Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.4*1761768731e-121
Sklu_1276.21611595751e-76
Scas_595.21611595631e-74
YIR037W (HYR1)1631595621e-74
KLLA0F06732g1611595603e-74
YBR244W (GPX2)1621585464e-72
AFL039C2151605429e-71
Kwal_14.16061621595352e-70
CAGL0C01705g1641565325e-70
CAGL0I00264g1611615073e-66
CAGL0I00242g1651605032e-65
KLLA0D03905g1681574927e-64
YKL026C (GPX1)1671594841e-62
YDR150W (NUM1)2748102680.65
Scas_721.1145962632.2
Scas_692.3552452632.4
AER085C204678632.7
Kwal_55.22033488104614.4
KLLA0C17644g157654589.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.4*
         (176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.4*                                                           340   e-121
Sklu_1276.2 YIR037W, Contig c1276 1769-2254                           226   1e-76
Scas_595.2                                                            221   1e-74
YIR037W (HYR1) [2701] chr9 (423125..423616) Glutathione peroxida...   221   1e-74
KLLA0F06732g complement(649269..649754) highly similar to sp|P40...   220   3e-74
YBR244W (GPX2) [423] chr2 (707485..707973) Glutathione peroxidas...   214   4e-72
AFL039C [3154] [Homologous to ScYIR037W (HYR1) - NSH; ScYBR244W ...   213   9e-71
Kwal_14.1606                                                          210   2e-70
CAGL0C01705g complement(182305..182799) highly similar to sp|P38...   209   5e-70
CAGL0I00264g complement(18821..19306) highly similar to sp|P4058...   199   3e-66
CAGL0I00242g complement(17649..18146) similar to sp|P40581 Sacch...   198   2e-65
KLLA0D03905g complement(330128..330634) similar to sp|P38143 Sac...   194   7e-64
YKL026C (GPX1) [3229] chr11 complement(389023..389526) Glutathio...   191   1e-62
YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration pro...    31   0.65 
Scas_721.11                                                            29   2.2  
Scas_692.35                                                            29   2.4  
AER085C [2590] [Homologous to ScYKL182W (FAS1) - SH] (795193..80...    29   2.7  
Kwal_55.22033                                                          28   4.4  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    27   9.9  

>Scas_685.4*
          Length = 176

 Score =  340 bits (873), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/176 (93%), Positives = 165/176 (93%)

Query: 1   MLNRCXXXXXXXXXXXTMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYK 60
           MLNRC           TMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYK
Sbjct: 1   MLNRCISSSIRRFSIITMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYK 60

Query: 61  QLEKLYTKYEEQGLIILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKA 120
           QLEKLYTKYEEQGLIILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKA
Sbjct: 61  QLEKLYTKYEEQGLIILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKA 120

Query: 121 DPIYRYLKERQPGLFGIKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           DPIYRYLKERQPGLFGIKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL
Sbjct: 121 DPIYRYLKERQPGLFGIKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176

>Sklu_1276.2 YIR037W, Contig c1276 1769-2254
          Length = 161

 Score =  226 bits (575), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 103/159 (64%), Positives = 129/159 (81%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           MS FY+LT      +AFPF+QLK  VVLIVNVASKC FTPQYK+LE+LY KY+ QG  ++
Sbjct: 1   MSKFYELTPLDKAGQAFPFSQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQSQGFEVI 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
           GFPCNQF +QEPGSDE+I +FCQ ++GVTFP+MKKINVNG +ADP+Y +LK ++ GL G 
Sbjct: 61  GFPCNQFGHQEPGSDEEIGQFCQLNYGVTFPIMKKINVNGSEADPVYEFLKSQKSGLLGF 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           K IKWNFEKFL++K G + +RYSS+TKPS + + IEELL
Sbjct: 121 KGIKWNFEKFLVNKKGEVYERYSSLTKPSSLEKTIEELL 159

>Scas_595.2
          Length = 161

 Score =  221 bits (563), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           MS+FYKLT +    E +PF+QLK  VVLIVNVASKC FTPQYK+LE LY KY ++GL+I+
Sbjct: 1   MSEFYKLTPKDKKGEDYPFSQLKGKVVLIVNVASKCGFTPQYKELEALYEKYNDKGLVII 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
           GFPCNQF +QEPG+DE+I +FCQ ++GVTFP+MKKI+VNG+  DP+Y +LK ++ G+ G 
Sbjct: 61  GFPCNQFGHQEPGTDEEIGQFCQLNYGVTFPIMKKIDVNGKNEDPVYGFLKSQKSGILGF 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           K IKWNFEKFL+DK+G + +RY+S+TKPS I + I  LL
Sbjct: 121 KGIKWNFEKFLVDKNGKVYERYASLTKPSSIDETIATLL 159

>YIR037W (HYR1) [2701] chr9 (423125..423616) Glutathione peroxidase
           involved in oxidative stress response, forms an
           intermolecular disulfide with Yap1p upon exposure to
           peroxide to activate Yap1p [492 bp, 163 aa]
          Length = 163

 Score =  221 bits (562), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 128/159 (80%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           MS+FYKL       + FPF QLK  VVLIVNVASKC FTPQYK+LE LY +Y+++G  I+
Sbjct: 1   MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTII 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
           GFPCNQF +QEPGSDE+I +FCQ ++GVTFP+MKKI+VNG   DP+Y++LK ++ G+ G+
Sbjct: 61  GFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGL 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           + IKWNFEKFL+DK G + +RYSS+TKPS +++ IEELL
Sbjct: 121 RGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELL 159

>KLLA0F06732g complement(649269..649754) highly similar to sp|P40581
           Saccharomyces cerevisiae YIR037w HYR1 glutathione
           peroxidase, start by similarity
          Length = 161

 Score =  220 bits (560), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 127/159 (79%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           MS FY+L  +    E FPF QL+  VVLIVNVASKC FTPQYK+LE LY KYE++G I+L
Sbjct: 1   MSKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKELEALYKKYEDKGFIVL 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
           GFPCNQF +QEPG+DE+I +FCQ ++GV+FP++KK++VNG +ADP+Y +LK  + GL G 
Sbjct: 61  GFPCNQFGHQEPGTDEEISQFCQLNYGVSFPILKKVDVNGSEADPVYDFLKNEKSGLLGF 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           K IKWNFEKFL+DK G + +RYSS+TKPS + + IE+LL
Sbjct: 121 KGIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLL 159

>YBR244W (GPX2) [423] chr2 (707485..707973) Glutathione peroxidase,
           has a role in mitochondrial morphology and provides
           protection against lipid and non-lipid hydroperoxides
           [489 bp, 162 aa]
          Length = 162

 Score =  214 bits (546), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 123/158 (77%)

Query: 19  SDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIILG 78
           + FY L  +    E+F F QLK  VVLIVNVASKC FTPQYK+LE+LY KY+++G +ILG
Sbjct: 3   TSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILG 62

Query: 79  FPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGIK 138
           FPCNQF  QEPGSDE I +FCQ ++GVTFP+MKKI+VNG  AD +Y YLK ++ GL G K
Sbjct: 63  FPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFK 122

Query: 139 SIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
            IKWNFEKFL+D +G + +R+SS+TKPS + Q+I+ LL
Sbjct: 123 GIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLL 160

>AFL039C [3154] [Homologous to ScYIR037W (HYR1) - NSH; ScYBR244W
           (GPX2) - SH] (366579..367226) [648 bp, 215 aa]
          Length = 215

 Score =  213 bits (542), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 126/160 (78%)

Query: 17  TMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLII 76
           TMS FY L+      E FPF+QLK  VV+IVNVASKC FTPQY++LE+LY KY++QG  +
Sbjct: 26  TMSGFYDLSPLDAKGEPFPFSQLKGKVVIIVNVASKCGFTPQYEELEELYKKYKDQGFEV 85

Query: 77  LGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFG 136
           +GFPCNQFA+QEP ++E+I +FC+ ++GVTFP++KK++VNG  ADP+Y YLK ++ GL G
Sbjct: 86  IGFPCNQFAHQEPATNEEIVQFCKLNYGVTFPVLKKVDVNGADADPVYVYLKSQKSGLLG 145

Query: 137 IKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
            K IKWNFEKFL+D+ G ++ RYSSITKP  + + IE LL
Sbjct: 146 FKGIKWNFEKFLVDRKGQVKDRYSSITKPLSLEKTIETLL 185

>Kwal_14.1606
          Length = 162

 Score =  210 bits (535), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 124/159 (77%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           MS FY+L       + FPF QL+  VVLIVNVASKC FTPQY++L++LY +Y ++G  I+
Sbjct: 1   MSKFYELEPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEII 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
           GFPCNQF  QE G+DE+I +FC+ ++GVTFP+MKKI+VNG  ADP+Y YLKE++ G+ G 
Sbjct: 61  GFPCNQFGKQESGTDEEIGQFCKLNYGVTFPIMKKIHVNGASADPVYEYLKEQKAGMLGF 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           + IKWNFEKFLIDKHGN+  RYSS+TKP+ +   +++LL
Sbjct: 121 RGIKWNFEKFLIDKHGNVHDRYSSLTKPANLDAKVDKLL 159

>CAGL0C01705g complement(182305..182799) highly similar to sp|P38143
           Saccharomyces cerevisiae YBR244w GPX2, start by
           similarity
          Length = 164

 Score =  209 bits (532), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 117/156 (75%)

Query: 21  FYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIILGFP 80
           FY+L  +    E F F  LK  VVLIVNVASKC FTPQYK LE LY K++++GL+ILGFP
Sbjct: 6   FYELECKDKKGETFKFDTLKGKVVLIVNVASKCGFTPQYKDLESLYQKHKDEGLVILGFP 65

Query: 81  CNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGIKSI 140
           CNQF  QEPGS E+I  FCQ ++GVTFP+M KI VNG   DP+Y +LK ++ GL G+  +
Sbjct: 66  CNQFGGQEPGSQEEIGNFCQLNYGVTFPIMHKIEVNGDNTDPVYDFLKSQKSGLLGLNRV 125

Query: 141 KWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           KWNFEKFL+DKHG + +RYSS+TKP  I  DI++LL
Sbjct: 126 KWNFEKFLVDKHGKVHQRYSSLTKPMSIEDDIKQLL 161

>CAGL0I00264g complement(18821..19306) highly similar to sp|P40581
           Saccharomyces cerevisiae YIR037w HYR1, start by
           similarity
          Length = 161

 Score =  199 bits (507), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (75%), Gaps = 4/161 (2%)

Query: 18  MSDFYKLTARTVDNEA--FPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLI 75
           MS F++L  R VD +   +PF  LK  VVLIVN AS C FTPQY +LE +Y KY+ +G  
Sbjct: 1   MSPFHQL--RPVDGQGNIYPFEMLKGKVVLIVNTASNCGFTPQYIELENMYQKYKNEGFE 58

Query: 76  ILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLF 135
           ILGFPCNQF +QEPGSD +I+KFC   + VTFP+MKKI+VNG   DP+++Y+KE++PG+ 
Sbjct: 59  ILGFPCNQFGHQEPGSDAEIQKFCSSKYKVTFPIMKKIDVNGPYEDPVFKYIKEQKPGML 118

Query: 136 GIKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           G+K IKWNFEKFLID+ GN+  R SS+TKPS + + IE+LL
Sbjct: 119 GLKGIKWNFEKFLIDRQGNVVLRASSLTKPSTLNETIEKLL 159

>CAGL0I00242g complement(17649..18146) similar to sp|P40581
           Saccharomyces cerevisiae YIR037w HYR1 glutathione
           peroxidase, start by similarity
          Length = 165

 Score =  198 bits (503), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (72%)

Query: 17  TMSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLII 76
           + S FY L+    DN  FPF+ LK  VVLIVNVASKC+FTPQY  L+ L+ KY  +GL I
Sbjct: 3   SQSSFYDLSPHDKDNNEFPFSNLKGQVVLIVNVASKCNFTPQYNDLQYLHEKYSYRGLKI 62

Query: 77  LGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFG 136
           +GFPCNQF  QEP +DE I+KFC  ++GV+F ++KKI VNG  ADP+Y YLK   P   G
Sbjct: 63  IGFPCNQFGQQEPENDEVIQKFCLSNYGVSFKILKKIKVNGPNADPVYTYLKNEMPSQIG 122

Query: 137 IKSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           +K I+WNFEKFL+DKHG ++ RYSS+T P  + + I++LL
Sbjct: 123 LKVIRWNFEKFLVDKHGRVRHRYSSLTSPKSLQRTIDQLL 162

>KLLA0D03905g complement(330128..330634) similar to sp|P38143
           Saccharomyces cerevisiae YBR244w GPX2 glutathione
           peroxidases, start by similarity
          Length = 168

 Score =  194 bits (492), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 115/157 (73%)

Query: 20  DFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIILGF 79
           DFY  +  T D   +  ++L+  VVLIVNVASKC F  QY +L++LY ++  +G  IL F
Sbjct: 4   DFYSYSCETKDGSEYHMSELRGKVVLIVNVASKCGFRGQYGELQELYKEFHAKGFEILAF 63

Query: 80  PCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGIKS 139
           PCNQF NQEPGSDE+I KFCQE +GV+F +MKK  VNG  A P+Y+YLK++QP +FG   
Sbjct: 64  PCNQFMNQEPGSDEEIGKFCQEHYGVSFKIMKKCKVNGVNALPLYKYLKDQQPRMFGFTF 123

Query: 140 IKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           ++WNFEKFLID+ G +  RYS++TKP  + +DIE+LL
Sbjct: 124 VRWNFEKFLIDRSGRVHGRYSTLTKPKSMKEDIEQLL 160

>YKL026C (GPX1) [3229] chr11 complement(389023..389526) Glutathione
           peroxidase, involved in cellular protection against
           lipid and non-lipid hydroperoxides [504 bp, 167 aa]
          Length = 167

 Score =  191 bits (484), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 115/159 (72%)

Query: 18  MSDFYKLTARTVDNEAFPFAQLKNHVVLIVNVASKCSFTPQYKQLEKLYTKYEEQGLIIL 77
           M +FY  +    +   FPF  L+N VVLIVNVAS C+FTPQYK+LE LY KY+  GL+I+
Sbjct: 1   MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV 60

Query: 78  GFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
            FPC QF NQE   D++I KFCQ+ +GVTFP++ KI  NGQK DP+Y++LK    G  GI
Sbjct: 61  AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI 120

Query: 138 KSIKWNFEKFLIDKHGNIQKRYSSITKPSEIAQDIEELL 176
           K IKWNFEKF++D++G + KR+S +T+P E+   IEELL
Sbjct: 121 KMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELL 159

>YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration
           protein, controls interaction of bud-neck cytoskeleton
           with G2 nucleus [8247 bp, 2748 aa]
          Length = 2748

 Score = 30.8 bits (68), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 40  KNHVVLIVNVASKC----SFTPQYKQLEKLYTKYEEQGLIILGFPCNQFANQEPGSDEDI 95
           KN+++L+ N + K     S +    + ++L TK   + L ++  P +   +++  S E  
Sbjct: 347 KNNMILLSNDSYKNLLQKSESASKPKDDELMTKEVAENLNMIALPNDDNYSKKEFSLESH 406

Query: 96  KKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQPGLFGI 137
            K+ + S     PL +  N+N   ++P Y YLKE+   L  I
Sbjct: 407 IKYLEASGYKVLPLEEFENLNESLSNPSYNYLKEKLQALKKI 448

>Scas_721.11
          Length = 459

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 55  FTPQYKQLEKLYTKYEEQGLIILGFPCNQFANQEPGSD------EDIKKFCQESFGVTFP 108
           FT Q  Q    Y  Y+E G+++     +Q+ N   G D      E IK+  + +FG+T P
Sbjct: 201 FTYQILQAFDFYHLYKEHGVMVQVGGNDQWGNITAGIDLIGRLEEKIKE--KPAFGITVP 258

Query: 109 LM 110
           L+
Sbjct: 259 LL 260

>Scas_692.35
          Length = 524

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 27/52 (51%)

Query: 69  YEEQGLIILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKA 120
           ++ +G+I+ G P + +A   P  D D+ K      G+ + + +   +NG++ 
Sbjct: 51  WKPKGVILSGGPYSVYAEDAPHVDHDVFKLNVPILGICYGMQELAWINGKQV 102

>AER085C [2590] [Homologous to ScYKL182W (FAS1) - SH]
           (795193..801333) [6141 bp, 2046 aa]
          Length = 2046

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 19/78 (24%)

Query: 114 NVNGQK---ADPIYRYLKERQPGLFGIKSI-KW------NF---------EKFLIDKHGN 154
            VNG+     D  Y+ + ER   L  IKS  KW      NF         E+F  DK  +
Sbjct: 905 TVNGEARELTDMTYKEVAERMVELMFIKSTGKWIDVTLRNFTGDFLRRVEERFTKDKSVS 964

Query: 155 IQKRYSSITKPSEIAQDI 172
           + + YS +  PS++  DI
Sbjct: 965 VLQSYSDLETPSKVLADI 982

>Kwal_55.22033
          Length = 488

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 40/104 (38%), Gaps = 17/104 (16%)

Query: 59  YKQLEKLYTKYEEQGLIILGFPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQ 118
           Y QL   Y +Y +  +    F CN              K    SFG    L  K  +N  
Sbjct: 250 YDQLVDAYAEYTKP-VFFSEFGCN--------------KVTPRSFGEVEALYSKSMINTF 294

Query: 119 KADPIYRYLKERQPGLFGIKSIKWNFEKFLIDKHGNIQKRYSSI 162
               +Y + +E  P  +G+  IK +    ++     +Q RY++I
Sbjct: 295 SGGLVYEFTQE--PNQYGLVEIKSDGSAHMLSDFKALQSRYAAI 336

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
           cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 26.9 bits (58), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 23/54 (42%)

Query: 79  FPCNQFANQEPGSDEDIKKFCQESFGVTFPLMKKINVNGQKADPIYRYLKERQP 132
           F   +F     G++ + +K C E+F +   L   + V   K DP     K + P
Sbjct: 791 FVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSP 844

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,630,930
Number of extensions: 241938
Number of successful extensions: 550
Number of sequences better than 10.0: 23
Number of HSP's gapped: 549
Number of HSP's successfully gapped: 23
Length of query: 176
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 81
Effective length of database: 13,307,399
Effective search space: 1077899319
Effective search space used: 1077899319
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.9 bits)