184
           CPE VMLERLL+RGKTSGR DDNIESIKKRF+TFEETSMPVV+YF+ Q KV+K+RCD PV
Sbjct: 184 CPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCDHPV 243

Query: 185 DDVYKQVKAAV 195
           +DVY QVK A+
Sbjct: 244 EDVYNQVKQAL 254

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  333 bits (853), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 179/195 (91%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           AF+P+ VSV+FVLGGPGAGKGTQC KLV DYGFVHLSAGDLLRAEQNR+GSE+G LIKHY
Sbjct: 93  AFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHY 152

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124
           I EGLIVPQE+T+ALL+NAI+EN++ G K+FLVDGFPRKMDQA++FE+QIVPSKF LFFD
Sbjct: 153 IKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFFD 212

Query: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184
           CPE VMLERLL+RGKTSGR DDNIESIKKRF+TF ETSMPVV+YFE Q+KVIK+ CD P+
Sbjct: 213 CPETVMLERLLERGKTSGRTDDNIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQPI 272

Query: 185 DDVYKQVKAAVDERI 199
           D+VYK+V+ AV+ +I
Sbjct: 273 DEVYKKVQTAVEAKI 287

>Kwal_14.868
          Length = 282

 Score =  324 bits (830), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 173/195 (88%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           AF+   VSVIFVLGGPGAGKGTQCA LV DY FVHLSAGDLLRAEQNREGS++G LIKHY
Sbjct: 87  AFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHY 146

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124
           I EGLIVPQE+T+ALL+ AIQ+NYD+G K+FLVDGFPRKMDQA++FEEQIVPSKF LFFD
Sbjct: 147 IKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFD 206

Query: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184
           CPE VML+RLL+RGKTSGR DDN+ESIKKRFKTF ETSMPVV+YFE Q KV+ + CD  V
Sbjct: 207 CPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIETSMPVVEYFEKQDKVVSVSCDHSV 266

Query: 185 DDVYKQVKAAVDERI 199
           + VY+QVKAAV E+I
Sbjct: 267 EKVYEQVKAAVKEKI 281

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  305 bits (782), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/194 (74%), Positives = 165/194 (85%)

Query: 2   STTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLI 61
           S  AF+PDQVSVIFVLGGPGAGKGTQC KLV DY FVHLSAGDLLRAEQ R GS++G LI
Sbjct: 7   SQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELI 66

Query: 62  KHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFIL 121
           K+ I EG IVPQEITLALL+NAI +N      KFL+DGFPRKMDQA+SFE  IV SKFIL
Sbjct: 67  KNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFIL 126

Query: 122 FFDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCD 181
           FFDCPED+MLERLL+RGKTSGR DDNIESIKKRF TF+ETSMPV++YFE + KV+++RCD
Sbjct: 127 FFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCD 186

Query: 182 SPVDDVYKQVKAAV 195
             V+DVYK V+ A+
Sbjct: 187 RSVEDVYKDVQDAI 200

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  306 bits (783), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/198 (71%), Positives = 169/198 (85%)

Query: 3   TTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIK 62
           T AF+ D V V+FVLGGPGAGKGTQCAKLV D+GFVHLSAGDLLRAEQ REGS++G LIK
Sbjct: 104 TPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIK 163

Query: 63  HYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILF 122
             I +G IVPQE+T+ALLKNAI  NY+   KKFLVDGFPRKMDQA++FEE+IVPS   LF
Sbjct: 164 KCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLF 223

Query: 123 FDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDS 182
           FDCPE +MLERLL RGKTSGR+DDNIESI+KRFKTF ETS+PVV+YFE Q+KV+K+ C+ 
Sbjct: 224 FDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQ 283

Query: 183 PVDDVYKQVKAAVDERIN 200
           PVD+VY+ V  A+ ++I+
Sbjct: 284 PVDEVYQHVTEAIKDKIS 301

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  293 bits (751), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 164/193 (84%)

Query: 8   PDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITE 67
           P   SV+FVLGGPG+GKGTQC++LV    FVH+ AGDLLR EQNR GS++G LIKH+I E
Sbjct: 95  PADASVVFVLGGPGSGKGTQCSRLVERMQFVHVGAGDLLRDEQNRPGSQYGELIKHHIKE 154

Query: 68  GLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFDCPE 127
           GLIVPQE+T+ALL+ AI+E+Y  G +KFLVDGFPRKMDQA +FE+ +VPSKF+LFFDCPE
Sbjct: 155 GLIVPQEVTVALLRRAIEEHYRAGRRKFLVDGFPRKMDQAFTFEKTVVPSKFVLFFDCPE 214

Query: 128 DVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPVDDV 187
            VMLERLL RG+TSGR DDNIESIKKRF+T+ ETSMPVV++F  Q KV+++ CD PV++V
Sbjct: 215 RVMLERLLTRGQTSGRSDDNIESIKKRFRTYVETSMPVVEHFAQQDKVVRLSCDQPVEEV 274

Query: 188 YKQVKAAVDERIN 200
           YKQV+AAV ER+ 
Sbjct: 275 YKQVEAAVKERLG 287

>Kwal_56.23489
          Length = 225

 Score = 86.3 bits (212), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 98/198 (49%), Gaps = 37/198 (18%)

Query: 14  IFVLGGPGAGKGTQCAKLVADYGFVH-LSAGDLLRAEQNREGSEFGTLIKHYITEGLIVP 72
           I +LG PG+GKGTQ +KL++ + ++  +S+GDLLR E  ++ +  G+L   YI++G ++P
Sbjct: 6   ILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQGKLLP 64

Query: 73  QEITLALLKNAIQ-ENYDKGMKKFLVDGFPRKMDQALSFEEQIVPS----KFILFFDCPE 127
             +   L+ N +           FL+DGFPR +DQA S   ++ P       ++  D P 
Sbjct: 65  DSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPS 124

Query: 128 DVMLERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTFEE 160
            V+LER+ +R     SGRV                         DD  E   KR + + +
Sbjct: 125 SVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQ 184

Query: 161 TSMPVVKYFED---QHKV 175
           T  P+ +++ D    HKV
Sbjct: 185 TVEPLKQFYADLGILHKV 202

>Scas_681.18
          Length = 248

 Score = 84.7 bits (208), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 36/194 (18%)

Query: 14  IFVLGGPGAGKGTQCAKLVADYGFVH-LSAGDLLRAEQNREGSEFGTLIKHYITEGLIVP 72
           +  LG PG+GKGTQ ++L+     V+ +S+GD+LR E   E ++ G L   +I +G ++P
Sbjct: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGKLIP 68

Query: 73  QEITLALLKNAIQE-NYDKGMKK--FLVDGFPRKMDQALSFEEQI----VPSKFILFFDC 125
            ++   LL + +QE N+  G  K  +++DGFPR + QA  F+E +         ++  D 
Sbjct: 69  DDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128

Query: 126 PEDVMLERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTF 158
           P +V+LER+ +R     SGR+                         DD+  + KKR + +
Sbjct: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188

Query: 159 EETSMPVVKYFEDQ 172
            ET  P+ +Y++ Q
Sbjct: 189 HETLGPLKEYYQSQ 202

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 102/218 (46%), Gaps = 34/218 (15%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           +  P+ + ++ + G PGAGKGTQ   L   +   HL+ GD+LR++  ++ +  G   K  
Sbjct: 6   SHVPESIRMVLI-GPPGAGKGTQAPNLTERFCACHLATGDMLRSQVAKQ-TPLGIEAKKI 63

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIV----PSKFI 120
           + +G +V  EI + ++K+ +  N D   K F++DGFPR + QA   +E +     P +  
Sbjct: 64  MDDGKLVSDEIMINMIKDELTNNQD-CKKGFILDGFPRTIPQAEKLDEMLAQQGRPLEKA 122

Query: 121 LFFDCPEDVMLERLLDR--GKTSG-------------------------RVDDNIESIKK 153
           +     +++++ R+  R     SG                         R DDN+E++KK
Sbjct: 123 VELKIDDELLVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKK 182

Query: 154 RFKTFEETSMPVVKYFEDQHKVIKIRCDSPVDDVYKQV 191
           R  ++ + + P+V +++       +    P   V+  +
Sbjct: 183 RLTSYHKQTEPIVDFYKKTGIWAGVDASQPPKTVWSDI 220

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 35/210 (16%)

Query: 22  AGKGTQCAKLVADYG-FVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQE-ITLAL 79
           +GKGTQ +KL+        +S+GD+LR E  + G+E G L   YI +G ++P + IT  L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHEL-KSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 80  LKNAIQENYDKGMKKFLVDGFPRKMDQALSFE----EQIVPSKFILFFDCPEDVMLERLL 135
           + +  +E +      +L+DGFPR   QA S +    E       ++  D PE+V+LER+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 136 DR--GKTSGRV-------------------------DDNIESIKKRFKTFEETSMPVVKY 168
           +R     SGRV                         DDN++  KKR K +++T  P+ ++
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 169 FEDQHKVIKIRCDSPVDDVYKQVKAAVDER 198
           +  Q  +  I  D+  D ++ ++ A +++ 
Sbjct: 198 YAKQGILATISGDTS-DIIFPKLCALINQH 226

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 79.0 bits (193), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 105/206 (50%), Gaps = 17/206 (8%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           +  P+ + ++ + G PGAGKGTQ  KL   +   HL+ GD+LR++  ++ +  G   K  
Sbjct: 57  SHVPEAIRMVLI-GPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQ-TALGVQAKKI 114

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIV----PSKFI 120
           + +G +V  EI + ++K+ ++ N +     F++DGFPR + QA   +E +V    P    
Sbjct: 115 MDQGGLVSDEIMVNMIKDELRSNPECA-NGFILDGFPRTIPQAQKLDEMLVAQGKPLDRA 173

Query: 121 LFFDCPEDVMLERLLDR--GKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKI 178
           +     +++++ R+  R     SGR    + +  K   T + T  P+V+  +D    +K 
Sbjct: 174 VELKIDDELLVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKK 233

Query: 179 RCDS------PVDDVYKQ--VKAAVD 196
           R D+      P+ D YK+  + A VD
Sbjct: 234 RLDAYHAQTEPIVDFYKKTGIWAGVD 259

>Scas_721.82
          Length = 221

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 99/216 (45%), Gaps = 33/216 (15%)

Query: 14  IFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQ 73
           + ++G PGAGKGTQ   LV  +   HLS GD+LR+ Q  + +E G   K  + +G +V  
Sbjct: 8   MVLIGPPGAGKGTQAPNLVEKFHACHLSTGDMLRS-QIAKNTELGQEAKKIMDQGGLVSD 66

Query: 74  EITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIV----PSKFILFFDCPEDV 129
           EI + ++K+ +  N       F++DGFPR + QA   ++ +     P +  +     +D+
Sbjct: 67  EIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDL 125

Query: 130 MLERLLDR--GKTSG-------------------------RVDDNIESIKKRFKTFEETS 162
           ++ R+  R     SG                         R DDN +++KKR   +   +
Sbjct: 126 LVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQT 185

Query: 163 MPVVKYFEDQHKVIKIRCDSPVDDVYKQVKAAVDER 198
            P+V +++       +    P   V+ ++  ++ ++
Sbjct: 186 EPIVDFYKKTGIWSGVDASQPPATVWDEILKSLSQK 221

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 76.3 bits (186), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 99/213 (46%), Gaps = 33/213 (15%)

Query: 14  IFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQ 73
           + ++G PGAGKGTQ   LV  +   HL+ GD+LR+ Q  +G+E G   K  + +G +V  
Sbjct: 9   MVLIGPPGAGKGTQAPNLVERFHAAHLATGDMLRS-QISKGTELGLQAKKIMDQGGLVSD 67

Query: 74  EITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFE----EQIVPSKFILFFDCPEDV 129
           +I + ++K+ +  N       F++DGFPR + QA   +    E+  P +  +     +++
Sbjct: 68  DIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDNMLKERGTPLEKAVELKIDDEL 126

Query: 130 MLERLLDR--GKTSG-------------------------RVDDNIESIKKRFKTFEETS 162
           ++ R+  R     SG                         R DDN +++KKR   + + +
Sbjct: 127 LVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKRLGAYHDQT 186

Query: 163 MPVVKYFEDQHKVIKIRCDSPVDDVYKQVKAAV 195
            P+V +++       +    P + V+  +  A+
Sbjct: 187 EPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 93/207 (44%), Gaps = 36/207 (17%)

Query: 14  IFVLGGPGAGKGTQCAKLVADY-GFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVP 72
           + +LG PGAGKGTQ  +L+  + G   +++GDLLR E    GS  G     +I  G ++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 73  QE-ITLALLKNAIQENYDKGMKKFLVDGFPRKMDQA----LSFEEQIVPSKFILFFDCPE 127
              ++ A+L    +  +  G   +L+DGFPR + QA     + E        ++    PE
Sbjct: 92  DALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPE 151

Query: 128 DVMLERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTFEE 160
           DV+L+R+  R     SGRV                         DD  E   KR + +  
Sbjct: 152 DVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAA 211

Query: 161 TSMPVVKYFEDQHKVIKIRCDSPVDDV 187
           T+ P+ +++  Q  +  +R   P  D+
Sbjct: 212 TAGPLKEHYARQGILRTVR--GPTSDI 236

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 90/188 (47%), Gaps = 34/188 (18%)

Query: 18  GGPGAGKGTQCAKLVADYGFVH-LSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEIT 76
           G PG+GKGTQ +KL+ ++G +  +S+GDLLR +Q   G+  G     YI +G ++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 77  LALLKNAIQE-NYDKGMKKFLVDGFPRKMDQA----LSFEEQIVPSKFILFFDCPEDVML 131
             ++ + ++   +      +L+DGFPR + QA     S  E       ++  D P +V+L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 132 ERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTFEETSMP 164
           ER+ +R     SGRV                         DD  E   KR + + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 165 VVKYFEDQ 172
           + +++  Q
Sbjct: 192 LKEHYLKQ 199

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 94/209 (44%), Gaps = 33/209 (15%)

Query: 14  IFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQ 73
           + ++G PGAGKGTQ   L   +   HL+ GD+LR+ Q  +G++ G   K  + +G +V  
Sbjct: 9   MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRS-QIAKGTQLGLEAKKIMDQGGLVSD 67

Query: 74  EITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFE----EQIVPSKFILFFDCPEDV 129
           +I + ++K+ +  N       F++DGFPR + QA   +    EQ  P +  +     +++
Sbjct: 68  DIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDEL 126

Query: 130 MLERLLDR--GKTSG-------------------------RVDDNIESIKKRFKTFEETS 162
           ++ R+  R     SG                         R DDN +++KKR   +   +
Sbjct: 127 LVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQT 186

Query: 163 MPVVKYFEDQHKVIKIRCDSPVDDVYKQV 191
            P+V +++       +    P   V+  +
Sbjct: 187 EPIVDFYKKTGIWAGVDASQPPATVWADI 215

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 17/188 (9%)

Query: 18  GGPGAGKGTQCAKLVADYG-FVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEIT 76
           G PG+GKGTQ ++L+        +S+GD+LR E   E S  G     YI +G ++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPDDLI 79

Query: 77  LALLKNAIQE-NYDKGMKKFLVDGFPRKMDQALSFEEQI----VPSKFILFFDCPEDVML 131
             L+   +    + K    +L+DGFPR   QA + +E +         ++  D PE  +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 132 ERLLDR--GKTSGRVDDNIESIKKRFKTFEE-TSMPVVKYFEDQHKVIKIR------CDS 182
           ER+ +R     SGRV  N++    +    ++ T  P+ K  +D  +V K R       + 
Sbjct: 140 ERIENRYVHVPSGRV-YNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNE 198

Query: 183 PVDDVYKQ 190
           P+ D YK+
Sbjct: 199 PLKDYYKK 206

>Kwal_27.11607
          Length = 227

 Score = 70.5 bits (171), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 93/194 (47%), Gaps = 34/194 (17%)

Query: 8   PDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITE 67
           P+ V ++ + G PGAGKGTQ   L   +   HL+ GD+LR+ Q  + +E G   K  + +
Sbjct: 9   PESVRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRS-QVAQKTELGLEAKKIMDQ 66

Query: 68  GLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFE----EQIVPSKFILFF 123
           G +V  +I + ++K+ +  N +     F++DGFPR + QA   +    EQ  P +  +  
Sbjct: 67  GGLVSDDIMVKMIKHELITNPE-CKSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIEL 125

Query: 124 DCPEDVMLERLLDR--GKTSG-------------------------RVDDNIESIKKRFK 156
              +++++ R+  R     SG                         R DDN +++KKR  
Sbjct: 126 KIDDELLVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKRLG 185

Query: 157 TFEETSMPVVKYFE 170
            + + + P+V +++
Sbjct: 186 AYHQQTEPIVDFYK 199

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 93/197 (47%), Gaps = 34/197 (17%)

Query: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64
           +  P+ + ++ + G PGAGKGTQ   L   +   HL+ GD+LR++  ++ +  G   K  
Sbjct: 7   SHVPESIRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKI 64

Query: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIV----PSKFI 120
           + +G +V  +I + ++K  +  N +     F++DGFPR + QA   +E +     P +  
Sbjct: 65  MDQGGLVSDDIMVNMIKEELATNPE-CKNGFILDGFPRTIPQAEKLDEMLAEQGKPLERA 123

Query: 121 LFFDCPEDVMLERLLDR--GKTSG-------------------------RVDDNIESIKK 153
           +     +++++ R+  R     SG                         R DDN +++KK
Sbjct: 124 IELKIDDELLVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKK 183

Query: 154 RFKTFEETSMPVVKYFE 170
           R   + + + P+V +++
Sbjct: 184 RLNAYHQQTEPIVDFYK 200

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 25/140 (17%)

Query: 14  IFVLGGPGAGKGTQCAKLV---ADYGFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLI 70
           I V G PG GK T C  LV   +DY + ++S  D  R  +  +G  +  + K +I +   
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVDEDK 65

Query: 71  VPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFDCPEDVM 130
           +  E+   L K            K +VD     +     F E+++    ++   C   ++
Sbjct: 66  LLDELEPLLRKG-----------KSIVDWHVNDV-----FPERLI--DLVVVLRCDNSIL 107

Query: 131 LERLLDRGKTSGRVDDNIES 150
            +RL  RG    ++++N+++
Sbjct: 108 YDRLHKRGYHDSKIEENLDA 127

>ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH]
           complement(87745..88404) [660 bp, 219 aa]
          Length = 219

 Score = 33.1 bits (74), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 61/153 (39%), Gaps = 29/153 (18%)

Query: 1   MSTTAFTPDQVSVIFVLGGPGAGKGTQCAKL---VADYGFVHLSAGDLLRAEQNREGSEF 57
           M  T   P+    I V G PG GK T C  L   + DY + ++S  D  R     +G + 
Sbjct: 1   MQQTRCRPN----ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDGYDE 54

Query: 58  GTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPS 117
                H + E  ++ +   L     AI       +   + D FP ++             
Sbjct: 55  ARK-SHIVDEDRLLDELEPLLRRGGAI-------VDWHVNDIFPERL------------I 94

Query: 118 KFILFFDCPEDVMLERLLDRGKTSGRVDDNIES 150
             ++   C   ++ +RL  RG  S ++++NI++
Sbjct: 95  DLVVVLRCDNAILHDRLQKRGYHSSKIEENIDA 127

>Scas_617.7
          Length = 420

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%)

Query: 37  FVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFL 96
           F H+  G L +AE  +        I+    E +++  EITL +  N  +E  D  +K F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 97  VDGF 100
            +GF
Sbjct: 298 EEGF 301

>YFR019W (FAB1) [1700] chr6 (184490..191326)
            Phosphatidylinositol-3-phosphate 5-kinase involved in
            orientation or separation of mitotic chromosomes [6837
            bp, 2278 aa]
          Length = 2278

 Score = 32.0 bits (71), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (78%)

Query: 170  EDQHKVIKIRCDSPVDDVYKQVKAAVDE 197
            +D+++ I+++  +P+ ++YK VK AVDE
Sbjct: 1679 KDKYQAIRLQTSTPIVEIYKNVKDAVDE 1706

>AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH]
           complement(414310..415854) [1545 bp, 514 aa]
          Length = 514

 Score = 31.2 bits (69), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 3   TTAFTPDQ--VSVIFVLGGPGAGKGTQCAKLVADY---GF-VHLSAGDLLRA 48
           T A+ P +   +V+  +G  GAGK T C+KL   Y   GF V L   D  RA
Sbjct: 95  TAAYQPKKKKSNVVMFVGLQGAGKSTSCSKLAVYYSKRGFKVGLVCADTFRA 146

>KLLA0D09020g 758818..760410 similar to sp|P20424 Saccharomyces
           cerevisiae YPR088c SRP54 signal recognition particle
           subunit, start by similarity
          Length = 530

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 3   TTAFTPD--QVSVIFVLGGPGAGKGTQCAKLVADY---GF-VHLSAGDLLRA 48
           T+ F P   Q +VI  +G  G+GK T C KL   Y   G+ V L   D  RA
Sbjct: 97  TSPFQPKKRQSNVIMFVGLQGSGKTTSCTKLAVYYSKRGYKVGLVCADTFRA 148

>YPR088C (SRP54) [5513] chr16 complement(711399..713024) Signal
           recognition particle subunit [1626 bp, 541 aa]
          Length = 541

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 5   AFTPDQ--VSVIFVLGGPGAGKGTQCAKLVADY---GF-VHLSAGDLLRA 48
           AF P +   ++I  +G  G+GK T C KL   Y   GF V L   D  RA
Sbjct: 101 AFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRA 150

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 28.5 bits (62), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 126 PEDVMLERL--LDRGKTSGRVDDNIESI----KKRFKTFEETSMPVVKYFEDQHKVI 176
           PE +  E L  +D+GK++G  D    S+    KK+ K  +  S+    Y ED++ ++
Sbjct: 3   PESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLV 59

>Scas_677.33
          Length = 1685

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 22/28 (78%)

Query: 170  EDQHKVIKIRCDSPVDDVYKQVKAAVDE 197
            +++++ +K++  +P+ ++YK VK AVDE
Sbjct: 1109 KNKYQALKLQTSTPIVEIYKNVKDAVDE 1136

>Scas_536.7
          Length = 1051

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 99   GFPRKMDQALSFEEQIVPSKFILFFDCPEDVMLERLLDRGKT----SGRVDDNIESIKKR 154
            G P  +D+A+     I+PS+ +   D  ED+ L+R + R  T    +G++   +  +KK 
Sbjct: 976  GLPYSLDRAI-----ILPSQRLEHIDHIEDLKLKRRMHRADTTDPVTGQLRQTVHRLKKN 1030

Query: 155  FKTFEET 161
                 ET
Sbjct: 1031 IHLLGET 1037

>YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential
           protein important for Skn7p-dependent transcription of
           target genes during oxidative stress [594 bp, 197 aa]
          Length = 197

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 63/153 (41%), Gaps = 29/153 (18%)

Query: 1   MSTTAFTPDQVSVIFVLGGPGAGKGTQCAKL---VADYGFVHLSAGDLLRAEQNREGSEF 57
           M    + P+    I V G PG GK + C  L   + DY + ++S  D  +     EG + 
Sbjct: 1   MEARRYGPN----IIVTGTPGCGKSSTCEFLKNKLKDYKYYNIS--DFAKDNDCFEGYDE 54

Query: 58  GTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPS 117
           G        +  IV ++  L +L+  +++  +  +   + D FP ++             
Sbjct: 55  G-------RKSHIVDEDKLLDMLEPLLRQG-NSIVDWHVNDVFPERL------------I 94

Query: 118 KFILFFDCPEDVMLERLLDRGKTSGRVDDNIES 150
             ++   C    +  RL  RG    ++++N+++
Sbjct: 95  DLVVVLRCDNSNLYSRLHARGYHDSKIEENLDA 127

>AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..993050)
            [6525 bp, 2174 aa]
          Length = 2174

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 156  KTFE-ETSMPVVKYFEDQHKVIKIRCDSPVDDVYKQVKAAVD 196
            K FE +  M  ++  ++++K ++++   P+ +VYK VK AVD
Sbjct: 1602 KEFELQREMERLQMNKNKYKAMRVKSSKPIVEVYKNVKDAVD 1643

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 3   TTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIK 62
            T F PD++ V+ VL            K+ A  G   +     L   +  E  ++  L++
Sbjct: 82  VTVFKPDELEVLAVLAD------VPVEKIRAPAGARAVRVQQALERFRTDEHDKYHALLE 135

Query: 63  -----HYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQI 114
                H       +P+   +AL+   ++E    G    L+ GFPR M +A+ FE ++
Sbjct: 136 ELHAVHGDDYSAHLPKGALVALMGRYLKEVCQAGDSVVLL-GFPRNMQEAIQFESEV 191

>Scas_628.1
          Length = 307

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 4/75 (5%)

Query: 43  GDLLRAEQNREGSEFGTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPR 102
            D+ RA++ R       LIK Y   G  VP+E+  A   N  Q+  D G+K  L   F  
Sbjct: 54  ADVRRAKRKRSKDTRRALIKEYEDRGEEVPEELKRAPRVNVNQQ--DSGIKIVLDCSFDD 111

Query: 103 KMD--QALSFEEQIV 115
            M+  + +S   QI 
Sbjct: 112 LMNDKEVVSLSNQIT 126

>Kwal_26.7628
          Length = 570

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%)

Query: 41  SAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKF 95
           + G +L A  N  G E    IK+ ++ G   P+ +T A+ + + Q  + K +K F
Sbjct: 111 TGGIILTASHNPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNF 165

>YOR154W (YOR154W) [4953] chr15 (624729..626492) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3650p [1764 bp, 587 aa]
          Length = 587

 Score = 28.1 bits (61), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 6/76 (7%)

Query: 107 ALSFEEQIVPSKFILFFD------CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEE 160
           ALS   +++P KF  FF       CP   M+             +   ++I KR    E 
Sbjct: 388 ALSCTSKLIPLKFDEFFKVLNASFCPSKQMISSSSSSAVPVIPEESIFKNIMKRLSQLET 447

Query: 161 TSMPVVKYFEDQHKVI 176
            S   V Y E+Q K++
Sbjct: 448 NSSLTVSYIEEQSKLL 463

>CAGL0K06083g complement(592576..593520) no similarity, hypothetical
           start
          Length = 314

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 44  DLLRAEQNREGSEFGTLIKHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGF 100
           +LL+ + +R+G++   +  H +TE L+VPQ  TL           D   K+    GF
Sbjct: 15  NLLKQDIDRDGTKLLKITIH-MTEALLVPQSSTLKKSLKTYAVKLDSARKQLKSQGF 70

>Scas_591.3
          Length = 665

 Score = 27.3 bits (59), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 13/102 (12%)

Query: 108 LSFEEQIVPSKFILF-FDCPEDVM-----LERLLDRGKTSGRVDDNIESIKKRFKTFEET 161
           LSF   + P+K +L      +D+      + ++L + +   +VDD+  SI KR+   +E 
Sbjct: 537 LSFPPLVAPTKVLLVPLSTHKDLQPVTKEVSKILRKAQIPFKVDDSGVSIGKRYARNDEL 596

Query: 162 SMP---VVKYFEDQHKVIKIRCDSPVDDVYKQVKAAVDERIN 200
             P    + +   +   + +R      D  KQV+ +V+E IN
Sbjct: 597 GTPFGITIDFESAKDGSVTLR----ERDSTKQVRGSVEEIIN 634

>Sklu_2175.4 YOL076W, Contig c2175 4893-7295
          Length = 800

 Score = 27.3 bits (59), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 74  EITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFDCPEDVMLER 133
           E+  AL K   Q + D  +K FLVD   R  D A  F+      K +++FD  E  +L+ 
Sbjct: 210 ELLPALFKEE-QSSVDLYLKNFLVDHLRRLGDDANMFKS---CEKLLVYFDDFE--LLKE 263

Query: 134 LLDRGKTSGRVDDNI 148
           L+  G + G+  D +
Sbjct: 264 LIRSGNSVGKSRDEL 278

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,526,787
Number of extensions: 284837
Number of successful extensions: 1030
Number of sequences better than 10.0: 45
Number of HSP's gapped: 1006
Number of HSP's successfully gapped: 48
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)