Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.825225213220.0
YIR035C2542529501e-131
CAGL0F06897g2582509281e-127
Scas_628.62522437711e-103
ACR171C2512527362e-98
CAGL0F06919g2502506711e-88
YIR036C2632556122e-79
ABR249W2502494931e-61
ABR247W2502494782e-59
ABR248W2612514626e-57
Sklu_2380.41601414476e-56
ABR246W2502524531e-55
KLLA0E08063g1861443862e-46
KLLA0E08052g1171072891e-32
AER373C3002371873e-16
KLLA0E09834g2681871742e-14
Kwal_14.24442881891732e-14
AFR561W2672001634e-13
Scas_594.122671941618e-13
KLLA0B08371g2681941512e-11
YMR226C2672121502e-11
AAL089W3282151513e-11
Sklu_2348.52891921494e-11
Kwal_26.88383232231494e-11
KLLA0F04455g3051691442e-10
CAGL0M11242g2681951432e-10
KLLA0E13860g8891681462e-10
Sklu_2420.53262271442e-10
KLLA0D15521g2562121423e-10
Kwal_26.91602671951414e-10
Scas_666.17*2831931381e-09
Sklu_1578.32681941371e-09
CAGL0G08690g2941721353e-09
KLLA0E24046g2802551319e-09
Kwal_34.160242921981292e-08
Scas_662.43072631273e-08
Kwal_55.195692882551255e-08
YOR246C3302231248e-08
AGL060W8911811251e-07
YIL124W (AYR1)2971621221e-07
Sklu_268.12442031212e-07
Scas_650.83262161185e-07
YNL202W (SPS19)2951901167e-07
KLLA0C12694g2592171151e-06
ABL163W2921981141e-06
Kwal_47.171022851901132e-06
KLLA0D06127g3302171132e-06
CAGL0J04774g3381911105e-06
Sklu_2267.53502361096e-06
YKL055C (OAR1)278921089e-06
CAGL0L02167g9011371072e-05
Scas_478.29201431044e-05
YDL114W3081941025e-05
Kwal_26.79508971381035e-05
Sklu_1570.17561441036e-05
Scas_613.182861911017e-05
CAGL0H08063g290127991e-04
Kwal_14.1511277211982e-04
KLLA0D18909g290187954e-04
Sklu_1624.3316194946e-04
Kwal_14.2598311197936e-04
Scas_652.19d1344156929e-04
YKR009C (FOX2)900103890.003
CAGL0K09152g327217870.004
Kwal_55.21822283210850.008
Scas_721.47344180830.013
Kwal_26.8282298240830.014
KLLA0D02596g347193830.014
KLLA0E22495g292202830.014
Kwal_27.12155280146820.015
YLR426W326111790.041
Scas_566.11346154790.047
Scas_675.10312198760.085
AEL164C307191750.13
Sklu_2219.3363164740.20
Kwal_23.4572300129730.23
CAGL0J11264g409140720.37
Scas_641.3128739710.39
ABR076C27193690.62
AER111W327105690.74
ADL292C329165690.75
Kwal_23.3107248191680.85
KLLA0B09812g346180681.1
YBR265W (TSC10)32039671.3
YHR006W (STP2)54174671.5
YBR159W34754661.9
Scas_693.23*37055662.0
Scas_655.19297204642.6
CAGL0J05852g34338643.4
ABL127W72891625.8
Kwal_26.7565704123626.5
CAGL0H07513g35251617.9
YBL047C (EDE1)1381178618.4
CAGL0K03531g12566588.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.8
         (252 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.8                                                            513   0.0  
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   370   e-131
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   362   e-127
Scas_628.6                                                            301   e-103
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   288   2e-98
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   263   1e-88
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   240   2e-79
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   194   1e-61
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   188   2e-59
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   182   6e-57
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          176   6e-56
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   179   1e-55
KLLA0E08063g complement(726232..726792) some similarities with s...   153   2e-46
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   115   1e-32
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    77   3e-16
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    72   2e-14
Kwal_14.2444                                                           71   2e-14
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    67   4e-13
Scas_594.12                                                            67   8e-13
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    63   2e-11
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    62   2e-11
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    63   3e-11
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       62   4e-11
Kwal_26.8838                                                           62   4e-11
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    60   2e-10
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    60   2e-10
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    61   2e-10
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        60   2e-10
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    59   3e-10
Kwal_26.9160                                                           59   4e-10
Scas_666.17*                                                           58   1e-09
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            57   1e-09
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    57   3e-09
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    55   9e-09
Kwal_34.16024                                                          54   2e-08
Scas_662.4                                                             54   3e-08
Kwal_55.19569                                                          53   5e-08
YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member...    52   8e-08
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    53   1e-07
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    52   1e-07
Sklu_268.1 , Contig c268 57-791 reverse complement                     51   2e-07
Scas_650.8                                                             50   5e-07
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    49   7e-07
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    49   1e-06
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    49   1e-06
Kwal_47.17102                                                          48   2e-06
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    48   2e-06
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    47   5e-06
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            47   6e-06
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    46   9e-06
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    46   2e-05
Scas_478.2                                                             45   4e-05
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    44   5e-05
Kwal_26.7950                                                           44   5e-05
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             44   6e-05
Scas_613.18                                                            44   7e-05
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    43   1e-04
Kwal_14.1511                                                           42   2e-04
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    41   4e-04
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            41   6e-04
Kwal_14.2598                                                           40   6e-04
Scas_652.19d1                                                          40   9e-04
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    39   0.003
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    38   0.004
Kwal_55.21822                                                          37   0.008
Scas_721.47                                                            37   0.013
Kwal_26.8282                                                           37   0.014
KLLA0D02596g join(complement(219682..219797),complement(218659.....    37   0.014
KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candid...    37   0.014
Kwal_27.12155                                                          36   0.015
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    35   0.041
Scas_566.11                                                            35   0.047
Scas_675.10                                                            34   0.085
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    33   0.13 
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         33   0.20 
Kwal_23.4572                                                           33   0.23 
CAGL0J11264g complement(1094218..1095447) highly similar to sp|P...    32   0.37 
Scas_641.31                                                            32   0.39 
ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH] (527756..528...    31   0.62 
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    31   0.74 
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    31   0.75 
Kwal_23.3107                                                           31   0.85 
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    31   1.1  
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    30   1.3  
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    30   1.5  
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    30   1.9  
Scas_693.23*                                                           30   2.0  
Scas_655.19                                                            29   2.6  
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    29   3.4  
ABL127W [465] [Homologous to ScYMR277W (FCP1) - SH] complement(1...    28   5.8  
Kwal_26.7565                                                           28   6.5  
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    28   7.9  
YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein wit...    28   8.4  
CAGL0K03531g complement(328279..328656) similar to sp|Q99278 Sac...    27   8.8  

>Scas_685.8
          Length = 252

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI
Sbjct: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
           TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI
Sbjct: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180

Query: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240
           VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY
Sbjct: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240

Query: 241 LSFDDPILKEFA 252
           LSFDDPILKEFA
Sbjct: 241 LSFDDPILKEFA 252

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  370 bits (950), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 213/252 (84%), Gaps = 1/252 (0%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           MGKVI+VTGVSRGIGKSIV+ +F L  D +VYG+ARSEAPLK LKE YGDRFFYV GDIT
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           +   L++LV+ A K  GKIDS+VANAGVLEPVQ+VN ID++AWKKL+DINFFS+VSL  I
Sbjct: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
            LP LKKTNGN+VFVSSDA +M+FSSWGAY +SKA LN FAMT+ANEE  VK ++VAPGI
Sbjct: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180

Query: 181 VDTSMQVNIRENVG-KDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGK 239
           VDT MQVNIRENVG   M++E   MF+ LKE+N+LLDS+VPATVY+KLAL+GIP  VNG+
Sbjct: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240

Query: 240 YLSFDDPILKEF 251
           YLS++DP L +F
Sbjct: 241 YLSYNDPALADF 252

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  362 bits (928), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 172/250 (68%), Positives = 213/250 (85%), Gaps = 1/250 (0%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KVI+VTGVSRGIGKSIV+ +F L  + IVYGIARSEAPLKALK+TYGDRFFY  GDIT+ 
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
             L+K V+ A +  GKI+S++ANAGVLEPVQ++N+ID++AWK+L++INFFS+VSL  I L
Sbjct: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126

Query: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182
           P+LKKT+G+ +FVSSDASD +FSSWGAY +SKA LN FAMT+ANEE AV+ L+VAPGIVD
Sbjct: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186

Query: 183 TSMQVNIRENVGKDMTSEDH-AMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYL 241
           T MQVNIREN+G    S++H  MF+DLK+ NKLL S++PATVYSKLALNGIP ++NG+YL
Sbjct: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246

Query: 242 SFDDPILKEF 251
           SFD  +LKEF
Sbjct: 247 SFDAEVLKEF 256

>Scas_628.6
          Length = 252

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 191/243 (78%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KVIIVTGVSRGIG++IV +I  L+S+A+V+GIAR+ APLK LK  +G++FFY+ GD+T++
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
             ++KL+  A  + G++DSVVANAGVLEPV +V  +D +AWK+LFDINFFS+VSL   TL
Sbjct: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123

Query: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182
           P+++ TN N VFVSS AS   +  W AYSASKA LN FAM+VANE+P VK +SVAPG+VD
Sbjct: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183

Query: 183 TSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLS 242
           T MQV+IRE  G +MT+E    F DL ++ +LLDS+VP  VY+KLA+NGIP ++NGKY  
Sbjct: 184 TQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSR 243

Query: 243 FDD 245
           ++D
Sbjct: 244 YND 246

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  288 bits (736), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 186/252 (73%), Gaps = 2/252 (0%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           M ++IIVTGVSRGIG+S+VE++ +   D +V G+ARSEA L+ L+ TYG++F YV GD+ 
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
            + A   LV   A   G+ID+VVANAGVLEPVQDVNHID+ AW++L+++NFFSVV L   
Sbjct: 60  SEDAQDALV-ARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
            LP LKK  G++VFVSS AS   +S+WGAY +SKA LN FAMT+A EEPAV+ ++VAPG+
Sbjct: 119 ALPLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGV 178

Query: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240
           VDT MQ +IR+  G  M  E    F +LK++++LLD  +PAT+++ LAL GIP   NGKY
Sbjct: 179 VDTQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKY 238

Query: 241 LSFDDPILKEFA 252
           L ++D IL  +A
Sbjct: 239 LRYNDDILAAYA 250

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  263 bits (671), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 183/250 (73%), Gaps = 1/250 (0%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           M KV++VTG SRGIG++IV+ I  L S+A+VYGIAR+E  LK+LK+T G RF Y+ GDIT
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           D+  + ++V+    EQG+IDS+VANAGVLEPV  V    +  WKKL+DINFFS++ L + 
Sbjct: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
           TLP+L+K+ GN +FVSS AS   +  W AY +SKA +N   M++A E  A+K ++VAPG+
Sbjct: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180

Query: 181 VDTSMQVNIRENVGKD-MTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGK 239
           VDT MQ +IR+  G   MT++    F DLK++ +LLD++VP  +Y++LA++GIP ++NG+
Sbjct: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240

Query: 240 YLSFDDPILK 249
           Y+ ++D  L+
Sbjct: 241 YVRYNDSRLQ 250

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  240 bits (612), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 122/255 (47%), Positives = 176/255 (69%), Gaps = 10/255 (3%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG-DRFFYVTGDI 59
           MGKVI++TG SRGIG  +V+ + +   + IVYG+AR+EA L++L+  YG D+F Y   DI
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHI----DIDAWKKLFDINFFSVV 115
           TD+  ++ LV+   ++ GK+D +VANAG+LEPV+ ++      DI  W++LFD+NFFS+V
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 116 SLTSITLPYLKKTN--GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPA--V 171
           SL ++ LP LK +   GNIVFVSS AS   ++ W AY  SKA LN FAM +A+EEP+  V
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

Query: 172 KCLSVAPGIVDTSMQVNIRENVG-KDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALN 230
           + + +APG+VDT MQ +IRE +G + MT +    F  L +++ LLD  VPA V ++L L 
Sbjct: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240

Query: 231 GIPVDVNGKYLSFDD 245
           GIP  +NG+YL ++D
Sbjct: 241 GIPDSLNGQYLRYND 255

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  194 bits (493), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 156/249 (62%), Gaps = 3/249 (1%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KVIIVTG SRGIG + V+R+   + D +V G+AR+E  L+ LK  +G +F YV GD+TD+
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS-TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
             +Q ++D  + E G++D+VVANAGV    Q +   DI  W++LF+IN FSVV+L S  L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182
           P L+K+ G  + V+S  S M   +  AY++SK  LN FA+ +A EE  ++ L++ PG+V 
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQ 179

Query: 183 TSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLS 242
           T M         K   ++D+++ ++L +  +++    P TV + LA  GIP ++NGKY++
Sbjct: 180 TDMTAAALVAADKAAGTQDNSV-RELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYVT 238

Query: 243 FDDPILKEF 251
           FD   L  +
Sbjct: 239 FDSEKLAAY 247

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  188 bits (478), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 155/249 (62%), Gaps = 3/249 (1%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           +V+IVTG SRGIG++ VE++   ++D +V G+AR+E  L+ LK  +G +F YV GD+TD+
Sbjct: 2   RVVIVTGASRGIGEATVEKLCP-TADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
             +Q ++D  + E G++D+VVANAGV    + +   DI  W++LF+IN FSVV+L S  L
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 123 PYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVD 182
           P L+++ G ++ VSS  S M   +  AY++SK  LN FA+ +A EEP ++ +++ PG V 
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQ 179

Query: 183 TSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLS 242
           T M         +   S+D+A+ + LK+  ++     P  V + LA  GIP ++NGKY+ 
Sbjct: 180 TDMLAEGINAADEAAGSQDNAVRELLKQV-RVATPEEPGAVLAALAARGIPEELNGKYVR 238

Query: 243 FDDPILKEF 251
            D   L  +
Sbjct: 239 ADSEKLAAY 247

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  182 bits (462), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 154/251 (61%), Gaps = 7/251 (2%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KVIIVTG SRGIG + V+R+   + + +V G+AR+E  L+ LK  +G +F YV GD+TD+
Sbjct: 13  KVIIVTGASRGIGAATVDRLCS-TPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 71

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVL--EPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
             +Q ++D  +   G++D+VVANAGV   E ++D    DI  W++LF+IN FSVV+L S 
Sbjct: 72  RVVQAVIDKVSSGYGRLDAVVANAGVAGHERIEDA---DIKEWRRLFEINLFSVVNLASK 128

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
            LP L+K+ G  + VSS  S M   +   Y++SK  LN FAM +A EEP ++ +++ PG+
Sbjct: 129 ALPLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDPGV 188

Query: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240
             T M  +      +   ++D+A  +++    ++   + P TV + LA  GIP ++NGK+
Sbjct: 189 AQTDMLTDGLNAADQAAGTQDNAA-REMMRHVRVASPDEPGTVLAALAAKGIPEELNGKF 247

Query: 241 LSFDDPILKEF 251
           + +D   L  +
Sbjct: 248 VVYDSEELAAY 258

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  176 bits (447), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 87/141 (61%), Positives = 114/141 (80%), Gaps = 1/141 (0%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFK-LSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDI 59
           M KV++VTG SRGIG++IV  +    +S+ +V GIARSE PL A+K  +GD+F Y+ GDI
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60

Query: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119
           +D+  L+K V+ A K+ G+ID+VVANAGVLEPVQDVN+ID+  WK+LFD+NFFS+VSL S
Sbjct: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVS 120

Query: 120 ITLPYLKKTNGNIVFVSSDAS 140
           ++LP+LKK NGNIVFVSS AS
Sbjct: 121 LSLPHLKKFNGNIVFVSSGAS 141

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  179 bits (453), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 155/252 (61%), Gaps = 4/252 (1%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           M +VIIVTG SRGIG++ VE++   + D +V G+AR+E  LK LKE YG +F YV GD+T
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCT-APDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVT 59

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           D+  +Q ++D  + + G++D+++ANAGV    + +   DI  WK+ F+I   S VSL S 
Sbjct: 60  DESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSK 117

Query: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180
            LP L+K+ G ++ V+S  S + + +  + ++SK  LN F   +A EEPA++ ++VAPG+
Sbjct: 118 ALPMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGV 177

Query: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240
           V T M V    +  +D        FK + +  +++  + P  V + LA+ GIP ++NG++
Sbjct: 178 VRTDMTVEAL-DASEDAPGARDNFFKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGRF 236

Query: 241 LSFDDPILKEFA 252
           + FD   L  +A
Sbjct: 237 VQFDSEKLAAYA 248

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  153 bits (386), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 102/144 (70%)

Query: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60
           M KV +VTGVSRGIG SIVE++  + +  IV GIARS+  L+ LK  Y  +F Y+ GD++
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           D+  + + V+    +  ++D +VANAGVL+PV+DVN+I I  WK+LFDINFFSVVSL   
Sbjct: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120

Query: 121 TLPYLKKTNGNIVFVSSDASDMHF 144
            LP LK++NGNIV VSS AS   +
Sbjct: 121 ALPLLKQSNGNIVLVSSGASTKSY 144

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  115 bits (289), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 147 WGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVDTSMQVNIRENVGKD-MTSEDHAMF 205
           WGAY ASKA LN FA T+A EEPAVK +SVAPG+V T MQ +IRE  G   MT E    F
Sbjct: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69

Query: 206 KDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLSFDDPILKEFA 252
            DL ++++LL  +VP T+Y+ LA  GIP +++G YL ++D  L+ F+
Sbjct: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 76.6 bits (187), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 119/237 (50%), Gaps = 22/237 (9%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG-DRFFYVTGDIT 60
            KV++VTG S GIG  + + +   +   +VY  ARS  P++AL++  G ++   V  D+T
Sbjct: 14  AKVVLVTGASSGIGYELTKEL--ANRGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVT 71

Query: 61  DQVALQKLVDGAAKE--QGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
           D+  + KL    +KE   GK+ ++  NAG     P  DV    I+   K F +N F+ ++
Sbjct: 72  DEEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAVDVTPEMIE---KCFRVNVFAPMN 128

Query: 117 LTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE-EP-AVKCL 174
           +T    P L + +G IVF  S A  + F     YSA+KA ++++A  +  E +P  V+ +
Sbjct: 129 ITREFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGVRVI 188

Query: 175 SVAPGIVDTSMQVNIRENVGKDMTS-----EDHAMFKDLKESNKLLDSNVPATVYSK 226
           +   G V T    NI +      +S     E  A F + ++      S +PA VY++
Sbjct: 189 NAVTGGVAT----NIADTRPLPKSSVYNFAEGKAAFAE-RQRMASRSSPMPAPVYAR 240

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 93/187 (49%), Gaps = 12/187 (6%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEA-PLKALKETYGDRFFYVTGDITD 61
           +VI++TG S GIG SI E +   S+   V+G +R  + P K         F  +  DITD
Sbjct: 4   QVILITGASTGIGLSIAETL--RSAGYEVFGTSRKGSIPGKEYS------FKMIKLDITD 55

Query: 62  QVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSIT 121
           + +++  V+   ++ G+ID +V NAG+      V     D  K +F+ NFF V  +T   
Sbjct: 56  EESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTRAV 115

Query: 122 LPYLK-KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCLSVAP 178
           LP+++ + +G I+ +SS    M       Y +SK  L  +  ++  E  +  +   ++ P
Sbjct: 116 LPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHVSTIDP 175

Query: 179 GIVDTSM 185
            I+ T M
Sbjct: 176 HIIKTGM 182

>Kwal_14.2444
          Length = 288

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 92/189 (48%), Gaps = 11/189 (5%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KV +VTG S GIG  +  ++   S    VY  AR E  L+ L + + +    V  D+++ 
Sbjct: 5   KVAVVTGASSGIGYELTRQL--ASKGYKVYAAARREQRLETLAKEFPELVVPVKLDVSEP 62

Query: 63  VALQKLVDGAAKE--QGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVVSLT 118
             +  L +  AKE    K+D +  NAG     P  DV +   D  ++ F +N F  V+L 
Sbjct: 63  EQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTN---DVLEQAFKVNVFGPVNLC 119

Query: 119 SITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE-EP-AVKCLSV 176
              LP++ K  G ++F  S A  M F     YSA+K  ++ +A  +  E +P  V+ L+V
Sbjct: 120 KELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGVRVLNV 179

Query: 177 APGIVDTSM 185
             G V T +
Sbjct: 180 VTGGVKTDI 188

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 67.4 bits (163), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 96/200 (48%), Gaps = 10/200 (5%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAI-VYGIARSEAPLKALKETYGDRF----FYVTG 57
           K+++VTG S GIG++        +  AI +  +AR    L +LK+    ++     +V  
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 58  -DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+T    ++  ++G  +E   ID ++ NAG     + V  I +D  +++F+ N   +V 
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 117 LTSITLPYLK-KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           LT   LP +K K +G+IV V S A    +     Y A+K  +  F   +  E     ++ 
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRV 193

Query: 174 LSVAPGIVDTSMQ-VNIREN 192
             +APG V+T    V +R N
Sbjct: 194 FEIAPGSVETEFSMVRMRGN 213

>Scas_594.12
          Length = 267

 Score = 66.6 bits (161), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 93/194 (47%), Gaps = 9/194 (4%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAI-VYGIARSEAPLKALKETYGDRF----FYVTG 57
           K++ +TG S GIG++        S+  + +  +AR    L+ LKE    ++     Y+  
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 58  -DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+T+   +Q  +D   +E   ID ++ NAG       V  IDI   K + D N   +++
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133

Query: 117 LTSITLP-YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           +T   L  + KK +G+IV + S A    + +   Y ASK  +  F  ++  E     ++ 
Sbjct: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193

Query: 174 LSVAPGIVDTSMQV 187
           + +APGIV+T   V
Sbjct: 194 ILIAPGIVETEFSV 207

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 9/194 (4%)

Query: 3   KVIIVTGVSRGIGKSI-VERIFKLSSDAIVYGIARSEAPLKALKET----YGDRFFYVTG 57
           K I +TG S GIG++  +E +   + +  +   AR  A L+ LKE     Y     Y+  
Sbjct: 14  KTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIGQ 73

Query: 58  -DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+T+   +Q  +D   +E   ID ++ NAG       V  I  +  K + D N  ++++
Sbjct: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133

Query: 117 LTSITLPYLK-KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           +T   LP  K K +G+IV + S A    + +   Y ASK  +  F  ++  E     ++ 
Sbjct: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193

Query: 174 LSVAPGIVDTSMQV 187
           + +APG V+T   +
Sbjct: 194 IEIAPGNVETEFSL 207

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 98/212 (46%), Gaps = 16/212 (7%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSS-DAIVYGIARSEAPLKALKETYGDRF-----FYVT 56
           K +++TG S GIGK+      + S+ D  +   AR    L+ LK+T    F         
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

Query: 57  GDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            DIT    ++  ++   +E   ID +V NAG       V  I  +  + +FD N  ++++
Sbjct: 74  LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

Query: 117 LTSITLPYLK-KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           +T   LP  + K +G+IV + S A    + +   Y ASK  +  F  ++  E     ++ 
Sbjct: 134 ITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRV 193

Query: 174 LSVAPGIVDTSMQ-VNIR------ENVGKDMT 198
           + +APG+V+T    V  R      +NV KD T
Sbjct: 194 ILIAPGLVETEFSLVRYRGNEEQAKNVYKDTT 225

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 93/215 (43%), Gaps = 39/215 (18%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGI--ARSEAPLKALKETYGDRF-------- 52
           KV +VTG + GIG   V  ++       V G   +R    +K +K+   +R         
Sbjct: 20  KVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQEAENRLETARQDPH 79

Query: 53  ----------FYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDA 102
                      Y+  D+TD  +++K       ++  +D ++ NAGV+    ++ H   D 
Sbjct: 80  DELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYELTH---DG 136

Query: 103 WKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS----------------S 146
           ++     N+ S   LT   LPY+K++ G +V +SS    + F+                +
Sbjct: 137 FEVQMQTNYVSHFLLTMRLLPYVKRSGGRVVTLSSIGHKIQFTYCPLDCHFDYRPNIFFT 196

Query: 147 WGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIV 181
           W  Y+ +K    +F   +A + P V C++V PG+V
Sbjct: 197 WLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 94/192 (48%), Gaps = 17/192 (8%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           KV +VTG S GIG  I + +   S    VY  AR   P+K L+E + ++   V+ D++D 
Sbjct: 5   KVALVTGASSGIGYEITKLL--ASKGYTVYAAARRTTPIKPLEEEFPEKVIAVSLDVSD- 61

Query: 63  VALQKLVDGAAK-----EQGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVV 115
             LQ++ D  A+        K+  +  NAG     P  DV +   D  ++ F +N F  +
Sbjct: 62  --LQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGN---DKIEQCFKVNVFGPM 116

Query: 116 SLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE-EP-AVKC 173
           +L      ++    G IVF  S A  + F     YS++KA ++++A  +  E +P  VK 
Sbjct: 117 NLCREMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKPFGVKV 176

Query: 174 LSVAPGIVDTSM 185
           ++   G V T++
Sbjct: 177 INAITGGVATNI 188

>Kwal_26.8838
          Length = 323

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 98/223 (43%), Gaps = 46/223 (20%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARS-----------EAPLKALKETYGDR 51
           KV +VTG + GIG   V  ++       V G   S           EA  +  KE    R
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKEARTRIKKEDPESR 78

Query: 52  -----FFYVTGDITDQVALQKLVDGAAKE----QGKIDSVVANAGVLEPVQDVNHIDIDA 102
                 ++++ D+T+     KLVD AAK     + ++D ++ NAGV+     V     D 
Sbjct: 79  HPVGELYFLSLDLTEL----KLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTE---DG 131

Query: 103 WKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS----------------S 146
           ++     N+ +   LT   LP +K+  G I+ VSS   ++ FS                +
Sbjct: 132 FEIQLQTNYIAHFLLTMRLLPSVKRCRGRIITVSSIGHNLEFSYFSLAQSFNYKPNMLFT 191

Query: 147 WGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVDTSMQVNI 189
           W  Y+ +K    +FA  +A + P V C+SV PG+V   M+ N+
Sbjct: 192 WMRYAMAKTASIQFAKMLAIKHPDVLCMSVHPGLV---MKTNL 231

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 76/169 (44%), Gaps = 9/169 (5%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           K  +VTG S GIG  + + +  L     VY  AR   P++ L+  +GDR      D+++Q
Sbjct: 5   KYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDVSNQ 62

Query: 63  VALQKLVDGAAKE--QGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVVSLT 118
             + +L     +E    K+  +  NAG     P  DV+   ID     F +N +  ++  
Sbjct: 63  NDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIID---NTFRVNVYGPINSC 119

Query: 119 SITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
               P +    G IVF  S A    F     YSASKA ++++A  +  E
Sbjct: 120 REFAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGE 168

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 92/195 (47%), Gaps = 9/195 (4%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAI--VYGIAR---SEAPLKALKETYGDRFFYVT 56
           GK+  +TG S GIGK+        S+ ++  V G  R    E   K L   Y D   ++ 
Sbjct: 13  GKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIHIG 72

Query: 57  G-DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVV 115
             D+TD   +++ +    +E   ID ++ NAG       V  ID +    + + N  +++
Sbjct: 73  KLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALI 132

Query: 116 SLTSITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVK 172
           +LT + LP  KK N G+IV + S A    + +   Y A+K  +  F  ++  E     ++
Sbjct: 133 NLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELINTDIR 192

Query: 173 CLSVAPGIVDTSMQV 187
            + +APG+V+T   V
Sbjct: 193 VIEIAPGMVETEFSV 207

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 84/168 (50%), Gaps = 5/168 (2%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYV-TGDIT 60
           GKV+I+TG   G+GKS  +   +  +  ++  I    A +  + + YG       T DI 
Sbjct: 313 GKVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSGSAVADTHDIV 372

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
            +   Q++V  A  + G++D +V NAG+L   +    +  D W  + +++ FS  +L+  
Sbjct: 373 KEA--QQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLFSTFALSKA 429

Query: 121 TLP-YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
             P +LK+ +G I+  +S +          Y+A+KA +  F+ T+A E
Sbjct: 430 VWPIFLKQKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALE 477

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 94/205 (45%), Gaps = 11/205 (5%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAP--LKALKETYGDRFFYVTGD-I 59
           +V+I+TG   G+G+       K     +V  + RS A   ++ +K+  G+       D +
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGEGDAVANYDSV 67

Query: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119
           +D  A   +V+ A    G++D ++ NAG+L        +    ++++ D++      LT 
Sbjct: 68  SDNGA--AIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNGAFKLTR 124

Query: 120 ITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCLSV 176
              P+++K   G I+   S A          YSA+K  L  F  ++A E  +  +   S+
Sbjct: 125 AAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYNINVNSI 184

Query: 177 APGIVDTSMQVN-IRENVGKDMTSE 200
           AP +  ++M  N I  N+ K++  E
Sbjct: 185 AP-LARSAMTENVIPANILKELGPE 208

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 101/227 (44%), Gaps = 51/227 (22%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARS-------------EAPLKALKETYG 49
           KV +VTG + GIG   V  ++      IVY   R+             EA  +  K T+ 
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYM--HGFIVYVGGRNSSRVNQAIKAIQNEAKSRQRKSTFK 76

Query: 50  D--------RFFYVTGDITDQVALQKLVDGAAKEQG---KIDSVVANAGVLEPVQDVNHI 98
                    +  +++ D++D   L+ +   AAK +G    +D ++ NAGV+    ++   
Sbjct: 77  GLKLERNFGKLHFLSLDLSD---LRSVDKAAAKFKGLELSLDVLINNAGVMALPYEITK- 132

Query: 99  DIDAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS------------- 145
             D ++     N+ S   LT   LP +K+ NG ++ VSS   ++ F+             
Sbjct: 133 --DGFEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSIGHNLEFTYFNLNRDFNYMPN 190

Query: 146 ---SWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVDTSMQVNI 189
              +W  Y+ +K  L +F   +A + P V C+SV PG+V   M+ N+
Sbjct: 191 IIFTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV---METNL 234

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 96/212 (45%), Gaps = 10/212 (4%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALK-ETYGDRFFYVTGDIT 60
           GK+ +VTG S G+G+ I   +F   +  ++     SE    A   +  G R      D+T
Sbjct: 8   GKIALVTGASTGVGEGIARALFVRGATVVITSRHLSEVQETAGNIDPSGSRVIGKEVDVT 67

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQ-DVNHIDIDAWKKLFDINFFSVVSLTS 119
              A++ L+    +E G +  +V NAG+  P Q  +   DID+W+++ D N         
Sbjct: 68  VAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTFYTLK 127

Query: 120 ITLPYLKKTN-----GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVK 172
             LP ++ ++       +V +S+    +       Y+A+K  +     +VA E  E  V+
Sbjct: 128 YALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYAERNVR 187

Query: 173 CLSVAPGIVDTSMQVNIRENVGKDMTSEDHAM 204
             +VAPG V T     + +   + M+S+ H M
Sbjct: 188 VNAVAPGYVSTPKIQALPKETQQWMSSQ-HPM 218

>Kwal_26.9160
          Length = 267

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 88/195 (45%), Gaps = 9/195 (4%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIA-RSEAPLKALKETYGDRF----FYVT 56
           GK +++TG S GIG++        S+  I   +A R    LK +K  +   F     Y+ 
Sbjct: 13  GKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIG 72

Query: 57  G-DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVV 115
             D+T    ++  +D   +E   ID ++ NAG       V  ID    + +   N  +++
Sbjct: 73  QLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALI 132

Query: 116 SLTSITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVK 172
           ++T   LP  K  N G+IV + S A    + +   Y A+K  +  F  ++  E     ++
Sbjct: 133 NMTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRKELINTNIR 192

Query: 173 CLSVAPGIVDTSMQV 187
            + +APG V+T   +
Sbjct: 193 VIEIAPGNVETEFSL 207

>Scas_666.17*
          Length = 283

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 88/193 (45%), Gaps = 20/193 (10%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQV 63
            +++TG S G+G +IV R         +  + +  +P          R   +  D+++QV
Sbjct: 27  CVVITGGSHGLGHAIVVRFLNKVPKITIINVDKISSPQD------DPRMVTIQCDLSNQV 80

Query: 64  ALQKLVDGAAKEQG-KIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
            ++K +    ++ G +I  ++ NAG+    Q+  H+D +   ++F +N F+ V      +
Sbjct: 81  EMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQSLV 140

Query: 123 PYLKKTNGN-----IVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPA-----VK 172
           P   + N N     IV V+S    +  +    Y ASK+ L  F  + + E        ++
Sbjct: 141 P---EENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALIAFHQSYSMELQTRRVSNIR 197

Query: 173 CLSVAPGIVDTSM 185
            L V PG ++T+M
Sbjct: 198 TLLVVPGQLNTAM 210

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 90/194 (46%), Gaps = 9/194 (4%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGI-ARSEAPLKALKE----TYGDRFFYV-T 56
           K + +TG S GIG++        S+  I   + AR    L+ LK+     Y +   Y+  
Sbjct: 14  KTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYIGV 73

Query: 57  GDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+T+   ++  +DG  +E   ID ++ NAG       V  I  +  + + + N  ++++
Sbjct: 74  LDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLALIN 133

Query: 117 LTSITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           +T   LP  K  N G+IV + S A    + +   Y ASK  +  F  ++  E     ++ 
Sbjct: 134 ITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSLRKELVNTNIRV 193

Query: 174 LSVAPGIVDTSMQV 187
           + +APG V+T   +
Sbjct: 194 IEIAPGNVETEFSL 207

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTG-DITD 61
           KV +VTG S GIG  + + + +      V+  AR  AP++ L  ++G         DI++
Sbjct: 8   KVAVVTGASSGIGYEVTKELARKGFK--VFACARRTAPIEPLVNSFGKELIVPHHLDISE 65

Query: 62  QVALQKLVDGAAKE--QGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVVSL 117
              + K  +  A E  + K+D +  NAG     P  DV++   D  ++ F +N F  +++
Sbjct: 66  LDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDVSN---DVMEQCFKVNVFGHINM 122

Query: 118 TSITLPYLKKTNGNIVFVSSDA--SDMHFSSWGAYSASKACLNRFAMTVANE 167
           T     YL    G ++F  S A  S + F S   Y+A+KA ++ +A T+  E
Sbjct: 123 TRELAQYLINAKGTVIFTGSIAGFSTLPFGS--IYAATKAAIHEYARTLHLE 172

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 115/255 (45%), Gaps = 39/255 (15%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKA--LKETYGDRFFYVTGDI 59
           GKV +VTG S GIG ++ E + +  +   V+  + +    +A  L   Y  +       +
Sbjct: 30  GKVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAVELSAKYNVKVVAYQCPV 89

Query: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLE---PVQDV--NHIDIDAWKKLFDINFFSV 114
           T++  ++K ++   +E GKID  +ANAGV     P+ +   +  D D W K+   +F  V
Sbjct: 90  TEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIHTDFNGV 149

Query: 115 VSLTS-ITLPYLKKTNGNIVFVSSDASDM----HFSSWGAYSASKACLNRFAMTVANEEP 169
                 +   + ++ +G++V  +S +  +       +   Y+A+KA +  FA ++A E  
Sbjct: 150 YYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQA--CYNAAKAGVIHFAKSLAVEWA 207

Query: 170 A-VKCLSVAPGIVDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLA 228
              +  +V+PG + T     I   V +D+ ++ H++    +E                  
Sbjct: 208 GFARVNTVSPGYIATP----ISNFVDEDLKNKWHSLIPMGRE------------------ 245

Query: 229 LNGIPVDVNGKYLSF 243
             G+P ++ G YL F
Sbjct: 246 --GLPQELVGAYLYF 258

>Kwal_34.16024
          Length = 292

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 89/198 (44%), Gaps = 18/198 (9%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITD 61
           GK++IVTG +  IG++I E      +D  V            L + YG        DIT+
Sbjct: 39  GKLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQVDITN 98

Query: 62  QVALQKLVDGAAKE--QGKIDSVVANAGVLEPVQDV--NHIDIDAWKKLFDINFFSVVSL 117
              ++  +    K+     ID+ +ANAGV      V       +AW+++ D+N       
Sbjct: 99  DEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTFHC 158

Query: 118 TS-ITLPYLKKTNGNIVFVSSDASDM----HFSSWGAYSASKACLNRFAMTVANE----- 167
              +   + ++ +G ++  +S +S +    ++ +   Y+ASKA +   A   A E     
Sbjct: 159 AQEVAHVFKRQGHGCLILTASMSSHIANVPNYQT--CYNASKAAVRHMARGFAVEFAHLT 216

Query: 168 EPA--VKCLSVAPGIVDT 183
           EPA  ++C SV+PG  DT
Sbjct: 217 EPAGRIRCNSVSPGYTDT 234

>Scas_662.4
          Length = 307

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 108/263 (41%), Gaps = 43/263 (16%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTG----- 57
           K  IVTG S GIG  I + + +  +  IVY  AR   P+  L                  
Sbjct: 10  KTAIVTGASSGIGYEITKELAR--NGFIVYACARRLGPIDDLINDLAPELTTELAKAVIK 67

Query: 58  ----DITDQVALQKLVDGAAKE--QGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDI 109
               DI+ +  +++      KE   GK+D +  NAG     P  DV +   D  ++ F +
Sbjct: 68  PYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN---DVMEQCFKV 124

Query: 110 NFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE-E 168
           N F  V++      YL +  G IVF  S A    F     YSA+KA ++ +A  +  E +
Sbjct: 125 NVFGHVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHLEMK 184

Query: 169 P-AVKCLSVAPGIVDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSN--------- 218
           P  V+ ++V  G V T        N+       D +++ +  E  K  +           
Sbjct: 185 PFGVRVINVVTGGVAT--------NIADTRPLPDDSVY-NFPEGRKAFEYRQSMAKNHHP 235

Query: 219 VPATVYSKLALNGI-----PVDV 236
           +PA VY+K  +  I     PVDV
Sbjct: 236 MPADVYAKELIKDILSDKDPVDV 258

>Kwal_55.19569
          Length = 288

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 110/255 (43%), Gaps = 43/255 (16%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSE--APLKALKETYGDRFFYVTGDI 59
           GKV  ++G S GIG ++     +  +D  V+  +  +     K L ETYG R       +
Sbjct: 38  GKVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKCPV 97

Query: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDID-------AWKKLFDINFF 112
           TD+  +++ +    K+  KID  VANAGV  P  +   I+ +        W+K+F+ +F 
Sbjct: 98  TDEAKVKETILQVEKDFSKIDIFVANAGV--PWSEGPLIEAEERGVATKEWEKVFNTDFQ 155

Query: 113 SVVSLTSITLPYLKKT-NGNIVFVSSDASDM----HFSSWGAYSASKACLNRFAMTVANE 167
            V   + +     KK   G++V  +S +  +       +   Y+A+KA +   + ++A E
Sbjct: 156 GVYYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQA--CYNAAKAGVIHLSRSLAVE 213

Query: 168 EPA-VKCLSVAPGIVDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSK 226
                +  S++PG +DT +                 A F + K   +  +        + 
Sbjct: 214 WAGFARVNSISPGYIDTPI-----------------ATFAEAKMKQRWHE-------LTP 249

Query: 227 LALNGIPVDVNGKYL 241
           L   G+P ++ G YL
Sbjct: 250 LGREGLPEELVGAYL 264

>YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member of
           the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases, has low
           similarity to a region of WW domain-containing
           oxidoreductase (mouse Wwox), which is an apoptosis
           activator [993 bp, 330 aa]
          Length = 330

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 89/223 (39%), Gaps = 50/223 (22%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPL-KALKETYGD----------- 50
           K+ +VTG + GIG   V  ++      +VY   R+   + KA++E   +           
Sbjct: 17  KIAVVTGGNTGIGWYTVLHLYL--HGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDG 74

Query: 51  ---------------RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLE-PVQD 94
                             Y+  D+TD   +++      K +  ID +V NAG++  P++ 
Sbjct: 75  SSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLE- 133

Query: 95  VNHIDIDAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS--------- 145
              +  D ++     N+ S    T   LP L+   G I+ +SS    + F          
Sbjct: 134 ---MTKDGFEVQLQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKTWD 190

Query: 146 -------SWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIV 181
                  +W  Y+ SK  L +    +A + P V CLSV PG+V
Sbjct: 191 YKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLV 233

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 89/181 (49%), Gaps = 9/181 (4%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGD-RFFYVTGDI-T 60
           KV+I+TG   G+G+S      K  +  +V  +  ++  +  +   YG+ R    + +I T
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNIVT 379

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
           D  A   +V+ A K   ++D +V NAG+L     V   D D W  +  ++  SV +L+  
Sbjct: 380 DAAA---VVETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFALSKA 435

Query: 121 TLP-YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCLSVA 177
             P ++++ +G IV  +S +          YSA+KA +  F+ ++A E  +  ++   +A
Sbjct: 436 VWPIFMQQRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYVIA 495

Query: 178 P 178
           P
Sbjct: 496 P 496

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 18/110 (16%)

Query: 67  KLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVV--------SLT 118
           K+V  A    G++D +V NAG+L            ++ K+ + NF +VV         L 
Sbjct: 79  KIVKTAIDAFGRVDVIVNNAGILRD---------GSFAKMTEKNFSAVVDVHLNGSYKLC 129

Query: 119 SITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
               PY+++   G IV  +S A          YSA+K  L   + T+A E
Sbjct: 130 KAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETLAKE 179

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 6/162 (3%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG-DRFFYVTGDIT- 60
           K+ +VTG S GIG  + + + +  +  +VY  AR   P+  L   +G D       DI+ 
Sbjct: 10  KIAVVTGASGGIGYEVTKELAR--NGYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISK 67

Query: 61  -DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119
            +++        A    GK+D +  NAG       ++  D  A ++ F +N F  +++  
Sbjct: 68  PEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDA-AVEQCFKVNVFGHINMCR 126

Query: 120 ITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFA 161
               +L K  G IVF  S A  + F     YSASKA ++++A
Sbjct: 127 ELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYA 168

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 91/203 (44%), Gaps = 13/203 (6%)

Query: 5   IIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVT--GDITDQ 62
           +IVTG + GIGK+IV +   L   A V     +E  L  LKE+  D     T   D+   
Sbjct: 7   VIVTGAASGIGKAIVNQC--LQEGASVIACDLNEQALLVLKESLNDSTVLDTYPMDVRKY 64

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVL--EPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
             +         E   +D +V NAG+   + + D    +ID   K+ DIN    +  + +
Sbjct: 65  EEVAAFFAYVETEHSDVDGLVNNAGIYLAKHILDYQEDEID---KVLDINVKGYIYFSQM 121

Query: 121 TLPYL--KKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVA-NEEPAVKCLSVA 177
               L   +  G IV +SS  S    SS   Y +SKA +     + A N  P ++  +VA
Sbjct: 122 FGKKLFHSQRKGVIVNLSS-VSGQEGSSDAIYGSSKAAILGLTKSCAMNFSPYIRVNAVA 180

Query: 178 PGIVDTSMQVNIRENVGKDMTSE 200
           P +V+TSM  +I E   K+  S 
Sbjct: 181 PTMVNTSMMDSIPEWRKKEYLSH 203

>Scas_650.8
          Length = 326

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 87/216 (40%), Gaps = 40/216 (18%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYG-------------IARSEAPLKAL----- 44
           KV ++TG + GIG   V  ++       + G                +EA L  L     
Sbjct: 17  KVAVITGGNSGIGWYTVLHLYMHGFTVYLCGRTSHKIKKAINEITIEAEARLGLLEKEVD 76

Query: 45  ---KETYGDRFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDID 101
              K+ +     Y+  D+TD   ++K      K + KID ++ NA +L    ++     D
Sbjct: 77  DFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTK---D 133

Query: 102 AWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS---------------- 145
            ++     N+ +   LT   LP +KK +G I+ + S    +  +                
Sbjct: 134 GFEIQLQTNYIAHFLLTMRLLPAIKKCHGRIITLGSLGHRLEVTYWNLNKKWDYKPNMIF 193

Query: 146 SWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIV 181
           +W  Y+ +K    ++   ++ + P V CLS+ PG+V
Sbjct: 194 TWFRYAVAKTASIQYTKMLSIKYPEVLCLSLHPGLV 229

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 8/190 (4%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYG--IARSEAPLKALKETYGDR---FFYVT 56
           GKV  VTG +  I +   E +  L   A + G    R+E   K + +   D+        
Sbjct: 27  GKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIAN 86

Query: 57  GDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+ +   ++  V    ++ GKID V+A A     V D  ++  +A+K + DI+     +
Sbjct: 87  VDVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFN 145

Query: 117 LTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCL 174
                L  LKK+ G+I+FVS+          G   A+KA ++  A  +A E     ++  
Sbjct: 146 TAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSN 205

Query: 175 SVAPGIVDTS 184
            +APG +D +
Sbjct: 206 CIAPGAIDNT 215

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 99/217 (45%), Gaps = 38/217 (17%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSDAIVY------GIARSEAPLK--------------- 42
           V IV+G +RGIG  I + +  LS  +++Y       + +++  +K               
Sbjct: 6   VSIVSGATRGIGSKIRDELL-LSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFK 64

Query: 43  ---ALKETYGDRFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHID 99
                 +T   +F    G I  ++    L+ G  K+Q ++D +V  AG+ +    +   +
Sbjct: 65  GWPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAI-KAN 123

Query: 100 IDAWKKLFDINFFSVVSLTSITLPYLKKT------NGNIVFVSS----DASDMHFSSWGA 149
            +    + ++NF S VSLT + L  + +        G IV ++S     +S++       
Sbjct: 124 TNEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNIIVPGTAM 183

Query: 150 YSASKACLNRFAMTVANE--EPAVKCLSVAPGIVDTS 184
           YSASKA + ++   ++ E    ++   +++PG+V+++
Sbjct: 184 YSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVEST 220

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 16/198 (8%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKET--YGDRFFYVTG-- 57
           GKV+ VTG +  I +   E +  L + A + G    E   KA  E    GD    V G  
Sbjct: 22  GKVVFVTGGAGTICRVQAEAMVLLGAKAAIIG-RNVEKTKKAAAEIAELGDSADCVLGIG 80

Query: 58  --DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVV 115
             D+ +   +++ V+      G+ID V+A A     + D+ ++   A+K + DI+     
Sbjct: 81  GVDVREVADMKRAVEQTVAAFGRIDYVIAGA-AGNFLADMTNLSSRAFKTVLDIDLVGSY 139

Query: 116 SLTSITLPYLKKTNGNIVFVSSDASDMHFSS---WGAYSASKACLNRFAMTVANE--EPA 170
           +    TL  L K  G ++FVS   + +H++        SA+KA ++  +  +A E     
Sbjct: 140 NTVKATLSELAKNKGAVLFVS---ATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLG 196

Query: 171 VKCLSVAPGIVDTSMQVN 188
           ++C  +APG++  +  V+
Sbjct: 197 IRCNCIAPGLIGGTEGVD 214

>Kwal_47.17102
          Length = 285

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 84/190 (44%), Gaps = 18/190 (9%)

Query: 4   VIIVTGVSRGIGKSIV-ERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQ 62
           V +VTG S G+G++IV E + KL +  ++      E P K+    Y     + T D+++ 
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLIS--LDIEPPKKSFPNVY-----HYTCDLSNS 86

Query: 63  VALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITL 122
             + + +    +  G +  ++ NAG+    Q+   +  +   K+F +N F+ + L     
Sbjct: 87  SDVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELS 146

Query: 123 P-------YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLS 175
           P       +   T  + + V + A     S +GA  A+    +       +E   ++ L 
Sbjct: 147 PKAGDLRQFYAVTVASALGVCAPARG---SCYGASKAAAIAFHEAWAQELDETSRIRTLL 203

Query: 176 VAPGIVDTSM 185
           V PG +DT+M
Sbjct: 204 VTPGQLDTTM 213

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 89/217 (41%), Gaps = 41/217 (18%)

Query: 3   KVIIVTGVSRGIGKSIVERI----FKL-----SSDAIVYGI-------------ARSEAP 40
           KV +VTG + GIG   V  +    FK+     +S  + + I              + E P
Sbjct: 20  KVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEKP 79

Query: 41  LKALKETYGDRFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDI 100
              L      +  Y+  D+TD  +++K       ++  +D ++ NAGV+    ++     
Sbjct: 80  HDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTK--- 136

Query: 101 DAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDM----------------HF 144
           D ++     N+ S   LT   LP +K   G ++ VSS   ++                 F
Sbjct: 137 DNFEIQMQTNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNPGAQFNYWPSMF 196

Query: 145 SSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIV 181
             W  Y+ +K    +F   +A + P + C+S+ PG+V
Sbjct: 197 FMWCRYALAKTASIQFTKMLAIKNPDILCMSLHPGLV 233

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 88/191 (46%), Gaps = 17/191 (8%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITD-- 61
           ++++TG S G+G+ I+ ++ +  ++  V  +      L     +   R   +  D+ +  
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNNIKVINLD-----LDVQYWSEEARVINIECDLVNAD 125

Query: 62  --QVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119
             ++AL+K+     + + KI+ ++ NAGV           ID  +++ +IN +S   +  
Sbjct: 126 GLELALKKI---KLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQ 182

Query: 120 ITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPA-----VKCL 174
             +P   +    IV +SS    +  S   +Y+ASKA +     ++ N+        ++ L
Sbjct: 183 AIIPRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTNDFLVRGIGNIRTL 242

Query: 175 SVAPGIVDTSM 185
            V PG +DT M
Sbjct: 243 LVLPGQIDTQM 253

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 99/236 (41%), Gaps = 17/236 (7%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKET----YGDRFFYVTG 57
           GKV+ VTG +  I +   E +  L   A + G  + E  +K   E     +G     V G
Sbjct: 83  GKVLFVTGGAGTICRVQTEAMVLLGCKAAIVGRDK-EKTIKVAGEISQLGHGTSVLPVYG 141

Query: 58  -DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+ D   L+  V     E G+ID V+A A     + D  ++  +A+K +  I+     +
Sbjct: 142 VDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSVVSIDLLGSFN 200

Query: 117 LTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEP--AVKCL 174
                 P LKK  G I+FVS+              A+KA ++  +  +A E     ++  
Sbjct: 201 TVKACFPQLKKNKGAIIFVSATFHYYGVPFQSHVGAAKAGIDALSNALAVELGVLGIRSN 260

Query: 175 SVAPGIVDTSMQV------NIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVY 224
            +APG +  +  +      N ++ V K +  +     +D+ E+   L S  PA  +
Sbjct: 261 CIAPGAIANTEGISRLLTGNKKDEVFKRIPLQRLGTTRDIAETTVFLFS--PAASF 314

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 16/92 (17%)

Query: 106 LFDINFFSVVSLTSITLPYLKKTNGN------------IVFVSS--DASDMHFSSWGAYS 151
           + ++NF S V++T+I + Y+ K+               IV +SS   +  M       YS
Sbjct: 140 IMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYS 199

Query: 152 ASKACLNRFAMTVANE-EPA-VKCLSVAPGIV 181
           ASKA L+RF   +A E EP  ++C +++PG+V
Sbjct: 200 ASKAALSRFTEVLAAEMEPRNIRCFTISPGLV 231

 Score = 34.7 bits (78), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 4  VIIVTGVSRGIGKSIVERIFKLSSDAIVYG 33
          V IVTG +RGIGK+I +++F+     I+ G
Sbjct: 6  VAIVTGATRGIGKAICQKLFQKGLSCIILG 35

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 5/137 (3%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGD-RFFYVTGDITD 61
           KV+I+TG   G+GKS      K  +  +V  I      +  +   YG+ R    T ++  
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEGRAIPDTHNVVT 383

Query: 62  QVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSIT 121
           +    ++++ A K  G++D +V NAG+L     +   D + W  +  ++ +S   L+   
Sbjct: 384 EA--NQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTDQE-WFAVVQVHLYSTFLLSKAV 440

Query: 122 LP-YLKKTNGNIVFVSS 137
            P +LK+  G+I+  +S
Sbjct: 441 WPIFLKQKGGHIINTTS 457

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 66  QKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITLPYL 125
           +++V+ A K  G+ID ++ NAG+L  V      + + +  + D++      LT    PY+
Sbjct: 81  EQIVETAIKAFGRIDILINNAGILRDVSFAKMTEKE-FSAVLDVHLTGAYRLTKAAWPYM 139

Query: 126 KKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCLSVAPGIVD 182
           ++   G I+  +S A          YSA+K  L  FA T+A E  +  +   S+AP +  
Sbjct: 140 RQQKFGRIINTASPAGLFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAP-LAR 198

Query: 183 TSMQVNI 189
           + M  N+
Sbjct: 199 SRMTENV 205

>Scas_478.2
          Length = 920

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 4/143 (2%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG-DRFFYVTGDIT 60
           GKV+I+TG + G+GKS      K  +  I+  I   E  +  +   +G D  F  + +I 
Sbjct: 325 GKVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNII 384

Query: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
            +  L  +V  A    G +D +V NAG+L     +   + + W  +  ++  +  ++   
Sbjct: 385 TESEL--VVKTAIDHFGHVDILVNNAGILRDKSFLKMTEKE-WYPVLQVHLQATFAMCKA 441

Query: 121 TLPYLKKTNGNIVFVSSDASDMH 143
             P+  K N   +  ++  S ++
Sbjct: 442 VWPHFSKQNSGFIINTTSTSGIY 464

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 77  GKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITLPYLKKTN-GNIVFV 135
           GKID ++ NAG+L  V   N +    ++ + D++      LT    PY+K    G I+  
Sbjct: 94  GKIDILINNAGILRDV-SFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKAQKFGRIINT 152

Query: 136 SSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCL--SVAPGIVDTSMQVNI 189
           +S A          YSA+K  L   A T+A E      L  S+AP +  + M  N+
Sbjct: 153 ASPAGLFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAP-LARSRMTENV 207

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 87/194 (44%), Gaps = 15/194 (7%)

Query: 6   IVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQVAL 65
           ++TG S G+G  + + + +  +  IV  I           +   +  FY   DIT    +
Sbjct: 42  LITGGSSGLGFELAKELSRRINKVIVADIQS----FPTFAQVEYNNIFYYQCDITSLDEI 97

Query: 66  QKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS-ITLPY 124
           + L     ++ G I+ ++ NAGV   ++ + H+     ++L DIN      + S      
Sbjct: 98  KNLKKAIERDHGNINIIINNAGVAH-IKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDM 156

Query: 125 LKKTNGNIVFVSSDASDMHFSSWGAYSASKA-------CLNRFAMTVANE--EPAVKCLS 175
           +    G I+ ++S   ++  +   +Y ASK        C++R   +++ E  +  +K L 
Sbjct: 157 IDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLL 216

Query: 176 VAPGIVDTSMQVNI 189
           V PG + T+M +++
Sbjct: 217 VCPGKIKTNMFIDV 230

>Kwal_26.7950
          Length = 897

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 5/138 (3%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITD 61
           GKV+I+TG   G+G+S      K  +  +V  I      +  +++ YG        D  D
Sbjct: 324 GKVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRN--SAVADKHD 381

Query: 62  QVA-LQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
            V    ++V  A +  G++D +V NAGVL   +    +  + W+ +  ++ FS   L   
Sbjct: 382 VVKDPGEIVKSAFQTFGRVDILVNNAGVLRD-RSFAKMSDEEWEIVLKVHLFSTFGLCKA 440

Query: 121 TLP-YLKKTNGNIVFVSS 137
             P ++K+ +G I+  +S
Sbjct: 441 VWPIFVKQKSGYIINTTS 458

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 74/177 (41%), Gaps = 15/177 (8%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARS-----------EAPLKALKETYGDR 51
           +V+++TG   G+GK       K  +  +V  +  S           +  +  ++E Y  +
Sbjct: 11  RVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKYKTQ 70

Query: 52  FFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINF 111
                  +T+  A   +V  A    G++D ++ NAG+L      N  D  A+  + D++ 
Sbjct: 71  AAANYDSVTENAA--AIVQTAVDNFGRVDIIINNAGILRDSSFANMSD-SAFASVVDVHL 127

Query: 112 FSVVSLTSITLPYLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
               +LT    P++K    G IV   S A          YSA+K  L  F+ T+A E
Sbjct: 128 TGAYNLTRAAWPHMKNQKFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETLAQE 184

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG------DRFFYVT 56
           K++IVTG   G+G+S      K  +  +V  I   E  +  + + YG      D+     
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGGGSAIPDKH---- 240

Query: 57  GDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+  Q    ++V  A +  G++D +V NAG+L     +   D + W  +  ++ FS   
Sbjct: 241 -DVVTQPT--EIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTYG 296

Query: 117 LTSITLP-YLKKTNGNIVFVSSDA 139
           L+    P +LK+ +G I+  +S +
Sbjct: 297 LSKAVWPVFLKQRSGYIINTTSTS 320

>Scas_613.18
          Length = 286

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 80/191 (41%), Gaps = 17/191 (8%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITD 61
           G V +VTG S G+G  IV+++       I+  I        A K        Y   D+  
Sbjct: 35  GSVALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNIQFGADKA-----LTYYKCDVGS 89

Query: 62  QVALQKLVDGAAKEQGKIDSVVANAGV--LEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119
           Q  ++K     +K+   I  ++ NAG+  L+P+ + +  +++   K+ ++N+     L  
Sbjct: 90  QEEIEKTYKRISKDHASIHILINNAGITCLKPITEFSKEEVN---KVINVNYLGACKLMH 146

Query: 120 ITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTV-----ANEEPAVKCL 174
           + L       G IV ++S    +  +   AY ASK  L  F  ++           +K L
Sbjct: 147 LWLS--ANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTNKIKML 204

Query: 175 SVAPGIVDTSM 185
            V  G + T M
Sbjct: 205 LVCTGKIRTKM 215

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 3/127 (2%)

Query: 58  DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSL 117
           D+ +   L+  V       G+ID V+A A     + D NH+  +A+K +  I+     + 
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 118 TSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEP--AVKCLS 175
              T+P L K+ G+I+FVS+              A+KA ++  +  +A E     V+   
Sbjct: 142 AKATMPELIKSRGSILFVSATFHYYGVPFQSHVGAAKAGIDALSNALAVEMGPFGVRSNC 201

Query: 176 VAPGIVD 182
           +APG + 
Sbjct: 202 IAPGAIQ 208

>Kwal_14.1511
          Length = 277

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 27/211 (12%)

Query: 1   MGKVIIVTGVSRGIGKSI----VERIFKLSSDAIVYGIARSEAPLKALKETYG--DRFFY 54
           M K I++TG ++GIGK+I      + ++L+   +     +++A LK +KE         +
Sbjct: 1   MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 55  VTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVL----------EPVQDVNHIDID--- 101
           +  D++++ ++  +VD  A   G  D ++ NAG+           E +  +  I++    
Sbjct: 61  LPIDVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVAKILEATPEELDRIMKINVGGVL 120

Query: 102 -----AWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKAC 156
                A +K  ++N     +  ++     KK  G I+   S A +    S G Y +SK  
Sbjct: 121 YGTQAATRKFVELNRAGDYTPATVKTAS-KKLTGKIINCCSIAGNEAIGSLGLYCSSKFA 179

Query: 157 LNRFAMTVANE-EP-AVKCLSVAPGIVDTSM 185
           +       A E  P  +   + APGIV T M
Sbjct: 180 VKCLTQASAKELAPLGITVNAYAPGIVLTPM 210

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 80/187 (42%), Gaps = 8/187 (4%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYG-----IARSEAPLKALKETYGDRFFYVT 56
           GKV+ VTG +  I +   E +  L   A++ G       ++   +  L           +
Sbjct: 22  GKVVFVTGGAGTICRVQTEAMVLLGCKAVIVGRNPEKTRKTAHEIGQLVHDPHSCLPISS 81

Query: 57  GDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVS 116
            D+ +   L + V  A ++ G++D V+A A     + D  H+  +A+K +  I+     +
Sbjct: 82  VDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGSFN 140

Query: 117 LTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCL 174
                 P L KT G+++FVSS              A+KA ++  +  +A E     ++  
Sbjct: 141 TVKACFPELVKTKGSVLFVSSTLHYYGVPFQSHVGAAKAGIDALSNALAVEMGPLGLRFN 200

Query: 175 SVAPGIV 181
            VAPG +
Sbjct: 201 CVAPGAI 207

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 79/194 (40%), Gaps = 19/194 (9%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPL-KALKETYGD----------- 50
           + ++V G S+G+GK    + F   +   V  ++RS A L  A+K+  G            
Sbjct: 12  QTLLVAGGSQGLGKQFACKYFAEGTANTVIVVSRSAAKLAAAVKDITGQDAQELTVDLEF 71

Query: 51  -----RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKK 105
                  FY+  D++D  A +K+ +   +       V+  AG   P +    +  D    
Sbjct: 72  DSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTP-KLFKDLTGDELVT 130

Query: 106 LFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVA 165
              +N+ + ++L  + L     +  +++F SS+ +   F  +  Y+  K  +    M + 
Sbjct: 131 GVQVNYMTCLNLAHV-LARKHSSLPHVIFFSSETAFFPFIGYSQYAPMKQSIKALVMILR 189

Query: 166 NEEPAVKCLSVAPG 179
            E P  +   V PG
Sbjct: 190 QEFPESRISCVYPG 203

>Kwal_14.2598
          Length = 311

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 84/197 (42%), Gaps = 25/197 (12%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLK--------------ALKETY 48
           +V+++ G S+G+GK+   + +   S+  V  ++RS   L+               L +T 
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSGLKTAPELLPDTE 68

Query: 49  ----GDRFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEP--VQDVNHIDIDA 102
               G+  +Y   D+ +   ++KL +       +   V+  AG   P   +D+   +++ 
Sbjct: 69  IPKNGNHIWYSPCDLAEYAQVEKLYESLKACSLEPTQVLLCAGGSTPGLFKDLQGPELEL 128

Query: 103 WKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAM 162
             +   +N+ + V+L  I + +   +  ++VF SS+ +   F  +  Y+  K  +     
Sbjct: 129 GVR---VNYMTCVNLAHIAVCHWPTS--HLVFFSSEVAFFPFIGYSQYAPLKQSIKSLVA 183

Query: 163 TVANEEPAVKCLSVAPG 179
            +  E P  +   V PG
Sbjct: 184 ILRQECPQQRISCVYPG 200

>Scas_652.19d1
          Length = 344

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 21/156 (13%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT-- 60
           K  +VTG + GIGK +VE +++ + + I  G+ R++A  +  K+          G+IT  
Sbjct: 42  KTAVVTGCNTGIGKHVVELLYQKNCNVI--GVVRTDAKGEEAKKEIIANNPKSKGNITII 99

Query: 61  ---DQVALQKL--VDGAAKE---QGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFF 112
              D + L+K+  V G  KE      ++ ++ NAG++ P  D     +  ++ +F  N  
Sbjct: 100 GGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAGLMAP--DNKGTSVQGYEAMFQTNVL 157

Query: 113 SVVSLTSITLPYLKKTN----GNIVFVSSDASDMHF 144
               L     P   K +      IV+VSS A   HF
Sbjct: 158 GSQLLQHFLDPLFLKEDDISLKRIVWVSSGA---HF 190

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)

Query: 66  QKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITLPYL 125
           +K+++ A KE G++D ++ NAG+L  V      + + +  + D++      L+    PY+
Sbjct: 81  EKIIETAIKEFGRVDVLINNAGILRDVSFAKMTERE-FASVVDVHLTGGYKLSRAAWPYM 139

Query: 126 KKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
           +    G I+  +S A          YSA+K  L   A T+A E
Sbjct: 140 RSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKE 182

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 88/217 (40%), Gaps = 42/217 (19%)

Query: 3   KVIIVTGVSRGIGKSIVERIF-----------------KLSSDAIVYGIARSEAPLKALK 45
           +V +VTG + GIG   V  ++                 +   D I   + R    LK L 
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLH 77

Query: 46  ETYGDRFF----YVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLE-PVQDVNHIDI 100
           +    R+     Y+  D+TD   + +      + +  +D +V NAGV+  P +    I  
Sbjct: 78  DQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVMAVPYE----ITK 133

Query: 101 DAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFS--------------- 145
           D ++     N+ +   LT   LP L+ ++G +V +SS    + F                
Sbjct: 134 DGFEIQMQTNYIAHFLLTMRLLPLLRCSHGRVVTLSSLGHHIIFKYSKLDETWNYFPNFV 193

Query: 146 -SWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIV 181
            +W  Y+ +K    ++   +A + P +  +SV PG+V
Sbjct: 194 FTWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>Kwal_55.21822
          Length = 283

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 92/210 (43%), Gaps = 17/210 (8%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAP--LKALKETYGDRFFYVTGDI 59
           GKV  VTG S GIG  +     +  +D  ++  +       +  + E YG +       +
Sbjct: 30  GKVAAVTGASSGIGYDVAVAFAQAGADVAMWYNSNPHITELVGEISEKYGVKVKAYKCSV 89

Query: 60  TDQVALQKLVDGAAKE-QGKIDSVVANAGVL---EPVQDVNHID---IDA-WKKLFDINF 111
           T    +   +D   K+  GKID +V NAGV     P+ D+   D    DA W K+ D++ 
Sbjct: 90  TSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKVIDVDL 149

Query: 112 FSVVSLTSITLPYLKKTNGNIVFVSSDASDMHF----SSWGAYSASKACLNRFAMTVANE 167
             +  +    +  + K  G+  F+ + +   H         AY+A+KA +   + ++A E
Sbjct: 150 NGIYRVAK-NIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSKSLAVE 208

Query: 168 EPA-VKCLSVAPGIVDTSMQVNIRENVGKD 196
                +  +V+PG + T +  N  E+  KD
Sbjct: 209 WAGFARVNTVSPGYIATEI-TNFAEDELKD 237

>Scas_721.47
          Length = 344

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 83/180 (46%), Gaps = 18/180 (10%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKE----TYGDRFFYVTG 57
           GK  +VTG S GIGK    ++     + ++  I+R+ + L+ALKE     YG +   +  
Sbjct: 62  GKYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEFEKKYGIKVEILAI 119

Query: 58  DI-TDQVALQKLVDGAAKEQGKIDSVVANAGVLE--PVQDVNHIDIDAWKKLFDINFFSV 114
           DI +D     + + G  K+   I  ++ N G     PV  +   + +  + +  IN  + 
Sbjct: 120 DISSDSQDNYEFIKGLCKDL-PITVLINNVGQSHSIPVPFL-ETEEEELRNIITINNTAT 177

Query: 115 VSLTSITLPYL-------KKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
           + +T I  P +       KK+ G I+ + S    +       YS SKA L +++ ++A E
Sbjct: 178 LLITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWSTSLAGE 237

>Kwal_26.8282
          Length = 298

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 98/240 (40%), Gaps = 53/240 (22%)

Query: 4   VIIVTGVSRGIGKSIVERI-------FKLSSDAIVYGIARSEAP--------LKALKETY 48
           V +VTG +RGIG++IV+++         + S    +   R   P         +AL    
Sbjct: 37  VALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRALAIDL 96

Query: 49  GDRFFYVTGDITDQVALQKLVDGAAKEQ-----------------GKIDSVVANAGVLE- 90
           G    +   D+   V      +G+  EQ                   I  +V  AG+ + 
Sbjct: 97  GKWPQWTEQDVYTGVHF----NGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQA 152

Query: 91  -PVQDVNHIDIDAWKKLFDINFFSVVSLTSITLPYLKKTNGN------IVFVSS---DAS 140
            P    +  DI    ++ +IN+ S V+L S++   + ++  +      I+ VSS   D  
Sbjct: 153 SPALRCSPEDI---LRITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPK 209

Query: 141 DMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCLSVAPGIV-DTSMQVNIRENVGKDM 197
                    YSASKA L +++  ++ E     ++  S++P +V DT M   + + V K +
Sbjct: 210 TPPLPGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDMIRTLEDTVKKRL 269

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 80/193 (41%), Gaps = 17/193 (8%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSD--AIVYGIARSEAPLKALKETYGDRFFYVTGDITD 61
           V ++TG S G+G  +V+ +     D   ++  +   +  L   K    DR  ++  D++ 
Sbjct: 85  VCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITK----DRIEFLRCDLSS 140

Query: 62  QVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSIT 121
              ++  +     +  K+D ++ NA +      +  +      K+F  N  S + L    
Sbjct: 141 DEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAF 200

Query: 122 LPYLKKTNGN----IVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE-----EPAVK 172
            P  KK+  N    +V ++S    M  +    Y+ASKA L  +  +   E        V+
Sbjct: 201 HP--KKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAMNVR 258

Query: 173 CLSVAPGIVDTSM 185
            L V PG +DT M
Sbjct: 259 TLLVLPGQMDTQM 271

>KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candida
           albicans putative sorbitol utilization protein (by
           homology), start by similarity
          Length = 292

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 94/202 (46%), Gaps = 26/202 (12%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKA--LKETYGDRFFYVTGDI 59
           GK+ ++TG +  IG ++ E      SD I+  + R+  P  +  L +TYG        DI
Sbjct: 39  GKLTVITGGAGAIGGALCEGFASCGSDVII--LDRTFQPELSVHLSKTYGIESKSYQVDI 96

Query: 60  TD----QVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDV--NHIDIDAWKKLFDINFFS 113
           T+    +   +++++        I++ +ANAG+      +  +    + W+++ D+N   
Sbjct: 97  TNADDVKFVFERILEDFPGR--AINTFIANAGIAWTNGSILNDGSTPEMWRRVMDVNVQG 154

Query: 114 VVSLTSITLPYLK-KTNGNIVFVSSDASDM----HFSSWGAYSASKACLNRFAMTVANE- 167
               +       K + +GN++  +S +S +    ++ +   Y+ASKA +   A   A E 
Sbjct: 155 TYHCSRYAAEVFKNQGHGNLILTASMSSYISNVPNYQT--CYNASKAAVRHMAKGFAVEF 212

Query: 168 ----EPA--VKCLSVAPGIVDT 183
                PA  ++C SV+PG  DT
Sbjct: 213 SGLTSPAGKIRCNSVSPGYTDT 234

>Kwal_27.12155
          Length = 280

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 12/146 (8%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPL----KALKETYGDRFFYVTG 57
           GKV  ++G S GIG ++ E   +  +D  V+    S   L    + L  TY  R      
Sbjct: 30  GKVACISGASSGIGAAVAEAFAQAGADLAVW--YNSHPALVETARDLANTYHVRVVAYKC 87

Query: 58  DITDQVALQKLVDGAAKEQGKIDSVVANAGVLE---PVQDVNHIDI--DAWKKLFDINFF 112
            + D+  +Q  +     E G+ID  VANAGV     P+ D     +    W ++   +F 
Sbjct: 88  PVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQTDFQ 147

Query: 113 SVVSLTS-ITLPYLKKTNGNIVFVSS 137
            V   +  +   + ++ +G++V  +S
Sbjct: 148 GVYYCSKYVGEVFQRQQHGSLVVTAS 173

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 57/111 (51%), Gaps = 7/111 (6%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQV 63
           ++++TG S+G+G++IV ++ +  S+  +  +    + ++        R   +  D++D  
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVR------NTRVKDLICDLSDDE 125

Query: 64  ALQKLVDGAAKE-QGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFS 113
            +  L++   ++ + +I  +V NAGV       N ++ D   K+F IN F+
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFA 176

>Scas_566.11
          Length = 346

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 60/154 (38%), Gaps = 25/154 (16%)

Query: 44  LKETYGD-RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANA--GVLEPVQDVNHIDI 100
           L +TY +  +F+V        A Q++ DG     G +  V++N    V  P   +  I +
Sbjct: 88  LNKTYKEIHYFFVN-------AAQRVYDGI-DWIGAVKEVISNPLEAVTNPTYKIQRIGV 139

Query: 101 ---DAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSW---------G 148
              D    +F  N F    L    LP LK  NG IV++SS  S   + S           
Sbjct: 140 KSKDGMGLVFQANVFGPYYLIQKLLPLLKAGNGTIVWISSVMSAPKYLSLQDIELLKTDA 199

Query: 149 AYSASKACLNRFAMTVANEEP--AVKCLSVAPGI 180
           +Y  SK  ++   +    E     +    V PGI
Sbjct: 200 SYEGSKRLVDLLHLATYEERKKLGIHQYVVQPGI 233

>Scas_675.10
          Length = 312

 Score = 33.9 bits (76), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 37/198 (18%), Positives = 82/198 (41%), Gaps = 25/198 (12%)

Query: 3   KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPL-KALKETYGD----------- 50
           +++++TG S+G+G+    + +   +++ +  ++RSE  L KA+    G            
Sbjct: 8   QIVLITGGSQGLGREFAHKYYHEGNNSKIIVVSRSEKKLIKAVDAISGKTVGTNLSPEET 67

Query: 51  -------RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEP--VQDVNHIDID 101
                  + +Y   D++D  A+  + D   + +     V   AG   P   +D+   ++D
Sbjct: 68  GKLNKNAKLYYYPCDLSDHEAVSTMFDRLCELEMLPTQVYCCAGGSIPKLFKDLTGEELD 127

Query: 102 AWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFA 161
              K+   N+ + + +    +  L+ +N +++  SS  +   F  +  Y+  K  L    
Sbjct: 128 MGIKM---NYSTTLHIAH-KVAQLELSNCHLILFSSVTAFFPFIGYSQYAPLKVSLKALV 183

Query: 162 MTVANEEPAVKCLSVAPG 179
             +  E    +   V PG
Sbjct: 184 GILRQEMLQNRISCVYPG 201

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
           (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 82/191 (42%), Gaps = 20/191 (10%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKET-----------YGD 50
           G+V++++G S+G+G++  ++  +  SD+ V  ++RSE  L    E               
Sbjct: 7   GQVVLISGGSQGLGRAFAQKYIE-ESDSTVVIVSRSEEKLTRAGEAICGGARRLGAGGAG 65

Query: 51  RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEP--VQDVNHIDIDAWKKLFD 108
           R  Y   ++ D  A+  L    A    ++  V+  AG   P    +++   + A     +
Sbjct: 66  RLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGAVPGLFAELSSAQLAA---GVE 122

Query: 109 INFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEE 168
           +N+ + + L    + +  +   ++VF SS A+   F  +  Y+  KA L      +  E 
Sbjct: 123 MNYGTALHLAHGAVRHGAR---HLVFFSSAAAVYPFIGYSQYAPLKAALRALVAVLRQEC 179

Query: 169 PAVKCLSVAPG 179
             V+   V PG
Sbjct: 180 DGVRVSCVYPG 190

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 67/164 (40%), Gaps = 3/164 (1%)

Query: 6   IVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGD-RFFYVTGDITDQVA 64
           ++TG S G+G  IV++   L+    +  I      +    E   +   FY   DI++   
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPCDISNPKE 146

Query: 65  LQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITLP- 123
           + +L      + G +  ++ NAG+    + +  +     +K   +N+ S        LP 
Sbjct: 147 IAELHKKIKLQHGNVTILINNAGITSGYR-LQELSDKVIEKTIQVNYVSAFYTIQEFLPD 205

Query: 124 YLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
            +  + G IV V+S    M  +   AY ASK  L      + NE
Sbjct: 206 MVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNE 249

>Kwal_23.4572
          Length = 300

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 7/129 (5%)

Query: 58  DITDQVALQKLVDGAAKEQGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFDINFFSVV 115
           D+ +   L++ V    +  G+ID V+A A    + P    + +  +A+K +  I+     
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAPF---SKLSANAFKSVVSIDLLGSF 149

Query: 116 SLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKC 173
           +     L  L++T G+I+FVS+              A+KA ++  +  +A E     V+ 
Sbjct: 150 NTAKACLAELQRTKGSILFVSATFHYYGVPYQSHVGAAKAGVDALSNALAVELGVSGVRS 209

Query: 174 LSVAPGIVD 182
             +APG ++
Sbjct: 210 NCIAPGAIE 218

>CAGL0J11264g complement(1094218..1095447) highly similar to
           sp|P53878 Saccharomyces cerevisiae YNL181w, start by
           similarity
          Length = 409

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 17/140 (12%)

Query: 2   GKVIIVTG-VSRGIGKSIVERIFKLSSDAIVYGIARSEAP---LKALKE-TYGDRFFYVT 56
           GKV IVTG  S+G+G S+V  + +L +  I+      E      + L+E T  +  F   
Sbjct: 53  GKVYIVTGATSQGMGTSVVLEMARLGAQLIILCRDVDEWTTDWCEDLRERTQNELIFVEQ 112

Query: 57  GDITDQVALQKL----VDGAAKEQGKIDSVVANAGVLEPV------QDVNHIDIDAWKKL 106
            D++D   ++K     +D +     ++D VVA +G +EP       + +     D  +  
Sbjct: 113 CDLSDLYEVRKFATTWLDNSPPR--RLDGVVALSGDMEPWGIPMLSRPIRRSSKDGLEIQ 170

Query: 107 FDINFFSVVSLTSITLPYLK 126
             +NF  +  L  I  P  K
Sbjct: 171 MAVNFVGLFHLLDILQPSFK 190

>Scas_641.31
          Length = 287

 Score = 32.0 bits (71), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 3/39 (7%)

Query: 150 YSASKACLNRFAMTVANEEP--AVKCLSVAPGIV-DTSM 185
           YSASKA L ++  T++ E     ++ LS+APG+V DT M
Sbjct: 211 YSASKAALIQYTRTLSQETETWGIRALSMAPGLVTDTDM 249

>ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH]
           (527756..528571) [816 bp, 271 aa]
          Length = 271

 Score = 31.2 bits (69), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 12/93 (12%)

Query: 105 KLFDINFFSVVSLTSITL-PYLK-----KTNGNIVFVSSDASDMHFSS---WGAYSASKA 155
           +L  +N  S+VSL  +++ P L+          IV V+S     H         Y+ASK+
Sbjct: 135 RLLHVNLGSLVSLCQLSVRPMLRARRVAHARPTIVNVASVLGCAHAQPPPGTAVYAASKS 194

Query: 156 CLNRFAMTVANE--EPAVKCLSVAPGIV-DTSM 185
            + +++  +A E     + C +VAPG+V DT M
Sbjct: 195 AVIQYSRALAAELERTGIACHAVAPGLVPDTDM 227

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 31.2 bits (69), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/105 (19%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 51  RFFYVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDIN 110
           R  ++  D++    ++++++   +E  ++D ++  AG+    Q +  +  +   K F +N
Sbjct: 114 RVRFLRADLSKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVN 173

Query: 111 FFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKA 155
            F+         P        +V V S    +  +   AY+A+KA
Sbjct: 174 VFAPQRFIQKLAPR-DDRQFYLVTVGSTLGILAPARLSAYAATKA 217

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 74/165 (44%), Gaps = 8/165 (4%)

Query: 4   VIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDITDQV 63
           + +VTG + G+GK IV  + +     ++  +     P   L+   G  F+    DI+   
Sbjct: 62  IALVTGGAGGLGKEIVRELRRRQIVTVILDV----VPPPDLESLTGVHFY--ACDISLPG 115

Query: 64  ALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSITLP 123
            ++ + +   ++ G +  ++ NA +   +  ++ +D D  +++  +N     +L    LP
Sbjct: 116 RIRVIHENIIRDVGHVTILINNAAITSDLP-LDRVDNDKIEQIIRVNLLGPYTLIREFLP 174

Query: 124 YLKKTN-GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
            +   + G IV ++S    +  +   AY ASK  L     ++ +E
Sbjct: 175 SMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDE 219

>Kwal_23.3107
          Length = 248

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 83/191 (43%), Gaps = 14/191 (7%)

Query: 2   GKVIIVTGVSRGIGK-SIVERIFKLSSDAIVY--GIARSEAPLK-ALKETYGDRFFYVTG 57
           GKV ++TG ++ +G+ + +E   +  ++  ++       E  L   L   Y  +     G
Sbjct: 5   GKVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELYQG 64

Query: 58  DITDQVALQKLVDGAAKEQGKIDSVVANAG--VLEPVQDVNHIDIDAWKKLFD-INFFSV 114
           ++     ++KL + A  + G ID  + N G  + +P+ +V   + D    + + I FF +
Sbjct: 65  NLGSAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMVEVTEEEFDEMDLVNNKIAFFFI 124

Query: 115 VSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVK 172
              T         + G+I+ + +     +   +  Y  +K+ +  +  + + E  E  V 
Sbjct: 125 AQATKHV-----SSGGSIISLVTSLLAAYTPFYAVYQGTKSAVEFYTKSASKELIEKRVS 179

Query: 173 CLSVAPGIVDT 183
              +APG +DT
Sbjct: 180 VNCIAPGPMDT 190

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 73/180 (40%), Gaps = 19/180 (10%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRF--------F 53
           G   +VTG S GIGK   +++ K   + I+  I+R+E+ L  LK+               
Sbjct: 65  GAYAVVTGASDGIGKEYAKQLAKRGFNLIL--ISRTESKLVELKKEIETECKIDVKILAI 122

Query: 54  YVTGDITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFS 113
            V+ D  +   L + V         I++V  +  +  P       ++   + +  IN  +
Sbjct: 123 DVSSDSKENYTLIREVASGLPVTVLINNVGKSHSIPVPFDQTEESEL---RDIITINNTA 179

Query: 114 VVSLTSITLPYLK------KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE 167
            + +T   LP LK      K  G I+ + S    +       YS SKA L  ++  +A E
Sbjct: 180 TLMITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAGE 239

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
          reductase, catalyzes the second step in the synthesis
          of phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 26/39 (66%)

Query: 3  KVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPL 41
          +V+++TG S+G+GK   ++ +  + +  +  ++RSEA L
Sbjct: 8  QVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARL 46

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 57  GDITDQVAL-QKLVDGAAK-EQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSV 114
           G +T Q+ L + ++ G ++ E  K+ + + ++  LE     ++I+ D +K LF  NF  +
Sbjct: 112 GAVTTQLNLDEPILRGPSRGEPAKLQNDLISSPPLE----ESYINNDQYKALFPSNFLPI 167

Query: 115 VSLTSITLPYLKKT 128
             ++S+  P  KK+
Sbjct: 168 TPVSSVITPASKKS 181

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYV 55
           GK   +TG S GIGK    ++ K   + ++  I+R+++ L+AL++   D+   V
Sbjct: 62  GKYCAITGASDGIGKEFARQMAKRGFNLVL--ISRTQSKLEALQKELEDQHHVV 113

>Scas_693.23*
          Length = 370

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 92  VQDVNHIDIDAWKKLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSS 146
           +Q+V     D    +F +N F+   L  + LP LK     I+++SS  SD  + S
Sbjct: 121 LQEVGLKSKDGMGLIFQVNVFAPHFLIMLLLPQLKAGKAKIIWISSLRSDQKYLS 175

>Scas_655.19
          Length = 297

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 85/204 (41%), Gaps = 35/204 (17%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETY-----------GD 50
           GKV+ VTG +  I +  VE +  L   A + G    +  + A KE              D
Sbjct: 22  GKVVFVTGGAGTICRVQVEAMVLLGCKAAILG-REEKKTIDAAKEIESLVRSPTENDDAD 80

Query: 51  RFFYVTGDIT----DQV--ALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWK 104
                 G+I     DQ+  A++K VD      G ID ++A A     + D  ++  +A+K
Sbjct: 81  PIVLPLGNIDVRNFDQLKNAVKKTVD----TFGHIDYLIAGAAG-NFICDFMNLSPNAFK 135

Query: 105 KLFDINFFSVVSLTSITLPYLKKTNGNIVFVSSDASDMHFSSWGA-----YSASKACLNR 159
            + DI+     +        L K  G+++FVS+      F  +G        A+KA ++ 
Sbjct: 136 SVIDIDLLGSFNTVKACASQLIKNKGSVLFVSAT-----FHYYGVPFQLHVGAAKAGIDA 190

Query: 160 FAMTVANE--EPAVKCLSVAPGIV 181
            +  +A E     V+   +APG +
Sbjct: 191 LSNNLAVELGPLGVRSNCIAPGAI 214

>CAGL0J05852g complement(554403..555434) weakly similar to
          sp|P40580 Saccharomyces cerevisiae YIR036, hypothetical
          start
          Length = 343

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 2  GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEA 39
          GK  +VTG + G+GK   + +++ + + I  G+ R+E+
Sbjct: 41 GKTAVVTGCNTGVGKEAAKLLYQKNCNVI--GVCRTES 76

>ABL127W [465] [Homologous to ScYMR277W (FCP1) - SH]
           complement(156800..158986) [2187 bp, 728 aa]
          Length = 728

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 161 AMTVANEEPAVKCLSVAPGIVDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVP 220
           A+ + + +   +CL     + ++  ++ + E VG++         +DL E+ K +D    
Sbjct: 550 AIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLEN---FKRDLAEAQKKVDPPAQ 606

Query: 221 ATVYSKLALNGIPVDVNGKYLSFDDPILKEF 251
            +  S L L+G     NG +L +DD  + EF
Sbjct: 607 DSRSSLLLLDG-----NGSWLDYDDDEMDEF 632

>Kwal_26.7565
          Length = 704

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 49/123 (39%), Gaps = 19/123 (15%)

Query: 31  VYGIARSEAPLKALKETYGDRFFYVTGDIT-----------------DQVALQKLVDGAA 73
           +Y    S  PL  L +T+  +F     + T                 D +  Q+++D  A
Sbjct: 197 IYEADESAVPLPKLIQTHVSQFLLALNECTEWARIIILGALAEYTAKDAIEAQEIIDRVA 256

Query: 74  KEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI--TLPYLKKTNGN 131
                +++ V  A +   + ++ HI ++A   +F     ++VSL S    + Y+   N  
Sbjct: 257 PHLQHVNAAVVLASIKVVITNLPHIQVNAESAIFSKLSSALVSLMSTPPEMQYVALRNIR 316

Query: 132 IVF 134
           IV 
Sbjct: 317 IVL 319

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 28.1 bits (61), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 2   GKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRF 52
           G   +VTG S GIGK    ++     + ++  I+R+E+ L ALK+    +F
Sbjct: 62  GDYAVVTGASDGIGKEFASQLASKGFNLVL--ISRTESKLVALKDELEGKF 110

>YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein with
            role in endocytosis, has similarity to cytoskeletal
            proteins Uso1p and Pan1p and to mouse tyrosine kinase
            substrate eps15 [4146 bp, 1381 aa]
          Length = 1381

 Score = 28.1 bits (61), Expect = 8.4,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 83/178 (46%), Gaps = 28/178 (15%)

Query: 61   DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120
            +Q A+++  D  A  + + ++V ANAG +E  + ++H D+D       +N F+  +LTS 
Sbjct: 1210 EQAAVEE--DNGADSESEFENV-ANAGSMEQFETIDHKDLD---DELQMNAFT-GTLTSS 1262

Query: 121  TLPYLKK------TNGNIVFVSSDASDMHFSSWGAYSA-----SKACLNRFAMTVANEEP 169
            + P + K      +  +   VS+D  D  F+ +G   A     +   + +  + + N+  
Sbjct: 1263 SNPTIPKPQVQQQSTSDPAQVSNDEWDEIFAGFGNSKAEPTKVATPSIPQQPIPLKNDPI 1322

Query: 170  AVKCLSVAP----GIVDTSMQVNIRENVGKDMTSED--HAMFK---DLK-ESNKLLDS 217
                LS  P    G+  T   + + E  G   T E+  +A+ K   DL+  +N LLDS
Sbjct: 1323 VDASLSKGPIVNRGVATTPKSLAVEELSGMGFTEEEAHNALEKCNWDLEAATNFLLDS 1380

>CAGL0K03531g complement(328279..328656) similar to sp|Q99278
           Saccharomyces cerevisiae YMR112c, hypothetical start
          Length = 125

 Score = 26.9 bits (58), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 9/66 (13%)

Query: 185 MQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLSFD 244
           M+   +E+V    ++ D+A  K LK+  +LLD NV   +        +P++VN K L  D
Sbjct: 50  MKPQFQEHVSAFYSTLDNASGK-LKKEIELLDENVGNRL--------LPINVNKKALGQD 100

Query: 245 DPILKE 250
           D  LKE
Sbjct: 101 DDKLKE 106

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,881,639
Number of extensions: 330885
Number of successful extensions: 1242
Number of sequences better than 10.0: 103
Number of HSP's gapped: 1152
Number of HSP's successfully gapped: 111
Length of query: 252
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 153
Effective length of database: 13,168,927
Effective search space: 2014845831
Effective search space used: 2014845831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)