Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.764564531770.0
Sklu_2380.362265517920.0
ACR172W61267116610.0
Kwal_14.86362866316490.0
KLLA0E08085g65664914930.0
CAGL0L09889g71773214580.0
YKL025C (PAN3)67947013521e-179
Scas_713.7983112770.37
AEL063W131481760.47
ADR313W57858711.6
Sklu_2439.2234483701.9
KLLA0E17127g852118702.4
YHR082C (KSP1)102952693.0
Kwal_55.2018981299693.6
YLR087C (CSF1)295829667.5
ADR369C827121658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.7
         (645 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.7                                                           1228   0.0  
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        694   0.0  
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   644   0.0  
Kwal_14.863                                                           639   0.0  
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   579   0.0  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   566   0.0  
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...   525   e-179
Scas_713.7                                                             34   0.37 
AEL063W [2443] [Homologous to ScYJR033C (RAV1) - SH] complement(...    34   0.47 
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    32   1.6  
Sklu_2439.22 YJR142W, Contig c2439 36303-37337 reverse complement      32   1.9  
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    32   2.4  
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    31   3.0  
Kwal_55.20189                                                          31   3.6  
YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein r...    30   7.5  
ADR369C [2110] [Homologous to ScYOR346W (REV1) - SH] (1362312..1...    30   8.8  

>Scas_685.7
          Length = 645

 Score = 1228 bits (3177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/645 (93%), Positives = 603/645 (93%)

Query: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEXXXXXXXXXXXXXX 60
           MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQE              
Sbjct: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEPVPVQQSPVAPVPS 60

Query: 61  FSRKFNPKSSASFTPMSSKTPELAAVXXXXXXXXXXXXXXXXXXXKPMNSPLASQSSNAS 120
           FSRKFNPKSSASFTPMSSKTPELAAV                   KPMNSPLASQSSNAS
Sbjct: 61  FSRKFNPKSSASFTPMSSKTPELAAVSSFERSSNPSSPAPPASIPKPMNSPLASQSSNAS 120

Query: 121 FPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLANDPNLPSANVPLQF 180
           FPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLANDPNLPSANVPLQF
Sbjct: 121 FPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLANDPNLPSANVPLQF 180

Query: 181 SSSPASNIHQQMLXXXXXXXXXSRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTP 240
           SSSPASNIHQQML         SRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTP
Sbjct: 181 SSSPASNIHQQMLNENNINNNNSRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTP 240

Query: 241 ETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKN 300
           ETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKN
Sbjct: 241 ETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKN 300

Query: 301 SLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDS 360
           SLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDS
Sbjct: 301 SLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDS 360

Query: 361 SLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWD 420
           SLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWD
Sbjct: 361 SLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWD 420

Query: 421 KIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLLFKLASKIGNNANAKI 480
           KIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLLFKLASKIGNNANAKI
Sbjct: 421 KIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLLFKLASKIGNNANAKI 480

Query: 481 DELSVDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQGYAEYTEGILSRELE 540
           DELSVDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQGYAEYTEGILSRELE
Sbjct: 481 DELSVDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQGYAEYTEGILSRELE 540

Query: 541 NGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMDLTHVL 600
           NGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMDLTHVL
Sbjct: 541 NGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMDLTHVL 600

Query: 601 RCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645
           RCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ
Sbjct: 601 RCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/655 (53%), Positives = 435/655 (66%), Gaps = 43/655 (6%)

Query: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEXXXXXXXXXXXXXX 60
           MDK N EWAKDIPC+N+TI+G+CK   DGC F H  +                       
Sbjct: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTG---------VNTPTGIMN 51

Query: 61  FSRKFNPKSSASFTPMSSKTPELAAVXXXXXXXXXXXXXXXXXXXKPMNSPLASQSSNAS 120
            + KFN K+++SFTP    + +   V                     +NSP  +     +
Sbjct: 52  SASKFNAKTASSFTPSKITSSDFNGVSGFTSDKSATVTTAPVAASV-VNSPTFA----TN 106

Query: 121 FPPQPFYSYPASSSNGTL---LNNTILPDGI------SLHDPAFPLTQIDKTMLANDPNL 171
           F P    S+  S S G      N    P GI      + H    P+T   +       +L
Sbjct: 107 FNPYVADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSL 166

Query: 172 PSANVPLQFSSSPASNIHQQMLXXXXXXXXXSRYPSIYPPPHSILQYHLYAPDPPPQLRL 231
            SA  P+  S   A+                  +P+IYPPPHSILQYHLYAPDPPP L++
Sbjct: 167 TSAG-PIASSRVSATQ----------------NFPTIYPPPHSILQYHLYAPDPPPHLKV 209

Query: 232 PLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVT 291
           PLKPNERTPETLFIPNDLRE+LVKKN ++LQ+FPSGG++P+IV DYFGLVPL+FH +   
Sbjct: 210 PLKPNERTPETLFIPNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASY 269

Query: 292 KDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDL 351
           K RY GH+NSLYKVFSN DGK+YI+RRIHDV I +  Q+++PFQ W  + C  +VK++D 
Sbjct: 270 KQRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDA 329

Query: 352 FLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKG 411
           F+T  F DSSLC+V++++PQ++SLYE HF NF L PITQDYLW YLVQLTNA+  VHS+ 
Sbjct: 330 FITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQN 389

Query: 412 FYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLLFKLASK 471
             I ++ WDK+IVTG+PGRIK+S CG  D+L + E  D+  +QQ DFE LG+LL  L +K
Sbjct: 390 LSINILGWDKVIVTGEPGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTK 449

Query: 472 IGNNANAKIDELSVDDQFKTVLQY-LLNDTNDRKTINELSQLFIDKILSNVESSQGYAEY 530
           I ++ +    +L VD  FK VL Y LLND   +K + EL+ LF D+ILS V S Q + E 
Sbjct: 450 IASSKDTSTQDLKVDSDFKIVLDYLLLND--HKKNVRELASLFTDRILSVVSSLQTHVEC 507

Query: 531 TEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETG 590
           TE  LSRELENGRLFRL+CKLNFIFG+ ESRVDINWSESGEKFPIILFYD+VFHQVDE G
Sbjct: 508 TEAYLSRELENGRLFRLMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAG 567

Query: 591 KSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645
           KS+MDLTHVLRCLNKLDAG  EK++L TPDEMNCIIISYKELKDLID+TFRSMTQ
Sbjct: 568 KSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/671 (50%), Positives = 417/671 (62%), Gaps = 87/671 (12%)

Query: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKH-------SETDEPAAEIQEXXXXXXX 53
           M+K   +WAKD PC+N+TIYGYCK   DGC F H       S T   AA   E       
Sbjct: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAEDSAASGG 62

Query: 54  XXXXXXXFSRKFNPKSSASFTPMSSKTPELAAVXXXXXXXXXXXXXXXXXXXKPMNSPLA 113
                   S  FN K++ SFTP S   P+   +                           
Sbjct: 63  VTVGNTGKS-TFNAKTATSFTP-SVAIPDFNNI--------------------------- 93

Query: 114 SQSSNASFPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLANDPNLPS 173
                 SF P+   S PA              DG +   P+F           +D   PS
Sbjct: 94  -----PSFTPERIVSSPAG-------------DGATAFTPSF-------NPYGSDSFNPS 128

Query: 174 ANVPLQFSSSPASNIHQQMLXXXXXXXXX-------------------SRYPSIYPPPHS 214
           ANV     S P S +                                 + +P++YPP HS
Sbjct: 129 ANV-----SGPGSAVFAAASGNAGASATAAPRSQSVHVGTGGYLPLAGTAFPTVYPPSHS 183

Query: 215 ILQYHLYAPDPPPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIV 274
           ILQYHLYAPDPPP L++PLK NERTPETLFIPN+LRE L+K+NL++LQ+FPS G +PDIV
Sbjct: 184 ILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLPDIV 243

Query: 275 QDYFGLVPLDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPF 334
            DYFGLVPL+FH ++  K RY GH+NSLYKVFSN DGKVYI+RRIHDV+  D  QI+ PF
Sbjct: 244 GDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQISLPF 303

Query: 335 QKWNNLECNQIVKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLW 394
           +KW  + C  +VK++D F T  FGDSSLC+V+D+YPQ+NSLYE H  N+ +VP+TQ YLW
Sbjct: 304 RKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQKYLW 363

Query: 395 TYLVQLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQ 454
           +YLVQL+NA+N VH  G  +  I  DK+IVTGDPGRIK+      D+L  +E  D+  +Q
Sbjct: 364 SYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAFDEGRDIAKEQ 423

Query: 455 QMDFENLGQLLFKLASKIGNNANAKIDELSVDDQFKTVLQYLLNDTNDRKTINELSQLFI 514
           Q D+  +G LL  LA ++    +  +D + +D  FK VL YLL+D  ++KTI E + LF 
Sbjct: 424 QADYSAVGALLMDLAQRMLGTRDQPLDSMDIDPLFKRVLAYLLSD--EKKTIAEFTALFS 481

Query: 515 DKILSNVESSQGYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFP 574
            K+L  + SSQ Y+EY E  LSRELENGRLFRL+CKLNFIFG++ES +DI+WSE+G+KFP
Sbjct: 482 HKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFP 541

Query: 575 IILFYDFVFHQVDETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKD 634
           IILFYD+VFHQVDE GKSVMDLTHVLRCLNKLD G  EK+IL TPDEMNCIIISYKELKD
Sbjct: 542 IILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELKD 601

Query: 635 LIDTTFRSMTQ 645
            ID+TFRSMTQ
Sbjct: 602 SIDSTFRSMTQ 612

>Kwal_14.863
          Length = 628

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/663 (50%), Positives = 429/663 (64%), Gaps = 67/663 (10%)

Query: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEXXXXXXXXXXXXXX 60
           MDK NAEWAKDIPC+N+TIYG+CK   +GC F H   ++                     
Sbjct: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQ-----------------NTNS 57

Query: 61  FSRKFNPKSSASFTP---MSSKTPELAAVXXXXXXXXXXXXXXXXXXXKPM---NSPLAS 114
              KFN K+++SFTP   +S+K     A+                    P+   ++P  S
Sbjct: 58  AGLKFNAKTASSFTPSKALSTKNSTSTAIKAEKVAKALASAAEQPSTSSPLAAKSAPFGS 117

Query: 115 Q------------SSNASFPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDK 162
                        S+  S PP      PA++S  T  N    P G++    A PL Q   
Sbjct: 118 SYNPYAANFTPVGSAGTSTPP------PAAASR-TSFNPYSAPAGMTTPGEA-PL-QPGA 168

Query: 163 TMLANDPNLPSANVPLQFSSSPASNIHQQMLXXXXXXXXXSRYPSIYPPPHSILQYHLYA 222
           + +   P   + + P ++++                      +PSIYPP HSILQYHLYA
Sbjct: 169 SFIPGSPAPYAQDAPGRYTN----------------------FPSIYPPSHSILQYHLYA 206

Query: 223 PDPPPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVP 282
           PDPP  L++PLK NERTPETLFIPN++RE+L+KKN A+LQ+FPSGG +P+IV DYFGLVP
Sbjct: 207 PDPPLHLKVPLKANERTPETLFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVP 266

Query: 283 LDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLEC 342
           L+FH +   KDRYQGH+NSLYKVFSN DGKVYI+RRIHDV++ +  Q+ KPFQ W  +  
Sbjct: 267 LEFHNRVSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVN 326

Query: 343 NQIVKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTN 402
           + +V+ +D F+T  F D+SLC+V++++PQ++SLYE HF +F   PITQD LW+YLVQL +
Sbjct: 327 SNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCS 386

Query: 403 AINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLG 462
           AI   H++      I  DK+IVTG+PGR+K+      D+L   +E D+  +Q+ DF +LG
Sbjct: 387 AIQAAHTRNLAFNNICLDKVIVTGNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFADLG 446

Query: 463 QLLFKLASKIGNNANAKIDELSVDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVE 522
            LL  LA+K+  + +  +D L+VDD FK VL YLL D    KT+ EL  LF  KIL  + 
Sbjct: 447 GLLKDLAAKLVGSQDNTVDSLAVDDDFKQVLNYLL-DPKSLKTLPELMALFSHKILPIIS 505

Query: 523 SSQGYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFV 582
           S Q + EYTE IL+RELEN RLFRL+CK+NFIFG+IESR+DINWSESGEKFPIILFYD+V
Sbjct: 506 SLQTFTEYTESILARELENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYV 565

Query: 583 FHQVDETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRS 642
           FHQ DETGK VMDLTHVLRCLNKLDAG  EKL+L TPDEMNCIIISYKELKDLID+TFR+
Sbjct: 566 FHQADETGKPVMDLTHVLRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELKDLIDSTFRA 625

Query: 643 MTQ 645
           + Q
Sbjct: 626 LAQ 628

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/649 (47%), Positives = 417/649 (64%), Gaps = 22/649 (3%)

Query: 10  KDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEXXXXXXXXXXXXXXFSRKFNPKS 69
           K   CRN+ I+GYCK   +GC F H  + E   +  +               + KFN K+
Sbjct: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTP----LNVKFNAKT 72

Query: 70  SASFTPMSS---KTPE---LAAVXXXXXXXXXXXXXXXXXXXKPMNSPLASQSSNA---S 120
           S+SFTP  S   ++P+   L A                      M+  L + ++ A   S
Sbjct: 73  SSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPS 132

Query: 121 FPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLANDPNLPSANVPLQF 180
           F P    S+  S S G + ++  L   +   +P+ P + +      N   LPS    +  
Sbjct: 133 FNPYASESFTPSVSAGGIPSSQELAGTLHGSNPSIP-SPVPSNPYVNSAGLPSGG--MLG 189

Query: 181 SSSPASNIHQQMLXXXXXXXXXSRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTP 240
              P   +              +++P++YPP HS+LQYHLYAPDPPP L++PLKPNERTP
Sbjct: 190 VGHPMQGLPPPPPPGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTP 249

Query: 241 ETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKN 300
           ETLFI N LR++LVK N  +LQ+FP G ++PDIV DYFGLVP+DFH +   K RY GHKN
Sbjct: 250 ETLFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHKN 308

Query: 301 SLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDS 360
           SLYKVFSNLDGK+Y +RRIHDV+I D  Q++KPFQ W++L    I  L+D F+T+ F DS
Sbjct: 309 SLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDS 368

Query: 361 SLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWD 420
           SLC+V+D+YPQ+ SLYE +     +  + Q+YLW +LVQLT A+  VHS G  +  +DW 
Sbjct: 369 SLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWK 428

Query: 421 KIIVTGDPGRIKLSGCGAIDVLGANEELD-LHSKQQMDFENLGQLLFKLASKIGNNANAK 479
           K+IVTG+PGRIK++  G  D L  ++E   LH++QQ ++ +L +LL  L  ++   A+  
Sbjct: 429 KVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYLSLAELLLNLVQRLCG-ASGP 487

Query: 480 IDELS---VDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQGYAEYTEGILS 536
           +D++    +D  FK  +QYL + +N+ K I + ++LF  K+LS V S Q  +EY E  LS
Sbjct: 488 LDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLS 547

Query: 537 RELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMDL 596
           RELEN RLFRL+CKLN I+G++ESR+DINW+ESGEKFPIILF+D+VFHQ D+TGK+VMDL
Sbjct: 548 RELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMDL 607

Query: 597 THVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645
           THVLRCLNKLDAG  E+L+L TPDEMNCIIISYKELKDLID+TFR++TQ
Sbjct: 608 THVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDLIDSTFRALTQ 656

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/732 (43%), Positives = 428/732 (58%), Gaps = 104/732 (14%)

Query: 1   MDKINAEWAKDIPCRNVTIYGYCK----------------------KIKDGCPFKHSETD 38
           MDKIN +WA+D+PCRNV IYG+CK                      K+ D  P       
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60

Query: 39  EPA--------------AEIQEXXXXXXXXXXXXXXFSRKFNPKSSASFTPM---SSKTP 81
           +P+              +                     KFN K+SASFTPM   +  T 
Sbjct: 61  QPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKASASFTPMSKAADGTQ 120

Query: 82  ELAAVXXXXXXXXXXXXXXXXXXXKPMNSPLASQSSNASF-PPQPFYSYPASSSNGTLLN 140
           E  A                         P+    +  SF  P  + + P  S     + 
Sbjct: 121 ETQAPYLESPVAGSP-------------GPILKAGTPVSFMQPNIYSTTPVPSPASMAMP 167

Query: 141 NTILPDGISLHDPAFPLTQ------IDKTMLAN---DPN--LPSANVPLQFSSSPASNIH 189
           N ++P    +  P   L Q      +D ++  N    PN  +  +++PL   +S +  + 
Sbjct: 168 NVVMPPN-DMGSPDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPML 226

Query: 190 QQMLXXXXXXXXXS------------------------RYPSIYPPPHSILQYHLYAPDP 225
            Q +         S                        RYP+IYPP HSILQYHLYAPDP
Sbjct: 227 DQQIHSISGLSNTSGPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSILQYHLYAPDP 286

Query: 226 PPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDF 285
           PPQL + LK NERTP  LFIPNDLRE+LVK+NLASLQ+FPSGG +P IV+DYFGLVPLDF
Sbjct: 287 PPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDF 346

Query: 286 HQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQI 345
           HQ+   KDRY+ HKNSLYKVFSN+DG++Y+LRRIHDV I DP  I+K FQKW+ ++ + +
Sbjct: 347 HQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNV 406

Query: 346 VKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAIN 405
           V L+DLFLTT FGDSSL +VYD+YP A SLYE HF N+P V +T+D LW+Y VQ+ N + 
Sbjct: 407 VALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLR 466

Query: 406 VVH-SKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLG------ANEELDLHSKQQMDF 458
            +H + G  IG +D DKII+TG  GRIK+S     D++         ++ +    ++ +F
Sbjct: 467 EIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMNMCCPEDNEDDDNEEKLRKRNF 525

Query: 459 ENLGQLLFKLASKIGNNANAKIDELS-VDDQFKTVLQYL----LNDTNDRKTINELSQLF 513
            +LG++LFKLASK+ N     +  L+ V ++ K +++ L    L+D  +  TI E   + 
Sbjct: 526 VDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIE-KYIG 584

Query: 514 IDKILSNVESSQGYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKF 573
           +D +   +E+ Q Y+EY E +LSRELENGRLFRLICKLNFIFG++E+R+DINWSE G+KF
Sbjct: 585 LDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKF 644

Query: 574 PIILFYDFVFHQVD-ETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKEL 632
            I+LFYD+VFHQ+D  TGK V DLTHVLRCLNKLDAG  E ++L TPDE+N  ++SYK++
Sbjct: 645 VIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKV 704

Query: 633 KDLIDTTFRSMT 644
           K+L+D TFR+MT
Sbjct: 705 KELVDKTFRAMT 716

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score =  525 bits (1352), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 262/470 (55%), Positives = 343/470 (72%), Gaps = 35/470 (7%)

Query: 204 RYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQI 263
           +YP IYPPPHS+LQYHLYAP+ P  L+  LKPNER+ + LFIPN++RE L KKNL+ LQ+
Sbjct: 217 KYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQV 276

Query: 264 FPSGG-AIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDV 322
           FPS G  IP IVQDYF LVP          +    +K +L+KVFSN DGK Y+L+R+ ++
Sbjct: 277 FPSSGKVIPSIVQDYFNLVP------LNFNNNDFLNKTTLFKVFSNYDGKAYVLKRLPNI 330

Query: 323 -QIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFT 381
            + M+P +I+K +Q W+ + C  ++K RD+F TTKFGD S+CLV+D+YP + SLY++HF 
Sbjct: 331 DKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFV 390

Query: 382 NFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIG-LIDWDKIIVTGDPGRIKLSGCGAID 440
           NFP  PIT +YLW YLVQLTN IN +HS+   IG  ++W K+++TGDPGRIKLS C  +D
Sbjct: 391 NFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD 450

Query: 441 VLGANEELD---------LHSKQQMDFENLGQLLFKLAS--------------KIGNNAN 477
           +L  N++ D         +  +QQ+D++ LG+LLF L+               ++     
Sbjct: 451 LL-FNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPKEYRLEEITP 509

Query: 478 AKIDEL-SVDDQFKTVLQYLLNDTND-RKTINELSQLFIDKILSNVESSQGYAEYTEGIL 535
             ID++  +DD+FK VL+YL++D  D +K+I++L+  F DK+   +ESSQ Y EY E +L
Sbjct: 510 QSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVL 569

Query: 536 SRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMD 595
           SRELENGRLFRL+ KLN IFG+IESR+DINWSESG KFPIILFYD+VFHQVD  GK +MD
Sbjct: 570 SRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMD 629

Query: 596 LTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645
           LTHVLRCLNKLDAG  EKL+L TPDE+NCIIISYKELKDLI++TFRS+TQ
Sbjct: 630 LTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELKDLIESTFRSITQ 679

>Scas_713.7
          Length = 983

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 256 KNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYI 315
           KNL  + I    G I      Y   + L+F  K   K+   G+K+ +      LD KVYI
Sbjct: 76  KNLNHVNIVKYHGFIQKSSNLY---IILEFCSKGSLKNLLTGYKDGI----PELDAKVYI 128

Query: 316 LRRIHDVQIMDPQQIAKPFQKWNNL--ECNQIVKLRDLFLTTKFGDSSLCLV 365
            + ++ +  +  Q +     K  NL  + N +VKL D  ++TK  ++++ L 
Sbjct: 129 RQTLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGVSTKVSNTAMTLA 180

>AEL063W [2443] [Homologous to ScYJR033C (RAV1) - SH]
           complement(515396..519340) [3945 bp, 1314 aa]
          Length = 1314

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 12/81 (14%)

Query: 262 QIF-PSGGAIPDIVQDYFG-----LVPLDFHQK-----EVTKDRYQGHKNSLYKVFSNLD 310
           QI+  SGG +  ++ D  G     L+PLD   +     ++ + R+ GH  S+ +++ + D
Sbjct: 335 QIYEASGGQLSLVIHDLRGSIKHVLLPLDKLARPTSLGDILEHRFTGHSKSIQRLWRSSD 394

Query: 311 GK-VYILRRIHDVQIMDPQQI 330
           G+ +  + R H+  I  PQ +
Sbjct: 395 GEAILTISRFHENAIWIPQNL 415

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 388 ITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGAN 445
           +T+  +W Y  Q+   ++ +HS+G     +  D  +VT D G +KL   G+  +   N
Sbjct: 358 MTKHEVWCYFKQICRGVDYLHSQGLAHRDLKLDNCVVTAD-GILKLIDFGSAIIFRYN 414

>Sklu_2439.22 YJR142W, Contig c2439 36303-37337 reverse complement
          Length = 344

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 390 QDYLWTYLVQLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELD 449
           QDYL+    Q  N  ++    G  IG +    +    D  R K+ GC   D+  AN++  
Sbjct: 40  QDYLFNKHFQ-KNVYHLQTHTGDNIGFV----LRFVVDQMR-KIGGCLFADLFQANDQDR 93

Query: 450 LHSKQQMDFENLGQLLFKLASKI 472
           L   + +DFE   + L KLASK+
Sbjct: 94  LLKFKPVDFETRNETLHKLASKL 116

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 348 LRDLFLTTKFGD-SSLCLVYDF--------YPQANSLYEHHFTNFPLVPITQDYLWTYLV 398
           L ++ + TK G   ++  +YDF        Y     LYE       +VP     +   + 
Sbjct: 114 LYEVDIQTKIGKHKNITELYDFFDSYIIMEYCSGGDLYE--AIKDDMVPRKTKNVTNIIN 171

Query: 399 QLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQM 456
           Q+ +A+  VHS+G Y   I  + I++ G+   IKL+  G       + E ++ S++ M
Sbjct: 172 QILDAVEYVHSRGIYHRDIKPENILIAGN-WNIKLTDWGLATTDKTSMERNVGSERYM 228

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 386 VPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCG 437
           VP     +   + Q+ +AI  VH+KG Y   I  + I+++G    IKL+  G
Sbjct: 177 VPKKTKSITHIITQIMDAIEYVHNKGIYHRDIKPENILISGIDWTIKLTDWG 228

>Kwal_55.20189
          Length = 812

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 11/99 (11%)

Query: 348 LRDLFLTTKFGD-SSLCLVYDF--------YPQANSLYEHHFTNFPLVPITQDYLWTYLV 398
           L ++ + TK G   ++  +YDF        Y     LYE       L+P     +     
Sbjct: 105 LYEVDIHTKVGKHKNITELYDFFDSFIVMEYCSGGDLYE--AIKADLIPKRTKVITHIAS 162

Query: 399 QLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCG 437
           Q+  AI  VH KG Y   +  + I++ G    IKL+  G
Sbjct: 163 QIMEAIEFVHQKGIYHRDLKPENILIEGSDWTIKLTDWG 201

>YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein
           required for normal growth rate and resistance to NaCl
           and H2O2 [8877 bp, 2958 aa]
          Length = 2958

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 434 SGCGAIDVLGANEELDLH-SKQQMDFENL 461
           SG G IDVL   E LDL+ +K QM+F+N 
Sbjct: 252 SGKGIIDVLPPKERLDLYRNKTQMEFKNF 280

>ADR369C [2110] [Homologous to ScYOR346W (REV1) - SH]
           (1362312..1364795) [2484 bp, 827 aa]
          Length = 827

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 6/121 (4%)

Query: 494 QYLLNDTNDRKTINELSQLFI-DKILSNVESSQGYAEYTEGILSRELENGRLFRLICKLN 552
           + LL  T    TI ++SQLF   ++++ + S  G A+  +  L + L++    R++C   
Sbjct: 401 KLLLGSTGHEHTIAQVSQLFSRSELIARLGSITG-AKLAD--LFQGLDDVESSRMLCNPR 457

Query: 553 FIFGKIESRVDINWSESGEKFPII-LFYD-FVFHQVDETGKSVMDLTHVLRCLNKLDAGA 610
             F +    V+INW    +  P +  F D  V + V +  +  M  +H++  + +    A
Sbjct: 458 AYFARKSLSVEINWGIRFDAVPEVDAFLDRLVQYLVGKLNELRMTTSHIVLKIARRSRDA 517

Query: 611 P 611
           P
Sbjct: 518 P 518

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,814,993
Number of extensions: 984835
Number of successful extensions: 2920
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3006
Number of HSP's successfully gapped: 39
Length of query: 645
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 537
Effective length of database: 12,857,365
Effective search space: 6904405005
Effective search space used: 6904405005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)