Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.1138435619080.0
Kwal_14.88439536713440.0
YKL021C (MAK11)46838213450.0
KLLA0E07942g39036413170.0
CAGL0F06853g38835912951e-179
ACR166W38835912511e-172
Scas_631.174741301572e-11
KLLA0F11231g4341571511e-10
AAL009C3032731491e-10
AEL269C4552321502e-10
Sklu_2442.23032771482e-10
Kwal_23.50357441221493e-10
Scas_624.1112051391493e-10
CAGL0H03729g3032751464e-10
KLLA0D04840g3031151454e-10
KLLA0E12287g3262691456e-10
ADL082C5691591441e-09
CAGL0M02277g4271461431e-09
CAGL0A00561g4121291422e-09
YPR178W (PRP4)4651111422e-09
CAGL0G09845g5001361422e-09
YIL046W (MET30)6401381422e-09
YDL145C (COP1)12011391423e-09
Kwal_56.2452612101391423e-09
CAGL0L02629g7953121413e-09
Scas_704.406081561404e-09
Scas_465.410021221404e-09
AEL246C8151341404e-09
Scas_695.153272781375e-09
CAGL0L00781g6731591387e-09
YGL004C (RPN14)4171281377e-09
Scas_707.227301441379e-09
Kwal_0.2123031151341e-08
Sklu_2291.49971241371e-08
Sklu_2431.127493051361e-08
YNL006W (LST8)3032751331e-08
KLLA0E23529g8261341362e-08
Sklu_2172.62631341322e-08
KLLA0F04884g12121971362e-08
KLLA0E04741g4591321342e-08
Kwal_34.158183492771322e-08
KLLA0C08547g5151741333e-08
ADR264C3462711313e-08
ADR077C12041371334e-08
Kwal_26.89534581971314e-08
Kwal_26.87764331251314e-08
CAGL0I03718g12011391315e-08
YJL112W (MDV1)7141721315e-08
Sklu_2420.24411231297e-08
KLLA0D07546g6471681308e-08
Sklu_2160.37601411308e-08
Scas_721.328221601291e-07
AER263C5131741281e-07
AGL024W7561221291e-07
ACR137W4251421271e-07
KLLA0D16390g9361571281e-07
KLLA0F27511g6231321271e-07
Scas_692.254881611262e-07
KLLA0E18986g9901001262e-07
CAGL0L06952g3472681242e-07
Kwal_23.57696271591253e-07
YCR072C5151191253e-07
Kwal_23.53514741111243e-07
YBR198C (TAF5)7981481243e-07
YPL151C (PRP46)4511301243e-07
ADR176W4611651243e-07
Kwal_56.239209371321253e-07
YFL009W (CDC4)7791541244e-07
AGL196C9351251244e-07
Sklu_2173.25151791235e-07
CAGL0C03608g6432811235e-07
CAGL0M04279g9401251235e-07
Scas_720.955151151226e-07
Kwal_23.63245141831226e-07
Sklu_675.13082711199e-07
YMR116C (ASC1)3191431191e-06
KLLA0F10263g6822281201e-06
KLLA0B01958g8901801201e-06
Kwal_47.175554171231191e-06
Kwal_27.111269961241201e-06
YPL183C10131211201e-06
CAGL0M05335g8061341201e-06
Scas_713.509831251191e-06
YGL137W (SEC27)8892051192e-06
YOR269W (PAC1)4941561182e-06
AFR199C3342621172e-06
CAGL0J03476g5171151172e-06
Kwal_27.120537551241173e-06
Scas_585.84601601163e-06
YLR129W (DIP2)9431251173e-06
AGR168W8251791173e-06
Kwal_26.7570218981133e-06
AFL009C4131221153e-06
Sklu_2384.33281591144e-06
KLLA0F13244g8142421164e-06
YMR146C (TIF34)3471261144e-06
AGR180W8062461155e-06
AFL118W8322051155e-06
Scas_680.113472791136e-06
Kwal_56.24163729721137e-06
YBR103W (SIF2)5351551121e-05
Kwal_14.9063282051111e-05
AGL234W6292281121e-05
KLLA0E11297g5121141111e-05
Scas_592.4*3181311101e-05
Scas_721.115*3181311101e-05
Kwal_55.220674511301102e-05
Sklu_1926.55091121102e-05
YCR084C (TUP1)7132321102e-05
CAGL0D02090g2771941073e-05
CAGL0H08932g9022051093e-05
CAGL0K12188g5351131083e-05
YNL317W (PFS2)4651301073e-05
CAGL0M04081g4552931064e-05
Scas_720.45755721075e-05
Scas_630.6621791065e-05
AEL314W7151431065e-05
Kwal_33.154757832301066e-05
Sklu_2416.54591301057e-05
CAGL0C01441g10051251057e-05
KLLA0A04928g8613621058e-05
Scas_397.24101291048e-05
Kwal_27.126677211491049e-05
AFL056C9761091059e-05
CAGL0I07073g3931871031e-04
CAGL0M09845g9362351041e-04
Scas_702.168162221031e-04
Kwal_23.64297501211031e-04
Scas_542.53271561011e-04
ADL184W4491401021e-04
YKL018W (SWD2)3291591011e-04
Kwal_23.41189392401031e-04
Scas_717.689082141022e-04
CAGL0E00561g8361021022e-04
KLLA0F21406g7051431013e-04
KLLA0E07073g4521281003e-04
KLLA0F22000g7932151003e-04
CAGL0L03201g5791461003e-04
CAGL0C02937g467158993e-04
KLLA0F07403g347265984e-04
Kwal_23.6240913197994e-04
Scas_603.558960985e-04
CAGL0L09757g326131975e-04
KLLA0B02827g942163986e-04
CAGL0C00737g816198977e-04
CAGL0D05588g47768967e-04
Kwal_27.11585823246978e-04
Kwal_26.8975445201968e-04
Scas_657.13411147968e-04
CAGL0L10890g457145968e-04
CAGL0K00957g793253969e-04
KLLA0C08976g911132969e-04
Sklu_2423.1944187960.001
Scas_629.1267177960.001
KLLA0C07425g444132950.001
KLLA0E18139g326160940.001
Scas_718.6*546165950.001
Scas_720.83d915131950.001
CAGL0E02805g840207940.002
AER337W445205930.002
Scas_674.20297265920.002
Scas_571.4601125930.002
Scas_442.2*795235930.002
YLR409C (UTP21)939162930.002
Kwal_55.21450503344920.002
Scas_711.1169580920.003
YKR036C (CAF4)659188920.003
ACL099W357270910.003
YBL008W (HIR1)840319910.004
Scas_719.30940156890.006
YPL247C523159890.006
Scas_659.947583880.007
YLR429W (CRN1)651117880.008
YCR057C (PWP2)923162880.008
Kwal_27.12070418123870.008
CAGL0J08778g298102870.009
KLLA0A08866g42396870.009
KLLA0D00814g40871870.010
YEL056W (HAT2)401128860.011
AER114W633241870.012
CAGL0K09284g911191870.013
ACL116W804149860.013
AAR057W922131860.014
Scas_658.1442102850.015
Sklu_1880.3471317850.016
Scas_699.5494152850.016
AER081C102366860.017
Kwal_47.17465800104850.018
YOR272W (YTM1)460146850.019
Scas_700.27*43366840.021
CAGL0H00781g513165840.025
Scas_719.5262888840.026
YGL003C (CDH1)566205840.027
Scas_512.353470830.031
CAGL0J04818g65475830.034
Scas_605.18424136820.034
YLR222C (UTP13)817184830.036
KLLA0E24508g327209810.044
Scas_679.28815235820.045
AAR102C591166820.045
YLR208W (SEC13)297102810.047
Sklu_2114.2114067820.048
YLL011W (SOF1)48975810.052
CAGL0B03575g41945810.057
KLLA0E21263g429323810.057
AAL157C479100810.061
YGR200C (ELP2)78837810.065
Sklu_2133.4373105800.073
ADR242C521146800.078
CAGL0A02772g44190800.079
Sklu_2364.2411113790.095
CAGL0G04345g711141790.096
Kwal_26.862842293790.098
Kwal_56.24332418174790.100
YOR212W (STE4)423135780.11
KLLA0E21879g333265770.13
KLLA0C16643g302268770.13
KLLA0F19734g113383780.15
Scas_670.21595182780.15
YMR102C83464780.16
AFL007C551186770.16
CAGL0A00605g640195770.17
Scas_689.6213967780.17
CAGL0I03454g303192760.18
Kwal_27.12586509128770.18
KLLA0D06787g43660770.18
YBR234C (ARC40)384106760.18
YKL213C (DOA1)715136770.19
Sklu_1963.2314182760.20
CAGL0L04950g80578770.20
Kwal_56.24596294102750.25
Scas_706.24460220750.25
CAGL0B03289g87076760.26
Kwal_33.1314867378750.29
ACR199C295102740.31
Scas_721.29414112740.32
CAGL0L02761g419207740.35
AFL006C43387740.36
KLLA0B12804g852105750.36
YGL100W (SEH1)349235740.37
Kwal_56.23035424141740.38
Kwal_56.22345396128730.44
AER439W41498730.48
Sklu_2406.1142645730.48
Sklu_2318.1711119730.50
Sklu_2364.4555203730.55
YCL039W (GID7)74585730.60
Scas_705.4649055720.63
Scas_652.16345317720.64
KLLA0F15598g478124720.66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.11
         (384 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.11                                                           739   0.0  
Kwal_14.884                                                           522   0.0  
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...   522   0.0  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...   511   0.0  
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...   503   e-179
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...   486   e-172
Scas_631.17                                                            65   2e-11
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    63   1e-10
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    62   1e-10
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    62   2e-10
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            62   2e-10
Kwal_23.5035                                                           62   3e-10
Scas_624.11                                                            62   3e-10
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    61   4e-10
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    60   4e-10
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    60   6e-10
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    60   1e-09
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    60   1e-09
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    59   2e-09
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    59   2e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    59   2e-09
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    59   2e-09
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    59   3e-09
Kwal_56.24526                                                          59   3e-09
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    59   3e-09
Scas_704.40                                                            59   4e-09
Scas_465.4                                                             59   4e-09
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    59   4e-09
Scas_695.15                                                            57   5e-09
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    58   7e-09
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    57   7e-09
Scas_707.22                                                            57   9e-09
Kwal_0.212                                                             56   1e-08
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         57   1e-08
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      57   1e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    56   1e-08
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    57   2e-08
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       55   2e-08
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    57   2e-08
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    56   2e-08
Kwal_34.15818                                                          55   2e-08
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    56   3e-08
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    55   3e-08
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    56   4e-08
Kwal_26.8953                                                           55   4e-08
Kwal_26.8776                                                           55   4e-08
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    55   5e-08
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    55   5e-08
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            54   7e-08
KLLA0D07546g complement(647984..649927) some similarities with s...    55   8e-08
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         55   8e-08
Scas_721.32                                                            54   1e-07
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    54   1e-07
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    54   1e-07
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    54   1e-07
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    54   1e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    54   1e-07
Scas_692.25                                                            53   2e-07
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    53   2e-07
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    52   2e-07
Kwal_23.5769                                                           53   3e-07
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    53   3e-07
Kwal_23.5351                                                           52   3e-07
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    52   3e-07
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    52   3e-07
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    52   3e-07
Kwal_56.23920                                                          53   3e-07
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    52   4e-07
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    52   4e-07
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            52   5e-07
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    52   5e-07
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    52   5e-07
Scas_720.95                                                            52   6e-07
Kwal_23.6324                                                           52   6e-07
Sklu_675.1 YMR146C, Contig c675 761-1687                               50   9e-07
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    50   1e-06
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    51   1e-06
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    51   1e-06
Kwal_47.17555                                                          50   1e-06
Kwal_27.11126                                                          51   1e-06
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    51   1e-06
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    51   1e-06
Scas_713.50                                                            50   1e-06
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    50   2e-06
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    50   2e-06
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    50   2e-06
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    50   2e-06
Kwal_27.12053                                                          50   3e-06
Scas_585.8                                                             49   3e-06
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    50   3e-06
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    50   3e-06
Kwal_26.7570                                                           48   3e-06
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    49   3e-06
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            49   4e-06
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    49   4e-06
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    49   4e-06
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    49   5e-06
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    49   5e-06
Scas_680.11                                                            48   6e-06
Kwal_56.24163                                                          48   7e-06
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    48   1e-05
Kwal_14.906                                                            47   1e-05
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    48   1e-05
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    47   1e-05
Scas_592.4*                                                            47   1e-05
Scas_721.115*                                                          47   1e-05
Kwal_55.22067                                                          47   2e-05
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         47   2e-05
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    47   2e-05
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    46   3e-05
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    47   3e-05
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    46   3e-05
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    46   3e-05
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    45   4e-05
Scas_720.45                                                            46   5e-05
Scas_630.6                                                             45   5e-05
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    45   5e-05
Kwal_33.15475                                                          45   6e-05
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           45   7e-05
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    45   7e-05
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    45   8e-05
Scas_397.2                                                             45   8e-05
Kwal_27.12667                                                          45   9e-05
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    45   9e-05
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    44   1e-04
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    45   1e-04
Scas_702.16                                                            44   1e-04
Kwal_23.6429                                                           44   1e-04
Scas_542.5                                                             44   1e-04
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    44   1e-04
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    44   1e-04
Kwal_23.4118                                                           44   1e-04
Scas_717.68                                                            44   2e-04
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    44   2e-04
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    44   3e-04
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    43   3e-04
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    43   3e-04
CAGL0L03201g complement(366795..368534) some similarities with s...    43   3e-04
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    43   3e-04
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    42   4e-04
Kwal_23.6240                                                           43   4e-04
Scas_603.5                                                             42   5e-04
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    42   5e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    42   6e-04
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    42   7e-04
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    42   7e-04
Kwal_27.11585                                                          42   8e-04
Kwal_26.8975                                                           42   8e-04
Scas_657.13                                                            42   8e-04
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    42   8e-04
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   9e-04
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    42   9e-04
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             42   0.001
Scas_629.12                                                            42   0.001
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    41   0.001
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    41   0.001
Scas_718.6*                                                            41   0.001
Scas_720.83d                                                           41   0.001
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    41   0.002
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    40   0.002
Scas_674.20                                                            40   0.002
Scas_571.4                                                             40   0.002
Scas_442.2*                                                            40   0.002
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    40   0.002
Kwal_55.21450                                                          40   0.002
Scas_711.11                                                            40   0.003
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    40   0.003
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    40   0.003
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    40   0.004
Scas_719.30                                                            39   0.006
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    39   0.006
Scas_659.9                                                             39   0.007
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    39   0.008
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    39   0.008
Kwal_27.12070                                                          38   0.008
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    38   0.009
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    38   0.009
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    38   0.010
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    38   0.011
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    38   0.012
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    38   0.013
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    38   0.013
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    38   0.014
Scas_658.1                                                             37   0.015
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            37   0.016
Scas_699.5                                                             37   0.016
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    38   0.017
Kwal_47.17465                                                          37   0.018
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    37   0.019
Scas_700.27*                                                           37   0.021
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    37   0.025
Scas_719.52                                                            37   0.026
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    37   0.027
Scas_512.3                                                             37   0.031
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    37   0.034
Scas_605.18                                                            36   0.034
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    37   0.036
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    36   0.044
Scas_679.28                                                            36   0.045
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    36   0.045
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    36   0.047
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          36   0.048
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    36   0.052
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    36   0.057
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    36   0.057
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    36   0.061
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    36   0.065
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            35   0.073
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    35   0.078
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    35   0.079
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         35   0.095
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    35   0.096
Kwal_26.8628                                                           35   0.098
Kwal_56.24332                                                          35   0.100
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    35   0.11 
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    34   0.13 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    34   0.13 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    35   0.15 
Scas_670.21                                                            35   0.15 
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    35   0.16 
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    34   0.16 
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    34   0.17 
Scas_689.6                                                             35   0.17 
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    34   0.18 
Kwal_27.12586                                                          34   0.18 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    34   0.18 
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    34   0.18 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    34   0.19 
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         34   0.20 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    34   0.20 
Kwal_56.24596                                                          33   0.25 
Scas_706.24                                                            33   0.25 
CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces c...    34   0.26 
Kwal_33.13148                                                          33   0.29 
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    33   0.31 
Scas_721.29                                                            33   0.32 
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    33   0.35 
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    33   0.36 
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    33   0.36 
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    33   0.37 
Kwal_56.23035                                                          33   0.38 
Kwal_56.22345                                                          33   0.44 
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    33   0.48 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      33   0.48 
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          33   0.50 
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         33   0.55 
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    33   0.60 
Scas_705.46                                                            32   0.63 
Scas_652.16                                                            32   0.64 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    32   0.66 
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    32   0.67 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            32   0.69 
Kwal_47.19083                                                          32   0.71 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    32   0.71 
Kwal_33.14971                                                          32   0.72 
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    32   0.74 
Scas_670.22                                                            32   0.75 
Kwal_33.15591                                                          32   0.79 
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    32   0.80 
Scas_721.7                                                             32   0.87 
Kwal_56.23685                                                          32   0.87 
AFR438W [3630] [Homologous to ScYML088W (UFO1) - SH] complement(...    32   0.88 
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    32   0.98 
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement           32   1.1  
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    32   1.1  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    32   1.2  
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    32   1.3  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    32   1.3  
Kwal_55.21559                                                          31   1.5  
KLLA0F10593g complement(976698..978008) similar to sp|P53136 Sac...    31   1.5  
Kwal_56.24478                                                          31   1.6  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    31   1.7  
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    31   1.8  
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    31   1.8  
Scas_660.8                                                             31   2.0  
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          31   2.2  
Kwal_14.1174                                                           30   2.3  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    30   2.4  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    31   2.4  
Kwal_33.13515                                                          30   2.6  
Kwal_23.3869                                                           30   2.7  
Kwal_27.12239                                                          30   2.9  
Kwal_47.17567                                                          30   3.0  
Scas_692.29                                                            30   3.1  
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    30   3.7  
Kwal_33.15136                                                          30   3.7  
Scas_705.2                                                             30   3.8  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    30   4.0  
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    30   4.2  
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    30   4.4  
ACR061C [1109] [Homologous to ScYJL039C (NUP192) - SH] (466024.....    30   4.6  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    30   4.6  
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    30   4.6  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    29   4.8  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    29   4.9  
ADR011C [1752] [Homologous to ScYIR002C (MPH1) - SH] (721695..72...    30   5.2  
Scas_655.1                                                             30   5.3  
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    30   5.4  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    29   5.5  
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    29   5.9  
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    29   5.9  
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    29   6.2  
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    29   6.4  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    29   6.8  
YNL182C (IPI3) [4418] chr14 complement(295960..297627) Protein c...    29   6.9  
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    29   7.0  
Scas_719.7*                                                            29   7.3  
Scas_615.11                                                            29   7.6  
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    29   7.6  
Kwal_23.6290                                                           29   7.6  
Sklu_1395.2 YOL102C, Contig c1395 1586-2272 reverse complement         28   7.7  
Scas_675.18                                                            29   7.8  
YBR140C (IRA1) [326] chr2 complement(517306..526584) GTPase-acti...    29   8.0  
AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720) [...    29   8.0  
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    29   8.2  
Scas_642.1                                                             29   8.3  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    29   8.6  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    29   9.0  
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    28   9.4  
Kwal_56.23207                                                          29   9.5  
YMR275C (BUL1) [4229] chr13 complement(815650..818580) Protein i...    29   9.7  

>Scas_685.11
          Length = 384

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/356 (100%), Positives = 356/356 (100%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60
           MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND
Sbjct: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120
           EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR
Sbjct: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120

Query: 121 VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN 180
           VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN
Sbjct: 121 VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN 180

Query: 181 GQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAM 240
           GQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAM
Sbjct: 181 GQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAM 240

Query: 241 SDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVW 300
           SDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVW
Sbjct: 241 SDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVW 300

Query: 301 DMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESDTEEL 356
           DMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESDTEEL
Sbjct: 301 DMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESDTEEL 356

>Kwal_14.884
          Length = 395

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/367 (71%), Positives = 308/367 (83%), Gaps = 11/367 (2%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60
           M++NQFRI+VGSYEHN+LCLSL+LSL TP+FTPIFHFQAH+LSVKCLD+SKRYLVSGSND
Sbjct: 1   MSQNQFRIVVGSYEHNLLCLSLNLSLSTPIFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKS---KTENGDGEG-----SNNKWLLSASE 112
           EHIRIYDLQKRKELGTLL+HQGSIT LKFSK    + +N D  G      N+KWL+SAS+
Sbjct: 61  EHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASD 120

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           D+ ++IWRVKDWENFGTLKGH +RIND DIHPSNR+AISVSEDHSIRLWNLMTVKKA VL
Sbjct: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVKKAGVL 180

Query: 173 KLRNYSQNGQFVRWIGN-GDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLD 231
           KL+ Y+QNGQFVRW G+ G++FAVALL KVLIYKT+ AKVH E+D  K +IM +E E +D
Sbjct: 181 KLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIYKTSTAKVHRELDTGKSSIMRMEIENID 240

Query: 232 GKIYICVAMSDGNIHFYPTEGLLTEEPKVEE--PEFSLLGHSNRVKDFKFYKNDFGTYMV 289
           GK YI +A  +G +  +P + L  EE   E   PEF+L GH+NRVKDFKFYKN+FG Y+V
Sbjct: 241 GKDYIVLAFGNGTVSMFPAKSLYDEEASEEPVTPEFNLQGHTNRVKDFKFYKNEFGHYLV 300

Query: 290 SIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEV 349
           +IGSDG++VVWDM  K+++AVYDCGERLNCLA+ DE+VEKYE MKKR +E ADLGEQSEV
Sbjct: 301 TIGSDGKIVVWDMSNKEQVAVYDCGERLNCLALCDESVEKYEMMKKRVAEEADLGEQSEV 360

Query: 350 ESDTEEL 356
           E DTE L
Sbjct: 361 EEDTESL 367

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 304/382 (79%), Gaps = 31/382 (8%)

Query: 3   KNQFRIIVGSYEHNILCLSLDL-------SLKTPLFTPIFHFQAHALSVKCLDVSKRYLV 55
           KNQFRIIVGSYEHNILCLSLD+       + KTP F PIFHFQAH+LS+KCL VS+RYLV
Sbjct: 61  KNQFRIIVGSYEHNILCLSLDIPNQKENDAAKTPHFMPIFHFQAHSLSIKCLAVSRRYLV 120

Query: 56  SGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS----NNKWLLSAS 111
           SGSNDEHIRIYDLQKRKELGTLL+HQGSIT L+FS   + + D   S    N+KWLLSAS
Sbjct: 121 SGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSAS 180

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAV 171
           ED+KI++WRVKDWE  GTLKGH AR+NDVDIHP+NR+AISVS+DHSIRLWNLMT++ AAV
Sbjct: 181 EDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTLRNAAV 240

Query: 172 LKLRNYSQNGQFVRWIG-NGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETL 230
           LKLR Y+ NG  VRW+G  GDYFAV L ++VLIY+T +AKV  EI   +KT+MH+ET  L
Sbjct: 241 LKLRKYNTNGTCVRWLGAKGDYFAVGLRDRVLIYETGSAKVFKEIVFQRKTLMHIETHIL 300

Query: 231 --DGKIYICVAMSDGNIHFYPTEGLLTEEPKVEE--------------PEFSLLGHSNRV 274
             D K Y+ V +SDGN+HFYP E L     KVEE              P FSLLGH+NR+
Sbjct: 301 PFDNKEYLSVGISDGNVHFYPCEELF---EKVEENEKQEDDDDKEDISPAFSLLGHTNRI 357

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMK 334
           KDFKFY N+FGTY+V+IGSDG++VVWDM  K+++AVYDCGERLNCL + DE++EKY TMK
Sbjct: 358 KDFKFYTNEFGTYLVTIGSDGKIVVWDMSTKEQVAVYDCGERLNCLTLCDESIEKYNTMK 417

Query: 335 KRDSESADLGEQSEVESDTEEL 356
           KRD+E+AD+G+QSEVESDTEEL
Sbjct: 418 KRDAETADIGDQSEVESDTEEL 439

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/364 (71%), Positives = 302/364 (82%), Gaps = 10/364 (2%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60
           M  NQFRIIVGSYEHN+LCLSL+LSL  PLFTPIFHFQAH+LSVKCLD+SKRYLVSGSND
Sbjct: 1   MPDNQFRIIVGSYEHNLLCLSLNLSLTQPLFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120
           E+IRIYDLQKRKELGTLL HQGSITNL+FS+ K  +G  +   NKWLLSASED+KII+WR
Sbjct: 61  ENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQ-DIQLNKWLLSASEDHKIIVWR 119

Query: 121 VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN 180
           VKDWENFGTLKGH ARIND DIHPSNRVA+SVSEDHSIRLWNLMTVKKA VLKLR Y+QN
Sbjct: 120 VKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVKKAGVLKLRKYNQN 179

Query: 181 GQFVRWIG-NGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVA 239
           GQFVRW G NG Y AV LLNK+LI+KT  AKVH EID ++ T+MHLE E +DG+ YI V 
Sbjct: 180 GQFVRWCGENGSYIAVGLLNKLLIFKTETAKVHREIDFSRNTLMHLEREIIDGEEYIVVG 239

Query: 240 MSDGNIHFYPTEGLL-------TEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIG 292
           ++ G + F+    L         E PK+ E EFSLLGHSNRVKDF+FY N FG Y+V+IG
Sbjct: 240 LNSGAVQFWKASKLYEEVPDEEEESPKL-EAEFSLLGHSNRVKDFQFYHNKFGHYLVTIG 298

Query: 293 SDGRVVVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESD 352
           SDGR+VVWDM+ +D++AVYDCGERLNC+AV DE++EKY+T+KKR  E  ++GE S+VE+D
Sbjct: 299 SDGRIVVWDMKTRDQVAVYDCGERLNCVAVCDESIEKYDTVKKRAPEEVEVGEPSDVEAD 358

Query: 353 TEEL 356
            EEL
Sbjct: 359 PEEL 362

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score =  503 bits (1295), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 308/359 (85%), Gaps = 5/359 (1%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60
           M++NQFRI+VGSYEHN+LCLSLDL+L+TP+FTPIFHFQAH+LSVKCLD+SKRYLVSGSND
Sbjct: 1   MSRNQFRIVVGSYEHNLLCLSLDLTLETPVFTPIFHFQAHSLSVKCLDISKRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120
           EHIRIYDLQKRKELGTLLAHQGSITNLKF  SK  + + + ++ KWLLSASEDNKII+WR
Sbjct: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKF--SKVSDQEPKSTSGKWLLSASEDNKIIVWR 118

Query: 121 VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN 180
           VKDWENFGTLKGH ARIND+DIHPSNRV  SVSEDHSIRLWNLMTVKKAAVLKL+ Y+QN
Sbjct: 119 VKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMTVKKAAVLKLKKYNQN 178

Query: 181 GQFVRWI-GNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVA 239
           GQFVRW+   G YFAV+L+ KVLIY +  AKV+ EID  +KTIMH+ET  L    YI + 
Sbjct: 179 GQFVRWLKAQGKYFAVSLMTKVLIYDSTTAKVYREIDTGRKTIMHMETVVLADVEYIVLG 238

Query: 240 MSDGNIHFYPTEGLLTEE--PKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRV 297
           MSDG + FY  E +L  +     EEPEFSLLGH+NRVKD KFY N+FGTYMV+IGSDG+V
Sbjct: 239 MSDGKVLFYKVEEILNSKETEFTEEPEFSLLGHTNRVKDLKFYVNEFGTYMVTIGSDGKV 298

Query: 298 VVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESDTEEL 356
           +VWDM+K+D++AVYDCGERLNCLAV DET+EK +TMKKR  +  +LGEQSEVESDTEEL
Sbjct: 299 IVWDMDKRDQVAVYDCGERLNCLAVCDETIEKADTMKKRTIDQIELGEQSEVESDTEEL 357

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score =  486 bits (1251), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 255/359 (71%), Positives = 298/359 (83%), Gaps = 5/359 (1%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSND 60
           MA NQFRI+VGSYEHN+LCLSL+L L+TPLFTPIFHFQAHALSVK LD+S+RYLVSGSND
Sbjct: 1   MAGNQFRIVVGSYEHNLLCLSLNLELETPLFTPIFHFQAHALSVKTLDISRRYLVSGSND 60

Query: 61  EHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120
           EHIRIYDLQKRKELGTLL H GSIT+L+FS++ T+  DG+   NKWLLSASED+ IIIWR
Sbjct: 61  EHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDK-DGKQQGNKWLLSASEDHTIIIWR 119

Query: 121 VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQN 180
           VKDWENFG LKGH ARIND+DIHPSNRVA SVSEDHSIRLWNLMT KKAAVLKL+ Y+QN
Sbjct: 120 VKDWENFGKLKGHNARINDLDIHPSNRVA-SVSEDHSIRLWNLMTAKKAAVLKLKKYNQN 178

Query: 181 GQFVRWIG-NGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVA 239
           G++VRW G +  +FAV L+ KVLIY  A AKVH EI    KTIMH+E E +D K YICV 
Sbjct: 179 GKYVRWCGKDAGFFAVGLVTKVLIYNAATAKVHHEISTGNKTIMHMEVEHIDEKEYICVG 238

Query: 240 MSDGNIHFYPTEGLL--TEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRV 297
           +S G+I FY  E L   +E+ K  EP FSL GH+NRVKDF+FYKN  G Y+VS GSDG++
Sbjct: 239 LSTGSIQFYDAEKLYEESEDQKAAEPAFSLQGHTNRVKDFRFYKNSMGHYLVSAGSDGKI 298

Query: 298 VVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKRDSESADLGEQSEVESDTEEL 356
           VVWD+ K+++LAVYDCGERLNCLAV DE+VEKY+T+ KR + +AD+ +QSEVE D EEL
Sbjct: 299 VVWDIVKQEQLAVYDCGERLNCLAVCDESVEKYDTVLKRTAATADIEDQSEVEEDAEEL 357

>Scas_631.17
          Length = 474

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query: 34  IFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           I + Q HA  +  +D S    ++ +G  D  I I+D++K  E   LLAH   +T ++F K
Sbjct: 352 IMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQK 411

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
           S              L+S   D +I I+   +W    TL+GH  +I DVDI    ++ +S
Sbjct: 412 S----------TGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVS 461

Query: 152 VSEDHSIRLW 161
              D S++LW
Sbjct: 462 SGWDRSLKLW 471

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 109/265 (41%), Gaps = 28/265 (10%)

Query: 41  ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKEL-GTLLAHQGSITNLKFSKSKTENGDG 99
            +S  CL        +GS    I+I D +    + G    H G I  L ++ + T    G
Sbjct: 188 PISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSG 247

Query: 100 EGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIR 159
                  + S   D KII       +    L+GH  R+ +VD HPS R   S S D + R
Sbjct: 248 ADDCLVKIHSFDPDVKII-------KELTALQGHTGRVVNVDFHPSGRFVASASFDMTWR 300

Query: 160 LWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAV----ALLNKVLIYKTAAAKVHCEI 215
           LW++      +  +L+    +G+ V  +   +  A+     L N  +++     K    +
Sbjct: 301 LWDI-----ESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNL 355

Query: 216 DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVK 275
             + K I  ++  + DG  +I     DG I+ +      TE  +       LL H+N V 
Sbjct: 356 QGHAKPIYSVDW-SPDG-YHIATGGGDGVINIWDIRK-TTETTR-------LLAHNNIVT 405

Query: 276 DFKFYKNDFGTYMVSIGSDGRVVVW 300
             +F K+  G  +VS G D ++ ++
Sbjct: 406 GVRFQKS-TGHCLVSCGYDKQIRIY 429

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 72/157 (45%), Gaps = 22/157 (14%)

Query: 27  KTPLFTPIFH--------FQAHALSVKCL---DVSKRYLVSGSNDEHIRIYDLQKRKELG 75
           KT  + P +H           H   V+C+    V   +  +GSND  I+I+DL   K   
Sbjct: 100 KTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKI 159

Query: 76  TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
           TL+ H  S+ ++  SK            + ++ SASED  +  W ++         GH++
Sbjct: 160 TLIGHVMSVRDIAISK-----------RHPYMFSASEDKLVKCWDLERNTAIRDFHGHLS 208

Query: 136 RINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
            ++ VD+HPS  +  +   D  +RLW++ +  +  VL
Sbjct: 209 GVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVL 245

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 89/212 (41%), Gaps = 17/212 (8%)

Query: 39  AHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H +SV+ + +SKR  Y+ S S D+ ++ +DL++   +     H   +  +    S    
Sbjct: 163 GHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDI- 221

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                     + +A  D  + +W ++       L GH + IN V   P +   IS S D 
Sbjct: 222 ----------IATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDA 271

Query: 157 SIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEID 216
           ++RLW+++  K + VL   ++S+N + +        FA    N V  +K    ++     
Sbjct: 272 TVRLWDIIAGKASKVLT--HHSRNIRDLTLHPAEFSFASVSTNDVRSWKLPEGQLLTNFQ 329

Query: 217 MNKKTIMHLETETLDGKIYICVAMSDGNIHFY 248
                I  L T +++    +     DG + FY
Sbjct: 330 SQNTGI--LNTVSINHDNVLLAGGDDGTLCFY 359

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 121/273 (44%), Gaps = 40/273 (14%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKE--LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           KRYL +  +  H+R+YD++      + +   H+G++T++ F +           +NKW++
Sbjct: 44  KRYLAAAGH-LHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQ-----------DNKWMV 91

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL----- 163
           S+SED  I +W V+        K H A +N+V IHP+    IS  +D +I++W+L     
Sbjct: 92  SSSEDGTIKVWDVRSPSVQRNYK-HDAPVNEVVIHPNQGELISCDQDGNIKIWDLGENQC 150

Query: 164 ---MTVKKAAVLKLRNYSQNGQFVRWIGN--GDYFAVALLNKVLIYKTAAAKVHCEIDMN 218
              + ++    L+  + + +G  +   GN  G+ +   + N      TA+ K   +   +
Sbjct: 151 TNQLALEDNTALQSLSIASDGSMLV-AGNNKGNCYVWKMPNHT---DTASLKPVTKFRSH 206

Query: 219 KKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFK 278
            K I  +        +  C A  D     +  E          + E +L  HS  V D  
Sbjct: 207 SKYITRVLLSVDVKHLATCSA--DHTARVWSVEDNF-------QLETTLDAHSRWVWDCA 257

Query: 279 FYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
           F  +    Y+V+  SD  V +WD+  ++ +  Y
Sbjct: 258 FSAD--SAYLVTACSDHYVRLWDLSTREIVRQY 288

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 220 KTIMHLET-----ETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRV 274
           +TI H ++     E    K Y+  A   G++H    + + T  P    P  S  GH   V
Sbjct: 26  RTIQHADSQVNRLEITSDKRYLAAA---GHLHVRMYD-IRTTNPN---PVTSFEGHRGNV 78

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVVWDME 303
               F +++   +MVS   DG + VWD+ 
Sbjct: 79  TSIAFQQDN--KWMVSSSEDGTIKVWDVR 105

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 104/232 (44%), Gaps = 26/232 (11%)

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIN 138
           AH+G I  L +             +   LLS   DN + +W +    +F  L+GH  R++
Sbjct: 213 AHEGKIGGLDWH-----------PDGNHLLSGGGDNLVKLWDMTS-NSFEELRGHAGRVS 260

Query: 139 DVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALL 198
            V +HPS R+A S S D +  LW+L   +K  +     +S+    + +  +G   A A L
Sbjct: 261 RVKVHPSGRLAASASFDLTWILWDLE--RKVELQLQEGHSKAVYTIAFQSDGALLASAGL 318

Query: 199 NKVL-IYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEE 257
           + V  I+   + +   +++ +   I  ++         +  A +DG +  +    + TE 
Sbjct: 319 DAVCAIWDLRSGEPIMKLEGHAGAISGVDWSP--NGYQLATAGADGTVRVWDIRNVGTES 376

Query: 258 PKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELA 309
                   +LL H     D KF KN+ GT++VS G D  V +++ +   +LA
Sbjct: 377 --------ALLAHQVAALDVKFKKNN-GTFLVSCGHDRLVNIFNADNWQKLA 419

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 61/131 (46%), Gaps = 12/131 (9%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI   + HA ++  +D S     L +   D  +R++D++       LLAHQ +  ++KF 
Sbjct: 332 PIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFK 391

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
           K+          N  +L+S   D  + I+   +W+   +L+GH  R+  VDI        
Sbjct: 392 KN----------NGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIY 441

Query: 151 SVSEDHSIRLW 161
           S  +D S++ W
Sbjct: 442 SGGKDRSLKQW 452

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 120/277 (43%), Gaps = 48/277 (17%)

Query: 51  KRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           KR+L +  +  H+R+YD++      + +   H+G++T++ F +           +NKW++
Sbjct: 44  KRFLAAAGH-LHVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQ-----------DNKWMV 91

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL----- 163
           S+SED  I +W V+        K H A +N+V IHP+    IS  +D +IR+W+L     
Sbjct: 92  SSSEDGTIKVWDVRAPSVQRNYKHH-APVNEVVIHPNQGELISCDQDGNIRIWDLGENQC 150

Query: 164 ---MTVKKAAVLKLRNYSQNGQFVRWIGN--GDYFAVALLNKVLIYKTAAAKVHCEIDMN 218
              +T +    L+  + + +G  +   GN  G+ +   + N      T AA        N
Sbjct: 151 THQLTPEDDTPLQSLSIASDGSMLV-AGNNKGNCYVWQMPN-----HTDAA--------N 196

Query: 219 KKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEF----SLLGHSNRV 274
            K +    + T   K    V +S    H        T      E  F    +L GH   V
Sbjct: 197 LKPVTKFRSHT---KYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLDGHQRWV 253

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
            D  F  +    Y+V+  SD  V +WD+  ++ +  Y
Sbjct: 254 WDCAFSAD--SAYLVTACSDHYVRLWDLSTREIVRQY 288

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 67/172 (38%), Gaps = 25/172 (14%)

Query: 3   KNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEH 62
            NQ  +I    + NI    L  +  T   TP       +LS+         LV+G+N  +
Sbjct: 126 PNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIAS---DGSMLVAGNNKGN 182

Query: 63  IRIYDLQKRKELGTL------LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKI 116
             ++ +    +   L       +H   IT +  S           S+ K L + S D+  
Sbjct: 183 CYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLS-----------SDVKHLATCSADHTA 231

Query: 117 IIWRVKDWENF---GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            +W ++D  NF    TL GH   + D      +   ++   DH +RLW+L T
Sbjct: 232 RVWSIED--NFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281

>Kwal_23.5035
          Length = 744

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V CL     Y+++G++D+ IR+YD +  K +  L  H G +  LK+        DG    
Sbjct: 373 VTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGH------DG---- 422

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HPSNRVAISVSEDHSIRLW 161
              L+S S D  + +W +K  +     KGH + +  +DI  H   +  ++ S DH++ +W
Sbjct: 423 --ILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVW 480

Query: 162 NL 163
            L
Sbjct: 481 KL 482

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 37/156 (23%)

Query: 37  FQAHALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKE------------------- 73
           F+ H  +V+CLD+     K+++V+GS D  + ++ L                        
Sbjct: 447 FKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPY 506

Query: 74  -LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKG 132
            +G L  H  ++        +T +G G       ++S S D  +++W +   +    L G
Sbjct: 507 FVGVLRGHMAAV--------RTVSGHG-----NIVVSGSYDFNLMVWDIAQMKCLYVLTG 553

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKK 168
           H  RI            IS   D ++++W+L  V K
Sbjct: 554 HTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSK 589

>Scas_624.11
          Length = 1205

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 13/139 (9%)

Query: 32  TPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T +  F+ H   V+ +D   ++   VSG +D  I+++ L+  K L TL  H   I  + F
Sbjct: 44  TLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFF 103

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
            K              W++SAS+D  I IW  ++ +    L GH   +     HP++ + 
Sbjct: 104 HKEL-----------PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLV 152

Query: 150 ISVSEDHSIRLWNLMTVKK 168
           +S S D +IR+W++  ++K
Sbjct: 153 VSASLDETIRVWDISGLRK 171

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (48%), Gaps = 27/134 (20%)

Query: 54  LVSGSNDEHIRIYDL----QKRKELGT-----LLAHQGSITNLKFSKSKTE---NGDGEG 101
           +VS S DE IR++D+    +K    GT      +A Q ++ +  F     +    G   G
Sbjct: 152 VVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRG 211

Query: 102 SNNKW---------LLSASEDNKIIIWR---VKDWENFGTLKGHIARINDVDIHPSNRVA 149
            N  W         ++S S+D ++ +W+    K WE   T +GH   ++ V  HP+ +  
Sbjct: 212 VN--WASFHPTLPMIVSGSDDRQVKLWKYNSTKAWE-VDTCRGHTNNVDCVIFHPTQKFI 268

Query: 150 ISVSEDHSIRLWNL 163
           +SV ED ++R+W+L
Sbjct: 269 LSVGEDKTLRIWDL 282

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 116/275 (42%), Gaps = 56/275 (20%)

Query: 63  IRIYDLQKRKELGTLLA----HQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           I+++D +    +GTLL     H+G + ++ F  ++              +S  +D  I +
Sbjct: 35  IQLWDYR----MGTLLHRFEDHEGPVRSVDFHPTQ-----------PIFVSGGDDYTIKV 79

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRN-Y 177
           W ++  +   TL GH+  I  V  H      IS S+D +IR+WN    K+ A L   N +
Sbjct: 80  WSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHF 139

Query: 178 SQNGQFVRWIGNGDYFAVALLNKVL-------IYKTAAAKVHCEIDMNKKTIMHLETETL 230
               QF       D    A L++ +       + K  +A      D      M  +   L
Sbjct: 140 VMCAQFH---PTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQ----MAAQQNLL 192

Query: 231 DGKIYICVA--MSDGNIH------FYPTEGLL---TEEPKVEEPEF---------SLLGH 270
           DG    CV   + +G+        F+PT  ++   +++ +V+  ++         +  GH
Sbjct: 193 DGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGH 252

Query: 271 SNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKK 305
           +N V    F+      +++S+G D  + +WD++K+
Sbjct: 253 TNNVDCVIFHPTQ--KFILSVGEDKTLRIWDLDKR 285

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS    G     +  W+L A   + I +W  +        + H   +  VD HP+  + 
Sbjct: 9   SKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIF 68

Query: 150 ISVSEDHSIRLWNLMTVK 167
           +S  +D++I++W+L T K
Sbjct: 69  VSGGDDYTIKVWSLETNK 86

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 116/275 (42%), Gaps = 49/275 (17%)

Query: 54  LVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           L++ +  ++IR+YD++      + +   H+G++T++ F +           +NKW++++S
Sbjct: 46  LLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQ-----------DNKWMVTSS 94

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL-------- 163
           ED  I +W ++        K H A +N+V IHP+    IS   D +IR+W+L        
Sbjct: 95  EDGTIKVWDIRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ 153

Query: 164 MTVKKAAVLKLRNYSQNGQFVRWIGN-GDYFAVALLNKV------LIYKTAAAKVHCEID 216
           +T +    L+  + + +G  +    N G+ +   + N           K  A   +    
Sbjct: 154 LTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRV 213

Query: 217 MNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKD 276
           +    + H+ T + D    I     + N+                  E +L GH   V D
Sbjct: 214 LLSSDVKHMATCSADHTARIWSVEDNFNL------------------ESTLDGHQRWVWD 255

Query: 277 FKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
             F  +    Y+V+  SD  V +WD+  +D +  Y
Sbjct: 256 CAFSAD--SAYLVTASSDHYVRLWDLSTRDIIRQY 288

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 68/172 (39%), Gaps = 25/172 (14%)

Query: 3   KNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEH 62
            NQ  +I    + NI    L  +  T   TP       +LSV         LV+ +N  +
Sbjct: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVAS---DGSMLVAANNKGN 182

Query: 63  IRIYDLQKRKELGTLL------AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKI 116
             ++++    +   L       AH   IT +  S           S+ K + + S D+  
Sbjct: 183 CYVWEMPNHTDASNLKPATKFKAHPSYITRVLLS-----------SDVKHMATCSADHTA 231

Query: 117 IIWRVKDWENF---GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            IW V+D  NF    TL GH   + D      +   ++ S DH +RLW+L T
Sbjct: 232 RIWSVED--NFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 15/115 (13%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKE--LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           K+YL +  +  H+R+YD++      + +   H+G++T++ F +            N+W++
Sbjct: 44  KKYLAAAGH-LHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQE-----------NRWMV 91

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           S+SED  I +W V+        K H A +N+V IHP+    IS  +D +IR+W+L
Sbjct: 92  SSSEDGTIKVWDVRSPSVQRNYK-HNAPVNEVAIHPNQGELISCDQDGNIRIWDL 145

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 69/172 (40%), Gaps = 25/172 (14%)

Query: 3   KNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEH 62
            NQ  +I    + NI    L  +  T   TP  +    +LSV         LV+G+N  +
Sbjct: 126 PNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVAS---DGSMLVAGNNKGN 182

Query: 63  IRIYDLQKRKELGTL------LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKI 116
             ++ +    +  TL       +H   IT +  S           ++ K L + S D+  
Sbjct: 183 CYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLS-----------ADVKHLATCSADHTA 231

Query: 117 IIWRVKDWENF---GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            +W ++D  NF    TL GH   + D      +   ++   DH +RLW+L T
Sbjct: 232 RVWNIED--NFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST 281

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 34/93 (36%), Gaps = 2/93 (2%)

Query: 263 PEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAV 322
           P  S  GH   V    F + +   +MVS   DG + VWD+        Y     +N +A+
Sbjct: 67  PVSSFEGHKGNVTSIAFQQEN--RWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAI 124

Query: 323 VDETVEKYETMKKRDSESADLGEQSEVESDTEE 355
                E     +  +    DLGE       T E
Sbjct: 125 HPNQGELISCDQDGNIRIWDLGENQCTNQLTPE 157

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 109/269 (40%), Gaps = 51/269 (18%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN-FG----T 129
           GTL  H G +T+L  S ++             L+S S D  +I WR+ + E  FG    +
Sbjct: 12  GTLEGHNGWVTSLSTSAAQP----------NLLVSGSRDKTLISWRLTENEQQFGVPVRS 61

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL----------------- 172
            KGH   + DV +      A+S S D ++RLWNL T    A                   
Sbjct: 62  YKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSS 121

Query: 173 KLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDG 232
           K+ + S++     W   GD   V L +   + K   A  + E           + E  DG
Sbjct: 122 KIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLE-----------DGEVDDG 170

Query: 233 KIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIG 292
           +I    A  D  +  +     L E+    E +F  +GH+N +   +   +  G+   S G
Sbjct: 171 RITFVSAGMDKIVRSWS----LNEDSYRIEADF--IGHNNYINVVQPSPD--GSLAASAG 222

Query: 293 SDGRVVVWDMEKKDELAVYDCGERLNCLA 321
            DG++ VW+++ K     +D  + +  LA
Sbjct: 223 KDGQIYVWNLKHKSAFMNFDAKDEVFALA 251

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 68/159 (42%), Gaps = 28/159 (17%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I  F+ H   V  L ++ + L++GS D  + I+DL   K +  L  H   +  L+F   K
Sbjct: 252 IQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK 311

Query: 94  TENGDGEGSNNKW---------------------------LLSASEDNKIIIWRVKDWEN 126
              G  + +   W                           ++S S D  + +W V+    
Sbjct: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC 371

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + TL+GH   +N V +HP +    S S+D +IR+W++ T
Sbjct: 372 Y-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 59/161 (36%), Gaps = 30/161 (18%)

Query: 35  FHFQAHALSVKCLDVSKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSITNL----- 87
           +  + H   V C+ +  +     SGS+D  IR++D++    +     H G +  +     
Sbjct: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL 431

Query: 88  ---------------------KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN 126
                                     +  N D        LLS S DN I +W VK    
Sbjct: 432 GSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC 491

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
             T  GH+  +   DI   N   +S S D S ++W+L T K
Sbjct: 492 IRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTGK 530

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 18/146 (12%)

Query: 27  KTPLFTPIFHF----QAHALSVKCLDVSK---RYLVSGSNDEHIRIYDLQKRKELGTLLA 79
           +TP +   +H       H   V+C+ + K    +  +GSND+ I+I++L   K   TL A
Sbjct: 97  QTPRWHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKA 156

Query: 80  HQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND 139
           H  ++ +L  S           + + ++ S SED  +  W ++         GH++ ++ 
Sbjct: 157 HDMTVRDLAIS-----------NRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHT 205

Query: 140 VDIHPSNRVAISVSEDHSIRLWNLMT 165
           VDIHP+  V ++   D  +++W++ T
Sbjct: 206 VDIHPTVDVVVTAGRDSVVKVWDIRT 231

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 13/138 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
            +AH ++V+ L +S R  Y+ S S D+ ++ +DL+K   +     H   +  +    +  
Sbjct: 154 LKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVD 213

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                       +++A  D+ + +W ++      TL GH   I  V   P +   IS S 
Sbjct: 214 V-----------VVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSV 262

Query: 155 DHSIRLWNLMTVKKAAVL 172
           D SIRLW+L+  K   VL
Sbjct: 263 DASIRLWDLVAGKSMKVL 280

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 61/134 (45%), Gaps = 14/134 (10%)

Query: 32  TPIFHFQAHALSVKCLDVSKRY--LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T I ++  H   V  +D+      +V+   D  ++++D++ R  + TL  H+G IT ++ 
Sbjct: 191 TAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRC 250

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
                +           ++S+S D  I +W +   ++   L  H   + D+ +HPS   +
Sbjct: 251 LPVDPQ-----------VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPS-EFS 298

Query: 150 ISVSEDHSIRLWNL 163
            + +  + IR W L
Sbjct: 299 FASACTNDIRSWLL 312

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           +N+W  + S D  I IW +   +   TLK H   + D+ I   +    SVSED +++ W+
Sbjct: 127 DNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWD 186

Query: 163 LMTVKKAAVLKLRNY 177
           L   K  A+   RNY
Sbjct: 187 LE--KNTAI---RNY 196

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 39  AHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGD 98
           + +L +   D S   +V G +   I +YD +   +L  + AH   +T +K   S      
Sbjct: 99  SESLDLISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPS------ 152

Query: 99  GEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158
                N  LLS S D ++ +W ++D  N  TLKGH A I D  I    R  +S S D S+
Sbjct: 153 -----NAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSV 207

Query: 159 RLWNLMTVK 167
           RLW L + K
Sbjct: 208 RLWELGSGK 216

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLK 173
           +  H++ +  V I PSN V +S S D  +++W+L        LK
Sbjct: 137 VGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLK 180

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 54  LVSGSNDEHIRIYDLQKRKE--LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + +G  D  I ++D++KR E  L  +LAH+  +T ++FSK   E+G       K L+S  
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSK---EDG------GKKLVSCG 414

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
            DN I ++    W   G+L GH  +I  +DI  ++   +S   D SI+LWN
Sbjct: 415 YDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWEN----FGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
           SNN+ ++S +ED  I  ++  + E      G L GH  RI+DV  HPS +   S S D +
Sbjct: 230 SNNQ-MISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMT 288

Query: 158 IRLWNLMTVKKAAVLKLRNYSQNGQF-VRWIGNGDYFAVALLNKV-LIYKTAAAKVHCEI 215
            RLW+  T ++   L L+     G F + +  +G       ++ + +++   +      +
Sbjct: 289 WRLWDASTHQE---LLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTL 345

Query: 216 DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFS-LLGHSNRV 274
             + K I  +          +     DG I+ +          K +E + + +L H N V
Sbjct: 346 AGHSKPIYTVAWSP--NGYQVATGGGDGIINVWDIR-------KRDEGQLNQILAHRNIV 396

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVVW 300
              +F K D G  +VS G D  + V+
Sbjct: 397 TQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 24/186 (12%)

Query: 130 LKGHIARINDVDIHP-SNRVAISVSEDHSIRLWNLMTVKKAAVLKLRN----YSQNGQFV 184
           L  H+ +I  +D HP SN   IS +ED  I+  N     +   L+L      + +    V
Sbjct: 214 LDSHVGKIGAIDWHPDSNNQMISCAEDGLIK--NFQYSNEEGGLRLLGDLVGHERRISDV 271

Query: 185 RWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNK---KTIMHLETETLDGKIYICVAMS 241
           ++  +G +   A  +  + ++   A  H E+ + +   K +  L  +  DG +     M 
Sbjct: 272 KYHPSGKFIGSA--SHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQC-DGSLVCSGGMD 328

Query: 242 DGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
             ++ +    G      KV     +L GHS  +    +  N  G  + + G DG + VWD
Sbjct: 329 SLSMLWDIRSG-----SKV----MTLAGHSKPIYTVAWSPN--GYQVATGGGDGIINVWD 377

Query: 302 MEKKDE 307
           + K+DE
Sbjct: 378 IRKRDE 383

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 91/232 (39%), Gaps = 28/232 (12%)

Query: 74  LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGH 133
           LG L+ H+  I+++K+  S            K++ SAS D    +W     +     +GH
Sbjct: 258 LGDLVGHERRISDVKYHPS-----------GKFIGSASHDMTWRLWDASTHQELLLQEGH 306

Query: 134 IARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYF 193
              +  +       +  S   D    LW++ +  K  V+ L  +S+    V W  NG   
Sbjct: 307 DKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK--VMTLAGHSKPIYTVAWSPNGYQV 364

Query: 194 AV----ALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYP 249
           A      ++N   I K    +++ +I  ++  +  +     DG   +     D  I+ Y 
Sbjct: 365 ATGGGDGIINVWDIRKRDEGQLN-QILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS 423

Query: 250 TEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           ++  L           SL GH++++       N    ++VS G D  + +W+
Sbjct: 424 SDTWLKMG--------SLAGHTDKIISLDISNNSH--FLVSGGWDRSIKLWN 465

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 45/114 (39%), Gaps = 11/114 (9%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
           S +++ S S+D   R++D    +EL     H   + +L F             +   + S
Sbjct: 276 SGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQ-----------CDGSLVCS 324

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
              D+  ++W ++      TL GH   I  V   P+     +   D  I +W++
Sbjct: 325 GGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDI 378

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 66/136 (48%), Gaps = 12/136 (8%)

Query: 33  PIFHFQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
            +   Q HA ++ C+D  +    L +G  D  I I+DL+K  +L  +  H+  +T+LKF 
Sbjct: 374 AVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFD 433

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
           K+   N          L+S+  D  I ++   ++    +L GH  ++   DI  +N+  I
Sbjct: 434 KANDHN----------LISSGYDRSIFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLI 483

Query: 151 SVSEDHSIRLWNLMTV 166
           S   D S++ W+ ++ 
Sbjct: 484 SGGWDRSVKHWSTVST 499

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 112/252 (44%), Gaps = 29/252 (11%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           Y+ SGS +  + I D    +   TL  H G +  + ++           SN+  L++  E
Sbjct: 226 YVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWT-----------SNDSVLITGGE 274

Query: 113 DNKIIIWRVKDWE--NFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAA 170
           D+ I +    D E     ++ GH  RI D+ +HPS +   + S D + RLW++   K+  
Sbjct: 275 DHLITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIE--KQKQ 332

Query: 171 VLKLRNYSQNGQFVRWIGNGDYFAVALLNK-VLIYKTAAAKVHCEIDMNKKTIMHLETET 229
           +L    +S+    + +  +G   + A  +K  +I+   + K   ++  + KTI  ++  +
Sbjct: 333 LLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDW-S 391

Query: 230 LDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYK-NDFGTYM 288
           +DG   +     DG I  +     L +  K+ +    +  H + V   KF K ND    +
Sbjct: 392 IDGHT-LATGGGDGVITIWD----LRKSDKLTK----ITEHKSIVTSLKFDKANDHN--L 440

Query: 289 VSIGSDGRVVVW 300
           +S G D  + V+
Sbjct: 441 ISSGYDRSIFVY 452

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 30  LFTP--IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL 87
           LFT   I     H+  VK L    R L++GS D+ IR+++    + + T   H  S+ ++
Sbjct: 329 LFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

Query: 88  KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
                         S  K ++S S D  + +W V+    + TL+GH   +N V +HP + 
Sbjct: 389 D-------------SYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSF 434

Query: 148 VAISVSEDHSIRLWNLMT 165
              S S+D +IR+W++ T
Sbjct: 435 SCFSCSDDTTIRMWDIRT 452

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 2/88 (2%)

Query: 107 LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTV 166
           LLS   DN I +W VK  +   T  GH+  +   DI   N   IS S D SI++W+L + 
Sbjct: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSG 582

Query: 167 KKAAVLKLRNYSQNGQFVRWIGNGDYFA 194
           K       R   +  Q  +    GD  A
Sbjct: 583 KCMHTFNGRRLQRETQHTQTQSLGDKVA 610

 Score = 35.0 bits (79), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I  ++ H+ SV  +D  ++ +VSGS D+ ++++ ++ R    TL  H   +  +K     
Sbjct: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKS 433

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140
                          S S+D  I +W ++        +GH+ ++  +
Sbjct: 434 FS-----------CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 13/139 (9%)

Query: 32  TPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T +  F+ H   V+ LD   ++   VS  +D  I+++ L   K L TL  H   +  + F
Sbjct: 44  TLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFF 103

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
            +              W++SAS+D  I IW  ++ +    L GH   +     HP++ + 
Sbjct: 104 HREL-----------PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLI 152

Query: 150 ISVSEDHSIRLWNLMTVKK 168
           +S S D +IR+W++  ++K
Sbjct: 153 VSASLDETIRIWDISGLRK 171

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 116/271 (42%), Gaps = 48/271 (17%)

Query: 63  IRIYDLQKRKELGTLLA----HQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           I+++D +    +GTLL     H+G +  L F  ++              +SA +D  I +
Sbjct: 35  IQLWDYR----MGTLLHRFEDHEGPVRGLDFHPTQ-----------PIFVSAGDDYTIKV 79

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRN-Y 177
           W +   +   TL GH+  +  V  H      IS S+D +IR+WN    K+ A L   N +
Sbjct: 80  WSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHF 139

Query: 178 SQNGQFVRWIGNGDYFAVALLNKVL-IYKTAA-AKVHCEIDMNK-KTIMHLETETLDGKI 234
               QF       D    A L++ + I+  +   K H     +  +  M  +   LDG +
Sbjct: 140 VMCAQFH---PTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSL 196

Query: 235 YICVA--MSDGNIH------FYPTEGLL---TEEPKVEEPEFSLL---------GHSNRV 274
             CV   + +G+        F+PT  L+   +++ +V+    S           GH+N V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVVWDMEKK 305
               F+ +     ++S+G D  + VWD++K+
Sbjct: 257 DSVIFHPHQ--NLIISVGEDKTLRVWDLDKR 285

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 23/132 (17%)

Query: 54  LVSGSNDEHIRIYD---LQKRKEL-GT------LLAHQ----GSITN--LKFSKSKTENG 97
           +VS S DE IRI+D   L+KR    GT      + A Q    GS+ +  +KF       G
Sbjct: 152 IVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRG 211

Query: 98  DGEGSNNKWL---LSASEDNKIIIWRV---KDWENFGTLKGHIARINDVDIHPSNRVAIS 151
               S +  L   +S S+D ++ +WR+   K WE   T +GH   ++ V  HP   + IS
Sbjct: 212 VNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPHQNLIIS 270

Query: 152 VSEDHSIRLWNL 163
           V ED ++R+W+L
Sbjct: 271 VGEDKTLRVWDL 282

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS    G     +  W+L A   + I +W  +        + H   +  +D HP+  + 
Sbjct: 9   SKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIF 68

Query: 150 ISVSEDHSIRLWNLMTVK 167
           +S  +D++I++W+L T K
Sbjct: 69  VSAGDDYTIKVWSLDTNK 86

>Kwal_56.24526
          Length = 1210

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 67/139 (48%), Gaps = 13/139 (9%)

Query: 32  TPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T +  F+ H   V+ +D   ++   VS  +D  I+++ L  +K L TL  H   +  + F
Sbjct: 44  TLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFF 103

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
            +              W++SAS+D  I IW  ++ +    L GH   +   D HP+  + 
Sbjct: 104 HREL-----------PWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLV 152

Query: 150 ISVSEDHSIRLWNLMTVKK 168
           +S S D ++R+W++  ++K
Sbjct: 153 VSASLDETVRVWDISGLRK 171

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 97/216 (44%), Gaps = 31/216 (14%)

Query: 39  AHALSVKCLDV--SKRYLVSGSNDEHIRIYD---LQKRKE------LGTLLAHQGSITNL 87
            H   V C D   ++  +VS S DE +R++D   L+KR        L   +A Q ++ + 
Sbjct: 135 GHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDG 194

Query: 88  KFSKSKTE---NGDGEGSNNKW---------LLSASEDNKIIIWRV---KDWENFGTLKG 132
            F     +    G   G N  W         ++S  +D ++ +WR+   K WE   T +G
Sbjct: 195 GFGDCVVKFILEGHSRGVN--WASFHPTLPLIVSGGDDRQVKLWRMSSTKAWE-VDTCRG 251

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDY 192
           H   ++ V  HP   + ISV ED ++R+W+L   K+  V + +  +     VR   N + 
Sbjct: 252 HTNNVDSVIFHPHQNLIISVGEDKTVRVWDLD--KRTPVKQFKRENDRFWLVRAHPNINL 309

Query: 193 FAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETE 228
           F  A  + ++++K    +    I+ N+   ++ E +
Sbjct: 310 FGAAHDSGIMVFKLDRERPCSVINQNQLIFVNKEKQ 345

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 115/291 (39%), Gaps = 62/291 (21%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLA----HQGSITNLKFSKSKTENGDGEGSNNK 105
           S+ +++       I+++D +    +GTLL     H+G +  + F  ++            
Sbjct: 22  SRPWVLVALFSSSIQLWDYR----MGTLLHKFEDHEGPVRGIDFHPTQ-----------P 66

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
             +SA +D  I +W +   +   TL GH+  +  V  H      IS S+D +IR+WN   
Sbjct: 67  LFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN 126

Query: 166 VKKAAVLKLRNYSQNGQFVR---WIGNGDYFAVALLNKV--------LIYKTAAAKVHCE 214
            K+ A L   N+     FV    +    D    A L++         L  + +A   +  
Sbjct: 127 RKEIACLTGHNH-----FVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTL 181

Query: 215 IDMNKKTIMHLETETLDGKIYICVA--MSDGN------IHFYPTEGLLTEEPKVEEPEF- 265
            D      +  +   LDG    CV   + +G+        F+PT  L+       + +  
Sbjct: 182 EDQ-----IAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLW 236

Query: 266 -----------SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKK 305
                      +  GH+N V    F+ +     ++S+G D  V VWD++K+
Sbjct: 237 RMSSTKAWEVDTCRGHTNNVDSVIFHPHQ--NLIISVGEDKTVRVWDLDKR 285

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS    G     +  W+L A   + I +W  +        + H   +  +D HP+  + 
Sbjct: 9   SKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLF 68

Query: 150 ISVSEDHSIRLWNLMTVK 167
           +S  +D++I++W+L T K
Sbjct: 69  VSAGDDYTIKVWSLDTKK 86

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 122/312 (39%), Gaps = 55/312 (17%)

Query: 29  PLFTPI-FHFQAHALSV-KCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN 86
           P F P     + H  SV  CL     Y+++G++D+ IRIYD   +K L  L  H G +  
Sbjct: 355 PDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWA 414

Query: 87  LKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HP 144
           LK+            + N  L+S S D  + IW +   +     KGH + +  +DI  H 
Sbjct: 415 LKY------------AGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHE 462

Query: 145 SNRVAISVSEDHSIRLWNLMTVKKAAVLK-LRN-YSQNGQ-FVRWIGNGDYFAVALLNKV 201
             +  ++ S D+++ +W L  +  + + + + N YS NG  F        YF   L   +
Sbjct: 463 GVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHI 522

Query: 202 LIYKTAAAK--------------VHCEIDMNKKTIMHLETETLDGKIY-----ICVAMS- 241
              +T +                V   I M    I+   T+ +   IY      C++ S 
Sbjct: 523 ASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASM 582

Query: 242 DGNIHFYPTEGL------------LTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMV 289
           D  I  +  + +                 K+  P  +L GH+  V   K        ++V
Sbjct: 583 DSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVGLLKLSDK----FLV 638

Query: 290 SIGSDGRVVVWD 301
           S  +DG +  WD
Sbjct: 639 SAAADGSLRGWD 650

>Scas_704.40
          Length = 608

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 28/156 (17%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
           F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F ++K   
Sbjct: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVT 308

Query: 97  GDGEGSNNKW---------------------------LLSASEDNKIIIWRVKDWENFGT 129
           G  + +   W                           ++S S D  + IW V+    + T
Sbjct: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY-T 367

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           L+GH   +N V +HP +    S S+D +IR+W++ T
Sbjct: 368 LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKS 92
           I  ++ H  SV  +D  K+ +VSGS D+ ++I+ ++ R    TL  H   +  +K   KS
Sbjct: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKS 384

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140
            T              S S+D  I +W ++        +GH+ ++  V
Sbjct: 385 FT------------CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 65/175 (37%), Gaps = 44/175 (25%)

Query: 35  FHFQAHALSVKCLDVSKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSITN-LKFSK 91
           +  + H   V C+ +  +     SGS+D  IR++D++    L     H G +   +  + 
Sbjct: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425

Query: 92  SKTEN-------GDGEGSNNKW--------------------------------LLSASE 112
              EN       G  EG +                                   LLS S 
Sbjct: 426 IDAENLVVDNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSL 485

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           DN I +W V+  +   T  GH+  +   DI   N   IS S D SI++W+L + K
Sbjct: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 538

>Scas_465.4
          Length = 1002

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           S+K     K Y+ +G+    + I+DL    +L  L+ H+GSI    F  + ++NG     
Sbjct: 141 SIKEFSPEKVYISAGTVMGGVLIWDLFLETKLYNLVGHEGSI----FYATISDNG----- 191

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
             +++ S S+D  I +W ++  E   T  GH ARI ++    ++   ISVSED++ R+W+
Sbjct: 192 --RYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWD 249

Query: 163 LM 164
           ++
Sbjct: 250 IL 251

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 22/154 (14%)

Query: 23  DLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQG 82
           DL L+T L+  + H    ++    +  + RY+ S S+D  I++++LQ  +EL T   H  
Sbjct: 165 DLFLETKLYNLVGH--EGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTA 222

Query: 83  SITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND--- 139
            I NLKF  + T+           L+S SEDN   +W +   E  G     +++I +   
Sbjct: 223 RIWNLKFFNNDTQ-----------LISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHL 271

Query: 140 ------VDIHPSNRVAISVSEDHSIRLWNLMTVK 167
                 VDI   + VA++   D  ++L  +   K
Sbjct: 272 IKNVWGVDIQEKDMVAVTSGNDGRLKLTKIQDTK 305

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 116 IIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           ++IW +        L GH   I    I  + R   S S+D SI+LWNL T
Sbjct: 161 VLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQT 210

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 269 GHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           GH+ R+ + KF+ ND  T ++S+  D    VWD+
Sbjct: 219 GHTARIWNLKFFNND--TQLISVSEDNTCRVWDI 250

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 14/134 (10%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V C+       Y+++GS+D+  R++D+Q    +   L H  S+ ++  S
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVS 677

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGH-IARINDVDIHPSNRVA 149
                  DG     +WL + SED  II+W +   +    ++GH  + +  +  +    + 
Sbjct: 678 P------DG-----RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNIL 726

Query: 150 ISVSEDHSIRLWNL 163
           +S   D S+R+W+L
Sbjct: 727 VSGGADQSVRVWDL 740

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (43%), Gaps = 26/144 (18%)

Query: 34  IFHFQAHALSVKCLDVS--KRYLVSGSNDEHIRIYDL----------QKRKELG---TLL 78
           ++ F      + CL  S   R + +G  D +I+++ L           K K+     TL+
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIN 138
            H G + ++ FS            +N++L+SASED  + +W +  +    + KGH   + 
Sbjct: 540 GHSGPVYSVSFSP-----------DNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVW 588

Query: 139 DVDIHPSNRVAISVSEDHSIRLWN 162
           DV   P      + S D + RLW+
Sbjct: 589 DVKFSPLGHYFATGSHDQTARLWS 612

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 77/206 (37%), Gaps = 55/206 (26%)

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           W L  +     +  + KD  N  TL GH   +  V   P NR  +S SED ++RLW+L T
Sbjct: 514 WSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDT 573

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHL 225
                ++  + ++     V++   G YFA                          T  H 
Sbjct: 574 Y--TCLVSYKGHNHPVWDVKFSPLGHYFA--------------------------TGSHD 605

Query: 226 ETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFG 285
           +T     +++ C        H YP                   GH N V    F+ N  G
Sbjct: 606 QT----ARLWSC-------DHIYPLR--------------IFAGHLNDVDCVTFHPN--G 638

Query: 286 TYMVSIGSDGRVVVWDMEKKDELAVY 311
           TY+++  SD    +WD++  D + ++
Sbjct: 639 TYVLTGSSDKTCRMWDIQTGDSVRLF 664

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 56/131 (42%), Gaps = 13/131 (9%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           Y  +GS+D+  R++       L     H   +  + F             N  ++L+ S 
Sbjct: 598 YFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHP-----------NGTYVLTGSS 646

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           D    +W ++  ++     GH A +  V + P  R   + SED  I +W++ T K+  + 
Sbjct: 647 DKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKR--IK 704

Query: 173 KLRNYSQNGQF 183
           ++R + ++  +
Sbjct: 705 QMRGHGKSAVY 715

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 14/98 (14%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAH-QGSITNLKFSKSK 93
           F  H  SV  + VS   R+L +GS D  I ++D+   K +  +  H + ++ +L F+K  
Sbjct: 664 FLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNK-- 721

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK 131
                 EG+    L+S   D  + +W +K + N  +L+
Sbjct: 722 ------EGN---ILVSGGADQSVRVWDLKKFTNEPSLE 750

>Scas_695.15
          Length = 327

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 118/278 (42%), Gaps = 51/278 (18%)

Query: 54  LVSGSNDEHIRIYDLQKRKE--LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           L++ +  +++R+YD++      + T   H+G++T++ F +           +NKW++++S
Sbjct: 66  LLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQ-----------DNKWMVTSS 114

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK---- 167
           ED  I +W V+        K H A +N+V IHP+    IS   D +I++W+L   +    
Sbjct: 115 EDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGTIKIWDLGENQCTHQ 173

Query: 168 ------KAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKV------LIYKTAAAKVHCEI 215
                   ++  L   S     V     GD +   + N         I K +A K +   
Sbjct: 174 LIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITR 233

Query: 216 DMNKKTIMHLETETLD--GKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNR 273
            +    + H+ T + D   KI+  V  ++ + +                 E +L GH   
Sbjct: 234 VVLSSDVKHMATCSADRTAKIW-SVGETEDDFNL----------------ETTLDGHQRW 276

Query: 274 VKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
           V D  F  +    Y+V+  SD  V +WD+  ++ +  Y
Sbjct: 277 VWDCAFSAD--SAYLVTASSDHYVRLWDLSTREIVRQY 312

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 67/159 (42%), Gaps = 28/159 (17%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F   K
Sbjct: 327 IQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQK 386

Query: 94  TENGD------------GE---------------GSNNKWLLSASEDNKIIIWRVKDWEN 126
              G             GE                S+ K ++S S D  + +W V+    
Sbjct: 387 LITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTC 446

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + TLKGH   +N V +HP +    S S+D +IR+W++ T
Sbjct: 447 Y-TLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRT 484

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 66/169 (39%), Gaps = 38/169 (22%)

Query: 35  FHFQAHALSVKCLDVSKRYL--VSGSNDEHIRIYDLQKRKELGTLLAHQGSIT------- 85
           +  + H   V C+ +  +     S S+D  IR++D++    L     H G +        
Sbjct: 447 YTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTI 506

Query: 86  ----NLKFSKSK-------TENGDGE-----GSNNK-----------WLLSASEDNKIII 118
               NL   + K         NG GE     G N +            LLS + DN I +
Sbjct: 507 IDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKL 566

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           W V+      T  GH+  +   DI   N   IS S D SI++W+L + K
Sbjct: 567 WEVRSGRCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 613

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 60/128 (46%), Gaps = 11/128 (8%)

Query: 38  QAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENG 97
           +A   +V    +  R  + G+ +  I++ D     +     AH   IT LKF  S     
Sbjct: 93  RADYTAVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQAHVSEITKLKFFPS----- 147

Query: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
            GE      L+S+S+D ++ IW VKD  N  TL GH A + D+ I    R  +S S D +
Sbjct: 148 -GEA-----LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGT 201

Query: 158 IRLWNLMT 165
           IRLW   T
Sbjct: 202 IRLWECGT 209

>Scas_707.22
          Length = 730

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 71/144 (49%), Gaps = 16/144 (11%)

Query: 29  PLFTP-IFHFQAHALSV-KCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN 86
           P F P       HA SV  CL     Y+++G++D  +RIYD + +K L  L  H+G +  
Sbjct: 342 PSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWA 401

Query: 87  LKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HP 144
           LK+        D +G     ++S S D  + IW +K        KGH + +  ++I  + 
Sbjct: 402 LKY--------DADG----IIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYK 449

Query: 145 SNRVAISVSEDHSIRLWNLMTVKK 168
           + +  ++ S D+++ +W L+  +K
Sbjct: 450 NMKYIVTGSRDNTLHVWKLIKEEK 473

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 35/149 (23%)

Query: 37  FQAHALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKE------------------L 74
           F+ H  +V+CL++    + +Y+V+GS D  + ++ L K ++                  +
Sbjct: 433 FKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFV 492

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHI 134
           G L  H  S+        +T +G G       ++S S DN +++W +   +    L GH 
Sbjct: 493 GVLRGHMASV--------RTISGHG-----NIVISGSYDNNLMVWDIAQMKCLYVLIGHT 539

Query: 135 ARINDVDIHPSNRVAISVSEDHSIRLWNL 163
            RI         +  IS S D +I++W+L
Sbjct: 540 DRIYSTIYDHKRQRCISASMDSTIKVWDL 568

>Kwal_0.212
          Length = 303

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 63/115 (54%), Gaps = 15/115 (13%)

Query: 51  KRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           KR+L +  +  ++R+YD++      + +   H+G++T++ F +            NKW++
Sbjct: 44  KRFLAAAGH-LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE-----------NKWMV 91

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           S+SED  I +W V+        K H A +N+V IHP+    IS  +D ++R+W+L
Sbjct: 92  SSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVIHPNQGELISCDQDGNVRIWDL 145

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 22/121 (18%)

Query: 54  LVSGSNDEHIRIY------DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWL 107
           LV+G+N  +  ++      D    K +    +H   IT +  S           S+ K L
Sbjct: 174 LVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLS-----------SDVKHL 222

Query: 108 LSASEDNKIIIWRVKDWENF---GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
            + S D+   +W + D  NF    TL  H   + D      +   ++   DH +RLW+L 
Sbjct: 223 ATCSADHTARVWSIDD--NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLS 280

Query: 165 T 165
           T
Sbjct: 281 T 281

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 64/124 (51%), Gaps = 11/124 (8%)

Query: 40  HALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDG 99
           ++ S+     +K Y+ +G+    + I+DL    ++  LL H+GSI  +  SK        
Sbjct: 140 YSGSISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSK-------- 191

Query: 100 EGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIR 159
              N ++++S S+D  I +W +K  E   T  GH ARI  +    ++   +SVSED + R
Sbjct: 192 ---NGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCR 248

Query: 160 LWNL 163
           +W++
Sbjct: 249 VWDI 252

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 269 GHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
           GH+ R+   KF  ND  T +VS+  D    VWD+ K
Sbjct: 221 GHTARIWQLKFIDND--TKVVSVSEDCTCRVWDIAK 254

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 123/305 (40%), Gaps = 76/305 (24%)

Query: 34  IFHFQAHALSVKCLDVS--KRYLVSGSNDEHIRIYDL-----------QKRKELG--TLL 78
           ++ F      + CL+ S       +G  D +I+++ L           ++R+++   TL+
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIN 138
            H G++ +  FS            +NK+LLSASED  + +W +  + +  + KGH   + 
Sbjct: 474 GHSGTVYSTSFSP-----------DNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVW 522

Query: 139 DVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLK-------LRNYSQNGQFV------- 184
           DV   P      + S D + RLW+   +    +           ++  NG +V       
Sbjct: 523 DVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDK 582

Query: 185 ---RW-IGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAM 240
               W IG GD   + L +   +  TA +                     DG+ ++    
Sbjct: 583 TCRMWDIGTGDSVRLFLGHTAPVISTAVSP--------------------DGR-WLSTGS 621

Query: 241 SDGNIHFYPTEGLLTEEPKVEEPEFSLLGHS-NRVKDFKFYKNDFGTYMVSIGSDGRVVV 299
            DG I+ +     +    ++++    + GH  N V    + K   GT +VS G+D  V V
Sbjct: 622 EDGIINVWD----IGTGKRLKQ----MRGHGKNAVYSLSYSKE--GTVLVSGGADHSVRV 671

Query: 300 WDMEK 304
           WD+++
Sbjct: 672 WDLKR 676

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 14/134 (10%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V C+       Y+ +GS D+  R++D+     +   L H   + +   S
Sbjct: 552 PLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVS 611

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVA 149
                  DG     +WL + SED  I +W +   +    ++GH    +  +       V 
Sbjct: 612 P------DG-----RWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVL 660

Query: 150 ISVSEDHSIRLWNL 163
           +S   DHS+R+W+L
Sbjct: 661 VSGGADHSVRVWDL 674

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 115/275 (41%), Gaps = 49/275 (17%)

Query: 54  LVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           L++ +  +++R+YD++      + +   H+G++T++ F +           +N+W++++S
Sbjct: 46  LLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQ-----------DNRWMVTSS 94

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL-------- 163
           ED  I +W V+   +      H A +N+V IHP+    IS   D +IR+W+L        
Sbjct: 95  EDGTIKVWDVRS-PSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ 153

Query: 164 MTVKKAAVLKLRNYSQNGQFVRWIGN-GDYFAVALLNKV------LIYKTAAAKVHCEID 216
           +T +    L+  + + +G  +      G+ +   + N         + K  A   +    
Sbjct: 154 LTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRI 213

Query: 217 MNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKD 276
           +    + HL T + D    +     D  +                  E +L GH   V D
Sbjct: 214 LLSSDVKHLATCSADHTARVWSIDDDFKL------------------ETTLDGHQRWVWD 255

Query: 277 FKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
             F  +    Y+V+  SD  V +WD+  ++ +  Y
Sbjct: 256 CAFSAD--SAYLVTASSDHYVRLWDLSTREIVRQY 288

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 14/134 (10%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V C        Y+ +GS+D+  R++D+Q    +   L H   +T L+ S
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVS 688

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVA 149
                  DG     +WL + SED  II+W +   +    +KGH    I  +  +      
Sbjct: 689 P------DG-----RWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCL 737

Query: 150 ISVSEDHSIRLWNL 163
           ++   D S+R+W++
Sbjct: 738 VTGGADQSVRVWDI 751

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 4/117 (3%)

Query: 82  GSITNLKFSKSK--TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND 139
           G++T ++FS     T  G  + +   W L  S    I+  + KD  N  TL GH   +  
Sbjct: 499 GNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYS 558

Query: 140 VDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
           V   P NR  +S SED ++RLW+L T       K  N+     +V++   G YF  A
Sbjct: 559 VAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPV--WYVKFSPLGHYFITA 613

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 11/112 (9%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K + + GS  + I     + +    TL+ H G + ++ FS            +N++LLSA
Sbjct: 523 KVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFS-----------PDNRYLLSA 571

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           SED  + +W +  +      KGH   +  V   P     I+ S D + RLW+
Sbjct: 572 SEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 59/145 (40%), Gaps = 13/145 (8%)

Query: 31  FTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLK 88
           FT +  ++ H   V  +  S    Y ++ S+D+  R++       L     H   +    
Sbjct: 585 FTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCST 644

Query: 89  FSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRV 148
           F             N  ++ + S D    +W ++  ++     GH + +  +++ P  R 
Sbjct: 645 FH-----------PNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRW 693

Query: 149 AISVSEDHSIRLWNLMTVKKAAVLK 173
             + SED +I +W++ T K+   +K
Sbjct: 694 LTTGSEDGTIIVWDIGTGKRIKQMK 718

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 65/134 (48%), Gaps = 16/134 (11%)

Query: 32  TPIFHFQAH--ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T + +F  H  A++V   D +   L+SGS D  I I+DL     L  L +H+ SIT +  
Sbjct: 108 TVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-- 165

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
                EN D       WL+S S+D  I IW +K  +   T   H +    + IH  N + 
Sbjct: 166 ---WCENED-------WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH--NDLV 213

Query: 150 ISVSEDHSIRLWNL 163
           I+ S +  I++WNL
Sbjct: 214 ITTSTESQIKIWNL 227

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L  G  D  I+I+DL  +  L     H+ +IT L+F  + T            L+S S+D
Sbjct: 90  LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTR-----------LISGSKD 138

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + IIIW +        L+ H   I  +     + + IS S+D  I++W+L T
Sbjct: 139 SDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWL-ISTSKDGLIKIWDLKT 189

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 89/197 (45%), Gaps = 25/197 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENG----------DGEGSN 103
           +VS S DE +R++D+   ++  +    Q     ++  ++  + G          +G    
Sbjct: 152 VVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRG 211

Query: 104 NKW---------LLSASEDNKIIIWRV---KDWENFGTLKGHIARINDVDIHPSNRVAIS 151
             W         ++S S+D ++ +WR+   K WE   T +GH   ++ V  HP   + IS
Sbjct: 212 VNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWE-VDTCRGHTNNVDSVIFHPQQNLIIS 270

Query: 152 VSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKV 211
           V ED ++R+W+L   K+  + + +  +     VR   N + F  A  + ++I+K    + 
Sbjct: 271 VGEDKTVRVWDLD--KRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERP 328

Query: 212 HCEIDMNKKTIMHLETE 228
              I+ N+   ++ E +
Sbjct: 329 PTAINQNQLFFINREKQ 345

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 13/134 (9%)

Query: 37  FQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F+ H   V+ +D   ++   VS  +D  I+++ L+  K L TL  H   +  + F     
Sbjct: 49  FEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHEL- 107

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                      W++S+S+D  I IW  ++ +    L GH   +     HP   + +S S 
Sbjct: 108 ----------PWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASL 157

Query: 155 DHSIRLWNLMTVKK 168
           D ++R+W++  ++K
Sbjct: 158 DETVRVWDISGLRK 171

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 112/273 (41%), Gaps = 40/273 (14%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           I+++D +    L     H+G +  + F  ++              +SA +D  I +W ++
Sbjct: 35  IQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQ-----------PLFVSAGDDYTIKVWSLE 83

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRN-YSQNG 181
             +   TL GH+  +  V  H      IS S+D +IR+WN    K+ A L   N +    
Sbjct: 84  SNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCA 143

Query: 182 QFVRWIGNGDYFAVALLNK-VLIYKTAA-AKVHCEIDMNK-KTIMHLETETLDGKIYICV 238
           QF       D    A L++ V ++  +   K H        +  M  +   LDG    CV
Sbjct: 144 QFH---PVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCV 200

Query: 239 A--MSDGNIH------FYPTEGLL---TEEPKVEEPEFSLL---------GHSNRVKDFK 278
              + +G+        F+PT  L+   +++ +V+    S           GH+N V    
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

Query: 279 FYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
           F+       ++S+G D  V VWD++K+  +  +
Sbjct: 261 FHPQQ--NLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS    G     +  W+L A   + I +W  +        + H   +  +D HP+  + 
Sbjct: 9   SKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLF 68

Query: 150 ISVSEDHSIRLWNLMTVK 167
           +S  +D++I++W+L + K
Sbjct: 69  VSAGDDYTIKVWSLESNK 86

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 14/132 (10%)

Query: 34  IFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           I   Q H+  +  +D S+    L SGS D  I+++D++K+  + T+LAH   ++ +KF+K
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNK 399

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
                      N  +L+S+  D K+ I+   +W    +L+GH+ ++  +DI   +    S
Sbjct: 400 ----------QNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSIDIVGPD--IYS 447

Query: 152 VSEDHSIRLWNL 163
              D S+  W +
Sbjct: 448 AGWDRSVNKWGV 459

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 16/201 (7%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           ++K +   + D +I+I+   D      L  + AR   V  HP N    S S D   + W 
Sbjct: 232 DSKNIFVCTHDGRIVIYDSGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFD---KTWI 288

Query: 163 LM-TVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKV-LIYKTAAAKVHCEIDMNKK 220
           L+ TVK+A +L    +S     + +  +G   + A L+ + LI+   + K    +  + K
Sbjct: 289 LIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK 348

Query: 221 TIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFY 280
            I  ++         +     DG I  +     + ++  VE    ++L H++ V   KF 
Sbjct: 349 PIYSVDWSQ--NGYQLASGSGDGTIKVWD----IRKKGNVE----TILAHNSIVSQVKFN 398

Query: 281 KNDFGTYMVSIGSDGRVVVWD 301
           K + G Y+VS G D +V +++
Sbjct: 399 KQN-GGYLVSSGYDKKVNIFN 418

>Kwal_34.15818
          Length = 349

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 108/277 (38%), Gaps = 57/277 (20%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L  H+ S+T +KF++     GD        + + ++DN   +W   + E  GT +GH   
Sbjct: 6   LKGHERSLTQVKFNR----EGD-------LIFTCAKDNVASVWYSINGERLGTFEGHQGT 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLW------NLMTVKKAAVLKLRNYSQNGQFVRWIGNG 190
           I  +D+    + A++ S D SI+LW      N+ T K    ++   +S +G  +      
Sbjct: 55  IWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQFSPSGDKI------ 108

Query: 191 DYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETE------TLDG------------ 232
               +A+L+ V+ Y  +        D   K I+ +  E      T +G            
Sbjct: 109 ----LAVLDGVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVAAWSFN 164

Query: 233 KIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIG 292
             YI     DG +  Y  EG   E         S   H+  V D +F  +  GTY ++  
Sbjct: 165 DTYIVAGHKDGRVSKY--EGHSGEYID------SAALHTQNVSDIQFSPD--GTYFITSS 214

Query: 293 SDGRVVVWDMEKKDELAVY--DCGERLNCLAVVDETV 327
            D    + D E  + L  Y  DC     C+  + + V
Sbjct: 215 RDSAAKLVDTETLEVLKTYETDCPLNSACITPLKQFV 251

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 88/174 (50%), Gaps = 26/174 (14%)

Query: 9   IVGSYEH--NILCLSLDLSLKTPLF-----TPIFHFQAHALSVKCLD-VSKR------YL 54
           I+ S+ H  N L LS D +L+   F     TP    +A   ++K  + V+KR       +
Sbjct: 315 ILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELM 374

Query: 55  VSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           V+ S+D  + +++ L+  K +  +  HQ  + ++ FS            + ++++SAS D
Sbjct: 375 VTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFS-----------PDGRYIVSASFD 423

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           N I +W  +D +   T +GH+A +  V      R+ +S S+D ++++W++ T K
Sbjct: 424 NSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 477

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 69/158 (43%), Gaps = 17/158 (10%)

Query: 11  GSYEHNILCLSLDLS--LKTPLFT--PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIR 64
           G +E  ++  S D +  L  PL +  PI     H   V  +  S   RY+VS S D  I+
Sbjct: 368 GDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 427

Query: 65  IYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDW 124
           ++D +  K L T   H  S+  + +S           S+ + L+S S+D  + +W VK  
Sbjct: 428 LWDGRDGKFLSTFRGHVASVYQVAWS-----------SDCRLLVSCSKDTTLKVWDVKTR 476

Query: 125 ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           +    L GH   +  VD     +   S  +D  +R+W 
Sbjct: 477 KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIWT 514

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 16/161 (9%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIR 64
           R++ G+ + N  C+  D   +T + T     Q H   V C   S     + +GS D  IR
Sbjct: 158 RMVTGAGD-NTACI-WDCDTQTRMCT----LQGHHNWVLCCSWSPDGELIATGSMDNTIR 211

Query: 65  IYDLQKRKELG-TLLAHQGSITNLKFSKSK-TENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           +++  K K  G  L  H   IT+L +      + GD        L +AS+D  I IW   
Sbjct: 212 LWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPR-----LATASKDGTIKIWDTT 266

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
                 TL GH + ++ V     N V  S S D +IR W++
Sbjct: 267 RRVCLLTLCGHTSSVSCVKWGGKN-VLYSGSHDKTIRCWDM 306

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 111/271 (40%), Gaps = 46/271 (16%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L+ H+ S+T +K+++     GD        + ++ +DN   +W   + E  GTL+GH   
Sbjct: 6   LMGHERSLTQVKYNR----EGD-------LIFTSGKDNVASVWYAMNGERLGTLEGHNGS 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
           I  +D+      A++ S D S+++W    V+  ++    +     + V +   GD   +A
Sbjct: 55  IWSIDVDQHTEYAVTGSADFSVKVWR---VRDGSIAHSWDTRTPVRRVEFSPTGDR-VLA 110

Query: 197 LLNKVLIYKTAAAKVHCEIDMNKKTI---MHLETETL---------------DGKIYICV 238
           +L+ V+ Y  A        D N +       L  E L               DGK YI  
Sbjct: 111 VLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEILTQEGCAPVLVASWSYDGK-YIVA 169

Query: 239 AMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVV 298
              DG I  Y   G+  E  ++++       H  RV D +F  +   TY ++   D    
Sbjct: 170 GHQDGKISKY--NGVTGECLEIKDL------HKQRVSDIQFSLDR--TYFLTTSRDSYAN 219

Query: 299 VWDMEKKDELAVY--DCGERLNCLAVVDETV 327
           + D+E  + L  Y  DC     C+  + E V
Sbjct: 220 LVDVETFEVLKTYETDCPLNSGCITPLKEFV 250

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 34  IFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +  F+ H   V+ +D   ++   VS  +D  I+++ L   K L TL  H   +  + F  
Sbjct: 46  LHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFH- 104

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
                     +   W++SAS+D  I IW  ++      L GH   +     HP+  + +S
Sbjct: 105 ----------TELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVS 154

Query: 152 VSEDHSIRLWNLMTVKK 168
            S D ++R+W++  ++K
Sbjct: 155 ASLDETVRIWDISGLRK 171

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 83/188 (44%), Gaps = 25/188 (13%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENG----------DGEGSN 103
           +VS S DE +RI+D+   ++  +    Q     +   ++  + G          +G    
Sbjct: 152 VVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRG 211

Query: 104 NKW---------LLSASEDNKIIIWRV---KDWENFGTLKGHIARINDVDIHPSNRVAIS 151
             W         ++S S+D ++ +WR+   K WE   T +GH   ++ V  HP   + IS
Sbjct: 212 VNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWE-VDTCRGHTNNVDSVIFHPFQNLIIS 270

Query: 152 VSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKV 211
           V ED +IR+W+L   K+  V + +        +R   N + F  A  + ++++K    + 
Sbjct: 271 VGEDSTIRVWDLD--KRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKLDRERP 328

Query: 212 HCEIDMNK 219
              ++ N+
Sbjct: 329 PVAVNQNQ 336

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 106/267 (39%), Gaps = 40/267 (14%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           I+++D +    L     H+G +  + F  ++              +SA +D  I +W + 
Sbjct: 35  IQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQ-----------PLFVSAGDDYSIKVWSLS 83

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRN-YSQNG 181
             +   TL GH+  +  V  H      IS S+D +IR+WN    ++ A L   N +    
Sbjct: 84  THKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCA 143

Query: 182 QFVRWIGNGDYFAVALLNK-VLIYKTAAAKVHCEIDMNKKTIMHLETET--LDGKIYICV 238
           QF       D    A L++ V I+  +  +       ++     + T+    DG    CV
Sbjct: 144 QFH---PTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCV 200

Query: 239 A--MSDGNIH------FYPTEGLLTEEPKVEEPEF------------SLLGHSNRVKDFK 278
              + +G+        F+PT  L+       + +             +  GH+N V    
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

Query: 279 FYKNDFGTYMVSIGSDGRVVVWDMEKK 305
           F+   F   ++S+G D  + VWD++K+
Sbjct: 261 FHP--FQNLIISVGEDSTIRVWDLDKR 285

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS          +  W+L A   + I +W  +        + H   +  VD HP+  + 
Sbjct: 9   SKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLF 68

Query: 150 ISVSEDHSIRLWNLMTVK 167
           +S  +D+SI++W+L T K
Sbjct: 69  VSAGDDYSIKVWSLSTHK 86

>Kwal_26.8953
          Length = 458

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 84/197 (42%), Gaps = 44/197 (22%)

Query: 3   KNQFRIIVGSYEHNILCLSLDLS----LKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGS 58
           KN    +V S   ++ C   D+S    LK+        FQ HA  V+ LD+   Y+++GS
Sbjct: 228 KNATDTLVASCSRDLTCKIGDVSNGYFLKS--------FQPHAEWVRSLDIMGEYIITGS 279

Query: 59  NDEHIRIYDLQKRKELGTLLAH-----QGSITNLKFSKSKTENGDGEGSNNK-------- 105
           ND  +R+      + L   + H     Q  I  ++ S+S     +   + NK        
Sbjct: 280 NDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSAFNKDYLPLGFS 339

Query: 106 WLLSASEDNKIIIWRVK-----------------DWENFGTLKGHIARINDVDIHPSNRV 148
            ++S S DN + IW+V                   +    TLKGH + + D+ +      
Sbjct: 340 HVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVR--GNF 397

Query: 149 AISVSEDHSIRLWNLMT 165
            IS S+D S+R+W+L T
Sbjct: 398 IISCSDDRSVRVWDLET 414

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 57/288 (19%), Positives = 112/288 (38%), Gaps = 54/288 (18%)

Query: 33  PIFHFQAHALSVKCLDV-----SKRYLVSGSNDEHIRIYDL--QKRKELGTLLAHQGSIT 85
           P+   QAH   +  +DV     S+ ++ + S D H +++ L   + + + T   H+  ++
Sbjct: 163 PVASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVS 222

Query: 86  NLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS 145
           ++K  K+ T+           + S S D    I  V +     + + H   +  +DI   
Sbjct: 223 HIKIWKNATDT---------LVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDI--M 271

Query: 146 NRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYK 205
               I+ S D ++R+ +  T +  +                 G G  F V  + K++  +
Sbjct: 272 GEYIITGSNDCTVRVSHWPTGRALS----------------FGIGHDFPVEQV-KIIPME 314

Query: 206 TAAAKVHCEIDMNKKTIMHLETETLD-GKIYICVAMSDGNIHFY--PTEGLLT---EEPK 259
            + +      D    T      + L  G  ++     D  +  +  P   L+     +P 
Sbjct: 315 LSESD-----DPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPN 369

Query: 260 VEEPEFSLL----GHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDME 303
                F+L+    GHS+ V+D +      G +++S   D  V VWD+E
Sbjct: 370 PARAHFTLVKTLKGHSSWVRDIRVR----GNFIISCSDDRSVRVWDLE 413

>Kwal_26.8776
          Length = 433

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 14/125 (11%)

Query: 44  VKCL---DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGE 100
           V+C+    V   +  +GSND  I+++D+   K   TL  H  ++ ++  S+         
Sbjct: 124 VRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQ--------- 174

Query: 101 GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRL 160
              +  + SASED  +  W ++         GH + +N VD+HP+  +  S   D  +RL
Sbjct: 175 --RHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRL 232

Query: 161 WNLMT 165
           W++ T
Sbjct: 233 WDIRT 237

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 61/138 (44%), Gaps = 13/138 (9%)

Query: 37  FQAHALSVKCLDVSKRY--LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
              H ++V+ + VS+R+  + S S D+ ++ +DL++   +     H   +  +    +  
Sbjct: 160 LTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTL- 218

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                       + SA  D  + +W ++      TL GH + IN V   P +   +S S 
Sbjct: 219 ----------DLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSS 268

Query: 155 DHSIRLWNLMTVKKAAVL 172
           D ++RLW++   K   +L
Sbjct: 269 DATVRLWDIRAGKATKIL 286

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 16/131 (12%)

Query: 34  IFHFQAHALSVKCLDVSKRY--LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           I  +  H   V  +DV      + S   D  +R++D++ R  + TL  H+  I  +K   
Sbjct: 199 IRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFP 258

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS-NRVAI 150
              +           ++S S D  + +W ++  +    L  H   +  +  HP+ + VA 
Sbjct: 259 VDPQ-----------IMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVAT 307

Query: 151 SVSEDHSIRLW 161
           + + D  +R W
Sbjct: 308 ASTSD--VRSW 316

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 65/139 (46%), Gaps = 13/139 (9%)

Query: 32  TPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T +  F+ H   V+ +D   ++   VS  +D  I+++ L+  + L TL  H   +  + F
Sbjct: 44  TLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFF 103

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
                       S   W++SAS+D  + IW  ++ +    L GH   +     H +  + 
Sbjct: 104 H-----------SELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLV 152

Query: 150 ISVSEDHSIRLWNLMTVKK 168
           +S S D ++R+W++  ++K
Sbjct: 153 VSASLDETVRVWDISGLRK 171

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 82/176 (46%), Gaps = 29/176 (16%)

Query: 54  LVSGSNDEHIRIYDL----QKRKELGTL-----LAHQGSITNLKFSKSKTE---NGDGEG 101
           +VS S DE +R++D+    +K    G       LA Q ++ +  F   K +    G   G
Sbjct: 152 VVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRG 211

Query: 102 SNNKW---------LLSASEDNKIIIWRV---KDWENFGTLKGHIARINDVDIHPSNRVA 149
            N  W         +++  +D ++ +WR+   K WE   T +GH   ++ V  HP   + 
Sbjct: 212 VN--WASFHPTLPLIVTGGDDRQVKLWRMSSNKAWE-VDTCRGHTNNVDCVVFHPDQNLI 268

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYK 205
           +SV+ED ++R+W+L   K+  V + +  +     +R   N   F  A  + ++I+K
Sbjct: 269 LSVAEDKTLRIWDLD--KRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFK 322

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 19/119 (15%)

Query: 63  IRIYDLQKRKELGTLL----AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           I+++D +    +GTLL     H+G +  + F  ++              +SA +D  I +
Sbjct: 35  IQLWDYR----MGTLLHRFEGHEGPVRAVDFHPTQ-----------PIFVSAGDDASIKV 79

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNY 177
           W ++      TL GH+  +  V  H      IS S+D ++R+WN    K+ A L   N+
Sbjct: 80  WSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNH 138

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
           SKS    G     +  W L A   + I +W  +        +GH   +  VD HP+  + 
Sbjct: 9   SKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIF 68

Query: 150 ISVSEDHSIRLWNLMT 165
           +S  +D SI++W+L T
Sbjct: 69  VSAGDDASIKVWSLET 84

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 21/172 (12%)

Query: 32  TPIFH-FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSI----TN 86
           +P  H F+AH   V  L +   +LVSGS D  IR +DL+  K L T+     ++    TN
Sbjct: 492 SPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTN 551

Query: 87  LKFSKSKTENGDGE-------GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND 139
           +  SKS       E        S +  L + ++D  + +W ++  +   TLKGH   I  
Sbjct: 552 VDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITS 611

Query: 140 VDIHPSNRVAISVSEDHSIRLWNLMT-------VKKAAVLKLRNYSQNGQFV 184
           +    +    ++ S D ++R+W+L T          A VL L  + +N   V
Sbjct: 612 LKFDSA--CLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVV 661

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 20/148 (13%)

Query: 16  NILCLSLDLSL-KTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKEL 74
           N+L  S ++ L K+ L T     +    S+  L      L +G+ D  +R++DL+  K +
Sbjct: 544 NVLTTSTNVDLSKSTLLTQ----RNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVI 599

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHI 134
            TL  H  +IT+LKF             ++  L++ S D  + IW ++          + 
Sbjct: 600 RTLKGHTDAITSLKF-------------DSACLVTGSYDRTVRIWDLRTGL-LNKFHAYS 645

Query: 135 ARINDVDIHPSNRVAISVSEDHSIRLWN 162
           A +  +D+   N  A+ V+++ S+++++
Sbjct: 646 APVLSLDLFQEN-AAVVVADEPSVQIYD 672

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           D+ + IW +      G L GH+A IN + I+      ++   D +++LWNL
Sbjct: 420 DHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNL 470

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 11/123 (8%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           +V    +   +  +GSND  I+I+DL   K   TL  H  ++ ++  SK           
Sbjct: 134 TVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISK----------- 182

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
            + ++ SASED  +  W ++         GH++ ++ VDIHP+  +  +   D  +RLW+
Sbjct: 183 RHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWD 242

Query: 163 LMT 165
           + T
Sbjct: 243 IRT 245

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 13/138 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
              H ++VK + +SKR  Y+ S S D+ ++ +DL+K + +     H   +  +    +  
Sbjct: 168 LSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTL- 226

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                       + +A  D+ + +W ++      T+ GH + IN V   P +   +S S 
Sbjct: 227 ----------NLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSA 276

Query: 155 DHSIRLWNLMTVKKAAVL 172
           D ++RLW++   K   VL
Sbjct: 277 DATVRLWDITAGKTLKVL 294

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/132 (20%), Positives = 53/132 (40%), Gaps = 14/132 (10%)

Query: 34  IFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           I  +  H   V  +D+      + +   D  +R++D++ +  + T+  H+  I  +K   
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
              +           ++S S D  + +W +   +    L  H   + D+ IHP    +IS
Sbjct: 267 VDPQ-----------VVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHP-GEFSIS 314

Query: 152 VSEDHSIRLWNL 163
            +    IR W L
Sbjct: 315 SACTDDIRSWKL 326

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 19/168 (11%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V CL     Y+++G++D+ I +YD +    L  L  H+G +  LKF   K          
Sbjct: 263 VTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKI--------- 313

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HPSNRVAISVSEDHSIRLW 161
              L+S S D  + IW ++  +     KGH + +  +++  +  ++  ++ S D+++ +W
Sbjct: 314 ---LVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 162 NLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAA 209
            L  +K     +L   SQ   F R      YF   L   +   +T + 
Sbjct: 371 KLPPMK-----ELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSG 413

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 83/207 (40%), Gaps = 48/207 (23%)

Query: 37  FQAHALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKEL------------------ 74
           F+ H  +V+CL+V      +Y+V+GS D  + ++ L   KEL                  
Sbjct: 337 FKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPY 396

Query: 75  --GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKG 132
             G L  H  S+        +T +G G     + ++S S D+ +++W +   +    L G
Sbjct: 397 FVGVLRGHMSSV--------RTVSGHG-----RIVISGSYDHNLMVWDIISMKLLYILTG 443

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN--- 189
           H  R+            IS S D ++ +W+L  ++        N   +G  ++ +G+   
Sbjct: 444 HTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTIN---DGASIKVVGSMKC 500

Query: 190 --GDYFAVALL---NKVLIYKTAAAKV 211
             G    V LL   NK L+   A   +
Sbjct: 501 LYGHTALVGLLCLSNKFLVSAAADGSI 527

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 73/168 (43%), Gaps = 17/168 (10%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSV--KCLDVSKRYLVSGSNDEHIRI 65
           +I GSY+HN++   + +S+K      ++    H   V     D  +   +S S D  + I
Sbjct: 418 VISGSYDHNLMVWDI-ISMKL-----LYILTGHTDRVYSTIYDYKRNRCISASMDTTVMI 471

Query: 66  YDLQKRKELGTLL-----AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR 120
           +DL+  +  GT       A    + ++K     T        +NK+L+SA+ D  I  W 
Sbjct: 472 WDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRGWD 531

Query: 121 VKDW-ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
             D+   F     ++A I    +  ++ + +S SE     ++NL T K
Sbjct: 532 PNDYSRKFSFHHTNLAAITSFSM--NDNILVSGSE-RQFNVYNLRTGK 576

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 11/141 (7%)

Query: 37  FQAHALSVKCLDVSKR---YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           F+ H   V C+  + +      S   D  ++I+ L ++    T+ AH+    N       
Sbjct: 18  FEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPL 77

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
                    +  +L+++S+D  + IW  +      TL+GH+A ++    HPS  + IS S
Sbjct: 78  --------QDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGS 129

Query: 154 EDHSIRLWNLMTVKKAAVLKL 174
           ED ++++WN  T K    L L
Sbjct: 130 EDGTVKIWNANTYKLEKTLNL 150

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 16/121 (13%)

Query: 32  TPIFHFQAH-ALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN 86
           +P F   AH    V  +D      K YL++ S+D  ++I+D Q +  + TL  H  +++ 
Sbjct: 56  SPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSY 115

Query: 87  LKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSN 146
             F  S              ++S SED  + IW    ++   TL   + R   V  HP+ 
Sbjct: 116 AIFHPSL-----------PIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTG 164

Query: 147 R 147
           +
Sbjct: 165 K 165

>Scas_721.32
          Length = 822

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 19/160 (11%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V C+       Y+ +GS+D+  R++D+     +   L H   +     S
Sbjct: 625 PLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVS 684

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVA 149
                  DG     +WL + SED  I +W +   +    ++GH    I+ +       V 
Sbjct: 685 P------DG-----RWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVL 733

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN 189
           +S   DHS+R+W+L   KK+         +  QFV +IGN
Sbjct: 734 VSGGADHSVRVWDL---KKSTAEPGPEPEE--QFVGYIGN 768

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 112/280 (40%), Gaps = 48/280 (17%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
           FQ   + +  LD S    +   + + I   D+       TL+ H G++ +  FS      
Sbjct: 506 FQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTST-TLIGHSGAVYSTSFSP----- 559

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                 +N++LLS SED  + +W    + +  + KGH   + DV   P      + S D 
Sbjct: 560 ------DNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQ 613

Query: 157 SIRLWNLMTVKKAAVLKLR-------NYSQNGQFVRWIGNGD----YFAVALLNKVLIYK 205
           + RLW+   +    +           ++  NG +V + G+ D     + ++  + V ++ 
Sbjct: 614 TARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYV-FTGSSDKTCRMWDISTGDSVRLFL 672

Query: 206 TAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEF 265
              A V C               + DG+ ++     DG I+ +  +    +  KV     
Sbjct: 673 GHTAPVLC------------TAVSPDGR-WLATGSEDGIINLW--DIGTAKRLKV----- 712

Query: 266 SLLGHS-NRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
            + GH  N +    + K   G  +VS G+D  V VWD++K
Sbjct: 713 -MRGHGKNAIHSLSYCKE--GNVLVSGGADHSVRVWDLKK 749

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 57/148 (38%), Gaps = 13/148 (8%)

Query: 28  TPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSIT 85
           T  +T +  ++ H   V  +  S    Y  + S+D+  R++       L     H   + 
Sbjct: 578 TDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 637

Query: 86  NLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS 145
            + F             N  ++ + S D    +W +   ++     GH A +    + P 
Sbjct: 638 CVSFHP-----------NGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPD 686

Query: 146 NRVAISVSEDHSIRLWNLMTVKKAAVLK 173
            R   + SED  I LW++ T K+  V++
Sbjct: 687 GRWLATGSEDGIINLWDIGTAKRLKVMR 714

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 88/174 (50%), Gaps = 26/174 (14%)

Query: 9   IVGSYEH--NILCLSLDLSLKTPLF-----TPIFHFQAHALSVKCLD-VSKR------YL 54
           I+ S+ H  N L LS D +L+   F      P     A A +++  + V+K+       +
Sbjct: 313 ILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELM 372

Query: 55  VSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           V+GS+D  + +++ L+  K +  +  HQ  + ++ FS            + ++++SAS D
Sbjct: 373 VTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-----------DGRYIVSASFD 421

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           N I +W  +D +   T +GH+A +  V      R+ +S S+D ++++W++ T K
Sbjct: 422 NSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 475

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 111/284 (39%), Gaps = 24/284 (8%)

Query: 32  TPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELG-TLLAHQGSITNLK 88
           TP+   + H+  V C+  S     + +GS D  IR++D +K + LG  L  H   IT+L 
Sbjct: 175 TPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLS 234

Query: 89  FSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRV 148
           +         GE      L SAS+D  I IW         TL GH + ++ +     N V
Sbjct: 235 WEPIHLVK-PGEKPR---LASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRN-V 289

Query: 149 AISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAA 208
             S S D ++R W++    K   + L++++       W+ N    +     ++  +    
Sbjct: 290 LYSASHDRTVRCWDMAAGGKCINI-LKSHAH------WV-NHLSLSTDYALRMGPFDHTG 341

Query: 209 AKVHCEIDMNKKTIMHLE-TETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSL 267
            K     D   + + + E     +G +   +     +   Y     L    K  +P   +
Sbjct: 342 TKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMY-----LWNPLKGSKPILRM 396

Query: 268 LGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
            GH   V    F  +  G Y+VS   D  + +WD      +A +
Sbjct: 397 TGHQKLVNHVAFSPD--GRYIVSASFDNSIKLWDGRDGKFIATF 438

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 392 PILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWS 451

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      S+ + L+S S+D  + +W VK  +    L GH   +  VD     +   
Sbjct: 452 -----------SDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVC 500

Query: 151 SVSEDHSIRLWN 162
           S  +D  +RLW 
Sbjct: 501 SGGKDKMVRLWT 512

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 21/164 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +V+G+ D   RI+D   +  L TL  H   +  + +S       DGE      + + S D
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWS------ADGEV-----IATGSMD 205

Query: 114 NKIIIWRVKDWENFG-TLKGHIARINDVDIHPSNRVA-------ISVSEDHSIRLWNLMT 165
             I +W  +  ++ G  L+GH   I  +   P + V         S S+D +I++W+  T
Sbjct: 206 ATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWD--T 263

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAA 209
            ++  +  L  ++ +   ++W G    ++ +    V  +  AA 
Sbjct: 264 TRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAG 307

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 61/122 (50%), Gaps = 14/122 (11%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V C      Y+++G++D+ I +YD  + +    L+ H+G +  LK++      GD     
Sbjct: 370 VTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYA------GD----- 418

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HPSNRVAISVSEDHSIRLW 161
            + L+S S D  + IW VK  +     +GH + +  +D+  H   +  ++ S D+++ +W
Sbjct: 419 -EILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVW 477

Query: 162 NL 163
            L
Sbjct: 478 KL 479

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 63/151 (41%), Gaps = 37/151 (24%)

Query: 37  FQAHALSVKCLDVSK----RYLVSGSNDEHIRIYDLQKRKE------------------- 73
           F+ H  +V+CLDV +    +Y+V+GS D  + ++ L                        
Sbjct: 444 FRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPF 503

Query: 74  -LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKG 132
            +G L  H  S+        +T +G G       ++S S D+ +++W +   +    L G
Sbjct: 504 FVGVLRGHMASV--------RTVSGHG-----NIVVSGSYDHNLMVWDIAKMKLLYVLTG 550

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           H  RI         +  IS S D ++++W+L
Sbjct: 551 HTDRIYSTLYDHKRKRCISASMDTTVKVWDL 581

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 33/152 (21%)

Query: 29  PLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLK 88
           P F  +   + H  SV+ +      +VSGS D ++ ++D+ K K L  L  H   I +  
Sbjct: 502 PFFVGVL--RGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTL 559

Query: 89  FSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFG------------------TL 130
           +   +           K  +SAS D  + +W + D  N G                  TL
Sbjct: 560 YDHKR-----------KRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTL 608

Query: 131 KGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
            GH A +  + +  S++  +S + D S+R W+
Sbjct: 609 CGHTALVGLLGL--SDKYLVSAAADGSLRGWD 638

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 73/164 (44%), Gaps = 13/164 (7%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYD 67
           ++ GSY+HN++    D++    L+    H     +     D  ++  +S S D  ++++D
Sbjct: 525 VVSGSYDHNLMV--WDIAKMKLLYVLTGH--TDRIYSTLYDHKRKRCISASMDTTVKVWD 580

Query: 68  LQKRKELGTLLAHQGSITNLKFSKS-KTENGDGE-----GSNNKWLLSASEDNKIIIWRV 121
           L      G  ++   S + LK S S +T  G        G ++K+L+SA+ D  +  W  
Sbjct: 581 LSDINNNGP-VSQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADGSLRGWDA 639

Query: 122 KDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            D+    +   H  +        S+ + +S SE H   +++L T
Sbjct: 640 SDYSKRFSFH-HTNQSAITTFFVSDNILVSGSE-HQFNIYDLRT 681

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 39  AHALSVKCL---DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
            H   V+C+    V   +  +GSND  IR++DL   K   TL  H  ++ ++  S     
Sbjct: 111 GHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICIS----- 165

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSED 155
                 + + ++ SAS+D  +  W ++         G ++ ++ VD+HPS  + +S   D
Sbjct: 166 ------ARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRD 219

Query: 156 HSIRLWNLMTVKKAAVLKLRNY 177
             +R+W++ +  ++ VL L  +
Sbjct: 220 SVVRVWDIRS--RSCVLTLAGH 239

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 13/138 (9%)

Query: 37  FQAHALSVK--CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
            Q H ++V+  C+     Y+ S S D+ ++ +DL++   +         + ++    S  
Sbjct: 152 LQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSL- 210

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                       ++SA  D+ + +W ++      TL GH   IN V   P +   +S S 
Sbjct: 211 ----------DLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCST 260

Query: 155 DHSIRLWNLMTVKKAAVL 172
           D +++LW+L+  K    L
Sbjct: 261 DATVKLWDLVAGKPMKTL 278

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +VS   D  +R++D++ R  + TL  H+G I  ++      +           ++S S D
Sbjct: 213 IVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQ-----------IVSCSTD 261

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
             + +W +   +   TL  H   + D+  +P+     S   D  IR W L+
Sbjct: 262 ATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTD-DIRSWKLV 311

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 72/157 (45%), Gaps = 17/157 (10%)

Query: 12  SYEHNILCLSL-DLSLKTPLFTPI---FHFQAHALSVKCLD--VSKRYLVSGSNDEHIRI 65
           S E   L +SL D ++K   F  +        H L V  +D  V  + L++ S D++I+I
Sbjct: 531 SSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKI 590

Query: 66  YDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
           + +       ++ AHQ SI +++F ++ T N            S  +D  +  W    ++
Sbjct: 591 WGVDFGDCHKSIFAHQDSIMSVRF-EADTHN----------FFSCGKDGAVKRWDGDKFD 639

Query: 126 NFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
               L GH + +  + + P  R  +S S DHSIR+W 
Sbjct: 640 CIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVWQ 676

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 38  QAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENG 97
           +   ++  C       L  G  D  I+++DL  +  L     H+  +T L+         
Sbjct: 72  KPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRL-------- 123

Query: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
           D EG+    L+S S+D+ +IIW +        L+ H   I  + I  +    ISV++D  
Sbjct: 124 DSEGTR---LVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGL 180

Query: 158 IRLWNL 163
           I++W+L
Sbjct: 181 IKVWDL 186

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 16/133 (12%)

Query: 34  IFHFQAH--ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +  F  H   ++V  LD     LVSGS D  + I+DL     L  L +H+ +IT +    
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDH 167

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV-DIHPSNRVAI 150
                      N  WL+S ++D  I +W +K       ++ H+A       +     V I
Sbjct: 168 -----------NMDWLISVAKDGLIKVWDLK--AGGQCVETHMAHTGQCWSMAIDEEVII 214

Query: 151 SVSEDHSIRLWNL 163
           + S D   ++W L
Sbjct: 215 TTSMDSQAKIWEL 227

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 124/310 (40%), Gaps = 56/310 (18%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
            Q H   ++ +D+S   + L + SN E +++++L  +K + T        + +       
Sbjct: 379 LQGHRTDIRSMDISDDGKLLSTASNGE-LKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
             G  +G    + L++S                 T + H A I  +D+  + +  ++ S 
Sbjct: 438 VVGTRQGELQLFDLASST-------------LLSTTEAHTAAIWSLDLTSNGKRLVTGSA 484

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVR-------------WIGNGD-YFAVALL-N 199
           D S + W+   V++        Y    + V               I + D Y AV+LL N
Sbjct: 485 DKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDN 544

Query: 200 KVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPK 259
            V ++   + K +  +  +K  ++ ++  ++D K+ I  + +D NI  +  +        
Sbjct: 545 TVKVFFFDSLKFYLSLYGHKLPVLSIDF-SVDSKMLI-TSSADKNIKIWGVD-------- 594

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLN- 318
             +   S+  H + +   +F  +    +  S G DG V  WD +K      +DC ++LN 
Sbjct: 595 FGDCHKSIFAHQDSIMSVRFEADTHNFF--SCGKDGAVKRWDGDK------FDCIQKLNG 646

Query: 319 ------CLAV 322
                 C+AV
Sbjct: 647 HQSEVWCIAV 656

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 78/173 (45%), Gaps = 19/173 (10%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGS 58
           M      ++VG+ +  +     DL+  T L T     +AH  ++  LD++   + LV+GS
Sbjct: 430 MLPGGLLVVVGTRQGELQLF--DLASSTLLSTT----EAHTAAIWSLDLTSNGKRLVTGS 483

Query: 59  NDEHIRIYDLQKRKEL--GTLLAHQGSITNLKFSKSKTENGDGE------GSNNKWLLSA 110
            D+  + +D +  ++L  GT       I  LK     T     +       S +++L  +
Sbjct: 484 ADKSCKFWDFEVVEQLVPGT---KDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVS 540

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
             DN + ++     + + +L GH   +  +D    +++ I+ S D +I++W +
Sbjct: 541 LLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGV 593

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 257 EPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGER 316
           EP V      L GH   ++      +D G  ++S  S+G + VW++  K  +  + CG  
Sbjct: 369 EPPVRRYNVELQGHRTDIRSMDI--SDDGK-LLSTASNGELKVWNLTTKKCIRTFSCGYA 425

Query: 317 L 317
           L
Sbjct: 426 L 426

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 14/132 (10%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I     H   VK +    + +++ S D+ IR+++      + T   HQ S+ ++      
Sbjct: 345 IRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD----- 399

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
                   S  K ++SAS D  + +W V+    + TL+GH   +N V +HP +    S S
Sbjct: 400 --------SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSS 450

Query: 154 EDHSIRLWNLMT 165
           +D ++R+W++ T
Sbjct: 451 DDKTLRMWDIRT 462

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 75/189 (39%), Gaps = 33/189 (17%)

Query: 10  VGSYEHNILCLSLDLSLKTPLF--TPIFHFQAHALSVKCLDVSKRYLV--SGSNDEHIRI 65
           V SY+  I+  S D ++K         +  + H   V C+ +  +     S S+D+ +R+
Sbjct: 398 VDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457

Query: 66  YDLQKRKELGTLLAHQGSITN-LKFSKSKTEN--------------------GDGEG--- 101
           +D++    +     H G +   +  +   TEN                     D  G   
Sbjct: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517

Query: 102 SNNKW---LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158
            N K+   LLS S DN I +W V       T  GH+  +   DI   N   +S S D SI
Sbjct: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSI 575

Query: 159 RLWNLMTVK 167
           ++W+L   K
Sbjct: 576 KVWDLQNGK 584

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW 106
           +VSGS+D+ I+++DLQ  K + T   H+  I  +    S   +GD  G    W
Sbjct: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELGEVKMW 618

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 15/95 (15%)

Query: 71  RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTL 130
           R  +     H   + +LKF             N++ L + S D+ + IW  K       L
Sbjct: 302 RCRIQLFKGHMDGVLSLKF-------------NHRLLFTGSYDSTVAIWDTKSGNLIRRL 348

Query: 131 KGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            GH   +    I+  ++  I+ S D +IR+WN +T
Sbjct: 349 TGHTDGVK--GIYFDDQKMITASLDKTIRVWNYIT 381

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKS 92
           I  ++ H  SV  +D  K+ +VS S D+ ++++ ++ R    TL  H   +  +K   KS
Sbjct: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKS 443

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140
            T              S+S+D  + +W ++        +GH+ ++  V
Sbjct: 444 FT------------CYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 15/111 (13%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           +L+S S D  I+++++   + + T   H   + ++              ++N  ++S S 
Sbjct: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI-------------AADNFRIVSGSH 571

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           D  I +W +++ +   T  GH A I  V I  S+ V  S  E   +++W+ 
Sbjct: 572 DKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFV--SGDELGEVKMWHF 620

>Scas_692.25
          Length = 488

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 67/161 (41%), Gaps = 36/161 (22%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF------- 89
           F  H   V+CLDVS  +++SGS D  +R+        L   + H+  I ++KF       
Sbjct: 275 FHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTN 334

Query: 90  -SKSKTEN---------GDGEGSNNKWLLSASEDNKIIIWRVK----------------- 122
              S T N          D E  + K+  SAS D  I IW +                  
Sbjct: 335 EKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNS 394

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           +++   TLKGH + + D+ I        S S+D +IR WNL
Sbjct: 395 NFKCIMTLKGHASWVKDLRIR--GNYLFSCSDDKTIRCWNL 433

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 31  FTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL-AHQGSITNLKF 89
           F  I   + HA  VK L +   YL S S+D+ IR ++L+  + +      H G +T L  
Sbjct: 396 FKCIMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDM 455

Query: 90  SKSKTENGDGEGS 102
                 N  G+ S
Sbjct: 456 DPDGGTNDTGQQS 468

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 11/100 (11%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           I +++L  +K++ TL  H+GSI    F  + + NG       K L S S+D  IIIW + 
Sbjct: 163 IIVWELDSKKKIHTLRGHEGSI----FYVTTSNNG-------KLLASCSDDRSIIIWDMV 211

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
             +      GH ARI ++     +   ISVSED + R+WN
Sbjct: 212 SGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 18/128 (14%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + L S S+D  I I+D+   K L     H   I NLKF    T+           L+S S
Sbjct: 194 KLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQ-----------LISVS 242

Query: 112 EDNKIIIWRVKDWENFGTLK----GHIAR-INDVDIHPSNRVAISVSEDHSIRLWNLMTV 166
           ED    +W  K+ E   T+K     H+ + +  VD+  +N +AIS   D  +++  L+  
Sbjct: 243 EDCTCRVWNYKNDE--LTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRLKVTELVPH 300

Query: 167 KKAAVLKL 174
            ++  ++L
Sbjct: 301 NRSCNIEL 308

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           N II+W +   +   TL+GH   I  V    + ++  S S+D SI +W++++ K
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGK 214

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 269 GHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGE 315
           GH+ R+ + KF+ +D  T ++S+  D    VW+  K DEL + D  E
Sbjct: 221 GHTARIWNLKFFNDD--TQLISVSEDCTCRVWNY-KNDELTIKDIFE 264

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 109/268 (40%), Gaps = 48/268 (17%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L+ H+  +T +K+++     GD        L + S+D    +W   + E  GTL GH+  
Sbjct: 6   LMGHERPLTQVKYNR----EGD-------LLFTCSKDISASVWYSNNGERLGTLDGHMGS 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
           I  +D   ++   ++ S D++I++W LM       ++  N     + V +   G Y  +A
Sbjct: 55  IWSIDSDHTSLYCVTGSADYTIKVWTLM---NGQCVQTWNCPVPVKRVEFSPCGKYI-LA 110

Query: 197 LLNKVL-------IYKTAAAKVHCEIDMNKKTIMH--LETETLD----------GKIYIC 237
           +L+ V+       IY+        EI    +  +H  +  E LD          GK YI 
Sbjct: 111 ILDNVMKKPGSIEIYEVKRNPETNEITEFVEEPIHSIVTHEGLDAASVAGWSGEGK-YII 169

Query: 238 VAMSDGNIHFYPTEG--LLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDG 295
               DG I  Y T+    L E  +V         H + V D +F  +   TY ++   D 
Sbjct: 170 AGHKDGKISKYDTQDGYKLVESQQV---------HKDSVSDLQFSPDR--TYFITCSRDS 218

Query: 296 RVVVWDMEKKDELAVYDCGERLNCLAVV 323
              + D+E    L  Y+    LN  A+ 
Sbjct: 219 NAHIIDIETFKVLKTYETDSPLNSAAIT 246

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 15/107 (14%)

Query: 26  LKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKEL-GTLLAHQGSI 84
           ++ P+ + + H    A SV       +Y+++G  D  I  YD Q   +L  +   H+ S+
Sbjct: 140 VEEPIHSIVTHEGLDAASVAGWSGEGKYIIAGHKDGKISKYDTQDGYKLVESQQVHKDSV 199

Query: 85  TNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK 131
           ++L+FS  +T           + ++ S D+      + D E F  LK
Sbjct: 200 SDLQFSPDRT-----------YFITCSRDSNA---HIIDIETFKVLK 232

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 10/130 (7%)

Query: 38  QAHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLA----HQGSITNLKFSK 91
           Q H  SV  L  S  + Y ++ S D +  I D++  K L T       +  +IT LK   
Sbjct: 193 QVHKDSVSDLQFSPDRTYFITCSRDSNAHIIDIETFKVLKTYETDSPLNSAAITPLK--- 249

Query: 92  SKTENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                G G+ ++     SASE   +  I+     E  G + GH   +N + + P      
Sbjct: 250 EFVILGGGQDASEVTTTSASEGKFEARIYHKVFEEEIGRVVGHFGPLNSIAVSPQGTSYT 309

Query: 151 SVSEDHSIRL 160
           S  E+  +RL
Sbjct: 310 SGGEEGLVRL 319

>Kwal_23.5769
          Length = 627

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 28/159 (17%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I  F+ H   V  L  + R L +GS D  + I+DL   K +  L  H+  +  + F   K
Sbjct: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQK 369

Query: 94  TENGDGE---------------------------GSNNKWLLSASEDNKIIIWRVKDWEN 126
              G  +                            S  K ++S S D  + +W V+    
Sbjct: 370 LITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTC 429

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + TL+GH   +  V +HP +    S S+D +IR+W++ +
Sbjct: 430 Y-TLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRS 467

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 30/140 (21%)

Query: 56  SGSNDEHIRIYDLQKRKELGTLLAHQGSITN-LKFSKSKTEN------------------ 96
           SGS+D  IR++D++    +     H G +   L  +   TEN                  
Sbjct: 453 SGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQ 512

Query: 97  --GDGEGSN-------NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
              DG+ S           LLS S DN I +W V+  +   T  GH+  I   DI   N 
Sbjct: 513 DPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI--WDIAADNF 570

Query: 148 VAISVSEDHSIRLWNLMTVK 167
             +S + D ++++W+L + K
Sbjct: 571 RIVSGAHDKTVKVWDLQSGK 590

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 14/105 (13%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKSKTE 95
           +  H+ SV  +D  K+ +VSGS D+ ++++ ++ R    TL  H   +  +K   KS T 
Sbjct: 393 YPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRT-CYTLRGHTEWVGTVKLHPKSFT- 450

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140
                        S S+D  I +W ++        +GH+ ++  V
Sbjct: 451 -----------CFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKV 484

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEG 101
           +VSG++D+ ++++DLQ  K + T  +HQ  IT +    S+  +GD  G
Sbjct: 572 IVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDELG 619

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 50  SKRYLVSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           S+  +V+ S+D  + +++ L+  K +  +  HQ  + ++ FS            + ++++
Sbjct: 370 SEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP-----------DGRYIV 418

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           SAS DN I +W  +D +   T +GH+A +  V      R+ +S S+D ++++W++ T K
Sbjct: 419 SASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRK 477

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 21/145 (14%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +V+G+ D   RI+D   +  + TL  H   +  + +S       DGE      + + S D
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSP------DGEV-----IATGSMD 207

Query: 114 NKIIIWRVKDWENFG-TLKGHIARINDVDIHP-------SNRVAISVSEDHSIRLWNLMT 165
           N I +W  K  +  G  L+GH   I  +   P       S     S S+D +I++W+  T
Sbjct: 208 NTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWD--T 265

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNG 190
           V +     +  ++ +   V+W G G
Sbjct: 266 VSRVCQYTMSGHTNSVSCVKWGGQG 290

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 394 PIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      S+ + L+S S+D  + +W V+  +    L GH   +  VD     +   
Sbjct: 454 -----------SDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVC 502

Query: 151 SVSEDHSIRLWN 162
           S  +D  +RLW 
Sbjct: 503 SGGKDKMVRLWT 514

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 31/159 (19%)

Query: 35  FHFQAHALSVKCLDVSKRYLV-SGSNDEHIRIYDLQKR-KELGTLLAHQGSITNLKFS-- 90
           +    H  SV C+    + L+ SGS+D  +R++D+  + + +  L +H   + +L  S  
Sbjct: 272 YTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTD 331

Query: 91  ----------------------KSKTENGD----GEGSNNKWLLSASEDNKIIIWR-VKD 123
                                 K   EN +      G++ + +++AS+D  + +W  +K 
Sbjct: 332 YALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKS 391

Query: 124 WENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
            +    + GH   +N V   P  R  +S S D+SI+LW+
Sbjct: 392 TKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

>Kwal_23.5351
          Length = 474

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 10/111 (9%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           ++ +GS D  ++++D++K  +  ++LAH   ++ + F K   ENG+       +L+S+S 
Sbjct: 369 HVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEK---ENGN-------FLVSSSY 418

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           D  I ++    W    +L+GH  +I  VDI        S   D S+++W L
Sbjct: 419 DRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 94/204 (46%), Gaps = 20/204 (9%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGT----LKGHIARINDVDIHPSNRVAISVSEDHS 157
           S+++ L +   DN + IW  +   +       L+GH AR++ V  HPS+R   S S D +
Sbjct: 235 SDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMT 294

Query: 158 IRLWNLMTVKKAAVLKLR-NYSQNGQFVRWIGNGDYFAVALLNKV-LIYKTAAAKVHCEI 215
            RLW+   V++   L+L+  +++    + +  +G     A L+ V  ++     +    +
Sbjct: 295 WRLWD---VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVL 351

Query: 216 DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVK 275
           + + K I  + + + +G  ++     DG +  +          K  +P  S+L H++ V 
Sbjct: 352 EGHAKPIYGV-SWSPNGH-HVATGSGDGTVQVWDIR-------KANKPS-SILAHNSIVS 401

Query: 276 DFKFYKNDFGTYMVSIGSDGRVVV 299
           +  F K + G ++VS   D  + V
Sbjct: 402 EVNFEKEN-GNFLVSSSYDRTIGV 424

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 53/127 (41%), Gaps = 11/127 (8%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
           S R++ S S D   R++D+++  EL     H   +  L F             +   L S
Sbjct: 282 SDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQ-----------CDGSLLCS 330

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKA 169
           A  D+   +W ++   +   L+GH   I  V   P+     + S D ++++W++    K 
Sbjct: 331 AGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKP 390

Query: 170 AVLKLRN 176
           + +   N
Sbjct: 391 SSILAHN 397

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 60/148 (40%), Gaps = 30/148 (20%)

Query: 34  IFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQ-----------------KRKEL 74
           ++ FQ     + CLD S   R   +G  D +I+I+ L                  +    
Sbjct: 459 MYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTC 518

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHI 134
            TL+ H G++ +  FS            +NK+LLS SED  + +W +       + KGH 
Sbjct: 519 KTLVGHSGTVYSTSFSP-----------DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 567

Query: 135 ARINDVDIHPSNRVAISVSEDHSIRLWN 162
             + DV   P      + S D + RLW+
Sbjct: 568 HPVWDVSFSPLGHYFATASHDQTARLWS 595

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 14/134 (10%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V C+       Y+ +GS+D+  R++D+     +   L H   + ++   
Sbjct: 601 PLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVC 660

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVA 149
                  DG     +WL + SED  I +W +   +    ++GH    I  +       V 
Sbjct: 661 P------DG-----RWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVL 709

Query: 150 ISVSEDHSIRLWNL 163
           IS   DH++R+W+L
Sbjct: 710 ISGGADHTVRVWDL 723

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 70/178 (39%), Gaps = 21/178 (11%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRI 65
           ++ GS +  +   S+D        T +  ++ H   V  +  S    Y  + S+D+  R+
Sbjct: 540 LLSGSEDKTVRLWSMDT------HTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARL 593

Query: 66  YDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
           +       L     H   +  + F             N  ++ + S D    +W V   +
Sbjct: 594 WSCDHIYPLRIFAGHLNDVDCVSFHP-----------NGCYVFTGSSDKTCRMWDVSTGD 642

Query: 126 NFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQF 183
           +     GH A +  + + P  R   + SED  I +W++ T K+  + ++R + +N  +
Sbjct: 643 SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKR--LKQMRGHGKNAIY 698

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 129 TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIG 188
           TL GH   +      P N+  +S SED ++RLW++ T    A++  + ++     V +  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDT--HTALVSYKGHNHPVWDVSFSP 577

Query: 189 NGDYFAVA 196
            G YFA A
Sbjct: 578 LGHYFATA 585

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 62/153 (40%), Gaps = 30/153 (19%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAH-QGSITNLKFSKSK 93
           F  H   V  + V    R+L +GS D  I ++D+   K L  +  H + +I +L +SK  
Sbjct: 647 FLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSK-- 704

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVK----------DWENFGTLKGHIARIN-DVDI 142
                 EG+    L+S   D+ + +W +K          D    G L    A IN D+  
Sbjct: 705 ------EGN---VLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQDIKE 755

Query: 143 HPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLR 175
           +   R  I  S+     L      KK  V K++
Sbjct: 756 YGRRRTVIPTSD-----LVASFYTKKTPVFKVK 783

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 14/130 (10%)

Query: 39  AHALSVKCL---DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
            H   V+C+    V   + ++GSND  ++++DL   K   TL  H  ++ ++  S     
Sbjct: 137 GHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVS----- 191

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSED 155
                   + +L S SED  +  W ++  +      GH++ +  V IHP+  +  +   D
Sbjct: 192 ------DRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRD 245

Query: 156 HSIRLWNLMT 165
             I+LW++ T
Sbjct: 246 SVIKLWDMRT 255

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
              H ++V+ + VS R  YL S S D+ ++ +DL+K + +     H   +  +    +  
Sbjct: 178 LAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTL- 236

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                       + +A  D+ I +W ++      TL GH   IN V   P +   +S S 
Sbjct: 237 ----------DLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSST 286

Query: 155 DHSIRLWNLMTVKKAAVL 172
           D ++RLW+++  K   VL
Sbjct: 287 DATVRLWDVVAGKTMKVL 304

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 14/111 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           + +   D  I+++D++ R  + TL+ H+G I  ++ +    +           ++S+S D
Sbjct: 239 IATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQ-----------VVSSSTD 287

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSN-RVAISVSEDHSIRLWNL 163
             + +W V   +    L  H   +    +HP    VA + ++D  IR W L
Sbjct: 288 ATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDD--IRSWGL 336

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 38/165 (23%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF------S 90
           FQ H   V+ L++   Y+++GSND  IR+        L   + H+  I  +        +
Sbjct: 251 FQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLIIPMRANT 310

Query: 91  KSKTENGDGE-------------GSNNKWLLSASEDNKIIIWRVK--------------- 122
             KTE  D +                 K+ +S S DN I++W++                
Sbjct: 311 AQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKIPLPKFIPHRPPQPNLL 370

Query: 123 --DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
             ++E     KGH + + D+ +    R   S S+D SIR W+L+T
Sbjct: 371 QTNFEKVHVFKGHTSWVRDIKVR--GRHLFSCSDDRSIRCWDLVT 413

>Kwal_56.23920
          Length = 937

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 16/132 (12%)

Query: 34  IFHFQAH--ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +  F  H  A+++   D +   L+SGS D  I ++DL     L  L +H+ SIT L    
Sbjct: 110 LISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLW--- 166

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
                 +GE    +WL+S S+D  I +W +K  +   T   H+     + +H    + I+
Sbjct: 167 -----CEGE----EWLISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHED--LVIT 215

Query: 152 VSEDHSIRLWNL 163
              D+ I+LWNL
Sbjct: 216 AGADNQIKLWNL 227

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 13/126 (10%)

Query: 39  AHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H L V  +D+S   + L++ S D++I+I+ L       +L AH  SI  + F       
Sbjct: 565 GHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPE---- 620

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                S+N    S S+D  +  W    +E    L  H   +  + I    R  +S S D 
Sbjct: 621 -----SHN--FFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQ 673

Query: 157 SIRLWN 162
           SIR+W+
Sbjct: 674 SIRVWS 679

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (47%), Gaps = 7/132 (5%)

Query: 39  AHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
           AH+ ++  LD++   + LV+GS D+ +  +D Q  +E       + +     F  +  E 
Sbjct: 465 AHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLEL 524

Query: 97  GDGE-----GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
            D         +N+ L  +  DN + ++ +   + F +L GH   +  +DI   +++ I+
Sbjct: 525 NDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLIT 584

Query: 152 VSEDHSIRLWNL 163
            S D +I++W L
Sbjct: 585 SSADKNIKIWGL 596

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 61/125 (48%), Gaps = 20/125 (16%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDV-SKRYLVSGSNDEHIRI 65
           R+I GS + +I+   L   +       ++  ++H  S+  L    + +L+S S D  I++
Sbjct: 131 RLISGSRDSDIIVWDLVGEVG------LYKLRSHKDSITGLWCEGEEWLISTSKDGLIKV 184

Query: 66  YDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
           +DL+ ++ + T +AH G   ++             G +   +++A  DN+I +W +   E
Sbjct: 185 WDLKVQQCVETHVAHVGECWSM-------------GVHEDLVITAGADNQIKLWNLNFEE 231

Query: 126 NFGTL 130
           + G++
Sbjct: 232 SAGSM 236

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 64/154 (41%), Gaps = 40/154 (25%)

Query: 37  FQAHALSVKCLDVSK----RYLVSGSNDEHIRIYDLQKRKEL------------------ 74
           F+ H  +V+CLD+ +    +Y+V+GS D  + ++ L K   +                  
Sbjct: 459 FKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEE 518

Query: 75  -----GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGT 129
                G L  H  S+        +T +G G       ++S S DN +I+W V   +    
Sbjct: 519 NPYFVGVLRGHMASV--------RTVSGHGN-----IVVSGSYDNTLIVWDVAQMKCLYI 565

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           L GH  RI         +  IS S D +IR+W+L
Sbjct: 566 LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDL 599

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 16/139 (11%)

Query: 29  PLFTPI-FHFQAHALSV-KCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN 86
           P F P     + H  SV  CL     Y+++G++D+ IR+YD   +K L  L  H G +  
Sbjct: 368 PKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWA 427

Query: 87  LKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI--HP 144
           LK++                L+S S D  + +W +K        KGH + +  +DI  + 
Sbjct: 428 LKYAHGGI------------LVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYK 475

Query: 145 SNRVAISVSEDHSIRLWNL 163
           + +  ++ S D+++ +W L
Sbjct: 476 NIKYIVTGSRDNTLHVWKL 494

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 39  AHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H L V  +D+S   + +++ S D++I+I+ L       +L AHQ SI N+KF       
Sbjct: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE---- 620

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                S+N    S S+D  +  W    ++    L GH   +  + +    +  +SVS D 
Sbjct: 621 -----SHN--FFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDR 673

Query: 157 SIRLW 161
           SIR+W
Sbjct: 674 SIRVW 678

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 65/141 (46%), Gaps = 16/141 (11%)

Query: 23  DLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQG 82
           D+  +T L   +FH  + A+++   D +   L+SGS D  I ++DL     L  L +H+ 
Sbjct: 103 DMQTQTVLI--VFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKD 160

Query: 83  SITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI 142
           +IT +               N+ WL+S S+D  I +W +K  +   T   H      + +
Sbjct: 161 AITGI------------WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208

Query: 143 HPSNRVAISVSEDHSIRLWNL 163
              + + I+ + +  I+LW L
Sbjct: 209 --KDNMVITANAESEIKLWEL 227

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 12/110 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L  G  D  I+I+D+Q +  L    +H  +IT L+F ++ T            L+S S D
Sbjct: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTR-----------LISGSRD 138

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
             II+W +        L+ H   I  +     + + ISVS+D  I+LW++
Sbjct: 139 ATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL-ISVSKDGLIKLWDM 187

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 38  QAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKEL--GTLLAHQGSITNLKFSKSK 93
           +AH  ++  LD++   + LV+ S D+ ++ +D +  +EL  GTL      +  +K     
Sbjct: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTL---DKFVPKMKLIHDT 520

Query: 94  TENGDGE-------GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSN 146
           T +  GE          +++L  +  DN + ++ +   + F +L GH   +  +DI   +
Sbjct: 521 TLDL-GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDS 579

Query: 147 RVAISVSEDHSIRLWNL 163
           ++ I+ S D +I++W L
Sbjct: 580 KLIITSSADKNIKIWGL 596

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 46  CLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           C+ +S   R+L     D  ++++ L   K   +L  H+  + ++  S            +
Sbjct: 530 CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISH-----------D 578

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           +K ++++S D  I IW +   +   +L  H   I +V   P +    S S+D +++ W+
Sbjct: 579 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 26/179 (14%)

Query: 9   IVGSYEH--NILCLSLDLSLKTPLF-----TPIFHFQAHALSVKCLD-VSKR------YL 54
           I+ S+ H  N L LS D +L+   F      P    +A   ++K  + ++KR       +
Sbjct: 315 ILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELM 374

Query: 55  VSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           V+ S+D  + +++ L+  K +  +  HQ  + ++ FS            + + ++SAS D
Sbjct: 375 VTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFS-----------PDGRHIVSASFD 423

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           N I +W  +D +   T +GH+A +  V      R+ +S S+D ++++W++ T K A  L
Sbjct: 424 NSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDL 482

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI     H   V  +  S   R++VS S D  I++++ +  K + T   H  S+  + +S
Sbjct: 394 PITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      S+ + L+S S+D  + +W VK  +    L GH   +  VD     +   
Sbjct: 454 -----------SDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVC 502

Query: 151 SVSEDHSIRLWN 162
           S  +D  +RLW 
Sbjct: 503 SGGKDKMVRLWT 514

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 14/160 (8%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIR 64
           R+I G+ ++       D + +TP+ T   HF      V C+  S     + +GS D  IR
Sbjct: 158 RMITGAGDNTARIW--DCNTQTPMSTLKGHFNW----VLCVSWSPDGELIATGSMDNTIR 211

Query: 65  IYDLQKRKELG-TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD 123
           +++  K + +G  L  H   IT+L +           G   + L SAS+D  I IW    
Sbjct: 212 LWEGNKGQPVGDALRGHGKWITSLSWEPIHLVK---PGQKPR-LASASKDGTIKIWDTTR 267

Query: 124 WENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
                TL GH + ++ +       V  S S D +IR W++
Sbjct: 268 RVCLITLSGHTSSVSCIKWG-GQGVLYSGSHDKTIRAWDM 306

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 126/281 (44%), Gaps = 31/281 (11%)

Query: 35  FHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F      L+  C   +K + V+  N     + +L    + GT  A+  S  +L + +S  
Sbjct: 326 FSNNGEYLATGCNKTTKIFEVATGN----LVTELVDDTKTGTEDANSASSADL-YIRSVC 380

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
            + DG     K+L + +ED  I IW +   +    L+GH   I  +D   S    +S S 
Sbjct: 381 FSPDG-----KFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSG 435

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWI--GNGDYFAVALLNK-VLIYKTAAAKV 211
           D +IR+W+L T + +  L +    ++G     +  GNG+Y A   L++ V ++ + +  +
Sbjct: 436 DRTIRIWDLHTGQCSLTLSI----EDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFL 491

Query: 212 HCEIDMNKKT-IMHLETE-----TLDGKIYICVAMSDGNIHFYPTEGL----LTEEPKVE 261
              +D   +T + H ++      T DGK  +  ++ D ++  +    +     + +PK E
Sbjct: 492 VERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSL-DRSVKLWNLRNINGASTSPQPKTE 550

Query: 262 -EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
              E + +GH + V      +ND   Y++S   D  V+ WD
Sbjct: 551 GNCEMTYIGHKDFVLSVTTTEND--QYILSGSKDRGVIFWD 589

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 57/125 (45%), Gaps = 13/125 (10%)

Query: 39  AHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H L V  +D+S   + +V+ S D++I+I+ L       +L AHQ SI N+KF       
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP----- 622

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
              E  N     S S+D  +  W  + +E    L  H + +  + +       IS   DH
Sbjct: 623 ---ESYN---FFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676

Query: 157 SIRLW 161
           SIR+W
Sbjct: 677 SIRVW 681

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 16/141 (11%)

Query: 23  DLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQG 82
           DL  KT L +  F+    A++V   D +   L+S S D  I ++DL     L  L +H+ 
Sbjct: 107 DLISKTVLIS--FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKD 164

Query: 83  SITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI 142
           +IT L     + EN         WL+S S+D  + IW +K  +   T   H      + I
Sbjct: 165 AITGL---WCEDEN---------WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212

Query: 143 HPSNRVAISVSEDHSIRLWNL 163
                +A++ S D  ++LW L
Sbjct: 213 --IEDMAVTCSADSQVKLWKL 231

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 39  AHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
           AH  ++  LD++   R LV+GS D+ +R +  +   E+        ++  L+     T  
Sbjct: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE-VSEVPVSDESNKTMPMLQLFHDTTLE 526

Query: 97  GDGE------GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
            D +        ++K++  +  DN + ++ +   + F +L GH   +  +DI   +++ +
Sbjct: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIV 586

Query: 151 SVSEDHSIRLWNL 163
           + S D +I++W L
Sbjct: 587 TCSADKNIKIWGL 599

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 15/144 (10%)

Query: 23  DLSLKTPLFTPIFHFQAHALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           D S KT     +FH     L    L V      +++     D  ++++ L   K   +L 
Sbjct: 508 DESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLY 567

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIN 138
            H+  + ++  S            ++K +++ S D  I IW +   +   +L  H   I 
Sbjct: 568 GHKLPVLSMDIS-----------YDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIM 616

Query: 139 DVDIHPSNRVAISVSEDHSIRLWN 162
           +V   P +    S S+D +++ W+
Sbjct: 617 NVKFLPESYNFFSCSKDATVKYWD 640

>Scas_720.95
          Length = 515

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 62/115 (53%), Gaps = 12/115 (10%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           +V+ S+D  + +++ L+  K +  +  HQ  + ++ FS            + ++++SAS 
Sbjct: 374 MVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP-----------DGRYIVSASF 422

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           DN I +W  +D +   T +GH+A +  V      R+ +S S+D ++++W++ T K
Sbjct: 423 DNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRK 477

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 23/146 (15%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +V+G+ D   RI+D   +    TL  H   +  + +             N + + + S D
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCP-----------NGEVIATGSMD 207

Query: 114 NKIIIWRVKDWENFG-TLKGHIARINDVDIHP--------SNRVAISVSEDHSIRLWNLM 164
           N I +W  KD +  G  L+GH+  I  +   P        S R+A S S+D +IR+W++ 
Sbjct: 208 NTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLA-SASKDGTIRIWDI- 265

Query: 165 TVKKAAVLKLRNYSQNGQFVRWIGNG 190
             ++  +  +  ++ +   ++W G G
Sbjct: 266 -TRRVCLYTMSGHTNSVSCIKWSGQG 290

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 109/282 (38%), Gaps = 26/282 (9%)

Query: 23  DLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELG-TLLAHQ 81
           D   +TP  T   HF        C +     + +GS D  IR++D +  K LG  L  H 
Sbjct: 172 DCDTQTPKATLTGHFNWVLCVSYCPN--GEVIATGSMDNTIRLWDSKDGKPLGDALRGHL 229

Query: 82  GSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVD 141
             IT+L +         GE      L SAS+D  I IW +       T+ GH   ++ + 
Sbjct: 230 KWITSLAWEPIHLVK-PGESPR---LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIK 285

Query: 142 IHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKV 201
                 +  S S D ++R+W+ M      +  L++++       W+ N    +     +V
Sbjct: 286 WS-GQGIIYSGSHDKTVRVWD-MNADGKCINILKSHAH------WV-NHLSLSTDYALRV 336

Query: 202 LIYKTAAAKVHCEIDMNKKTIMHLE-TETLDGKI-YICVAMSDGNIHFYPTEGLLTEEPK 259
             +    A+     D   K + + E     +GK+  + V  SD    F      L    K
Sbjct: 337 GAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMF------LWNPLK 390

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
             +P   + GH   V    F  +  G Y+VS   D  + +WD
Sbjct: 391 SNKPIARMTGHQKLVNHVAFSPD--GRYIVSASFDNSIKLWD 430

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +  K + T   H  S+  + +S
Sbjct: 394 PIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS 453

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      ++ + L+S S+D  + +W V+  +    L GH   +  VD     +   
Sbjct: 454 -----------ADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVC 502

Query: 151 SVSEDHSIRLWN 162
           S  +D  +R+W 
Sbjct: 503 SGGKDKMVRIWT 514

>Kwal_23.6324
          Length = 514

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 90/183 (49%), Gaps = 26/183 (14%)

Query: 9   IVGSYEH--NILCLSLDLSLKTPLF-----TPIFHFQAHALSVKCLD-VSKR------YL 54
           I+ S+ H  N L L+ D +L+   F      P    +A A ++K  + ++K+       +
Sbjct: 314 ILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELM 373

Query: 55  VSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           V+ S+D  + ++D L+  K +  +  HQ  + ++ FS            + ++++SAS D
Sbjct: 374 VTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP-----------DGRYIVSASFD 422

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLK 173
           N I +W  ++     T +GH+A +  V      R+ +S S+D ++++W++ T K +  L 
Sbjct: 423 NSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLP 482

Query: 174 LRN 176
             N
Sbjct: 483 GHN 485

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 72/164 (43%), Gaps = 21/164 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +V+GS D   RI+D      + TL  H   +  + +        DGE      + + S D
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCP------DGE-----LIATGSMD 206

Query: 114 NKIIIWRVKDWENFG-TLKGHIARINDVDIHPSNRVA-------ISVSEDHSIRLWNLMT 165
           N I +W     E++G  L+GH   I  +   P + V         S S+D +I++W+  T
Sbjct: 207 NTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWD--T 264

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAA 209
            ++  VL L  ++ +   V+W G G  ++ +    +  +  AA 
Sbjct: 265 TRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAG 308

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 13/132 (9%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           PI     H   V  +  S   RY+VS S D  I+++D +    + T   H  S+  + +S
Sbjct: 393 PITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWS 452

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      S+ + L+S S+D  + +W V+  +    L GH   +  VD     +   
Sbjct: 453 -----------SDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVC 501

Query: 151 SVSEDHSIRLWN 162
           S  +D  +R+W 
Sbjct: 502 SAGKDKMVRIWT 513

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 107/271 (39%), Gaps = 45/271 (16%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L  H+ S+T +K+++     GD        + S ++D+   +W   + E  GT +GH+  
Sbjct: 6   LKGHERSLTQVKYNR----EGD-------LIFSCAKDSVASVWYAINGERLGTFEGHMGT 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLW------NLMTVKKAAVLKLRNYSQNGQFVRWIGNG 190
           I  +D+      A++ S D S++LW      N+ T K    ++   +S  G  +  + +G
Sbjct: 55  IWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTWKTKTPVRRVEFSPAGDKILAVLDG 114

Query: 191 DYFAVALLNKVLIYKTAAAKVHCEI-DMNKKTIMHLETE-----------TLDGKIYICV 238
               +     V +Y         EI ++N++ +  + T              +GK YI  
Sbjct: 115 ---VMGYAGSVTVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGK-YIVA 170

Query: 239 AMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVV 298
              DG +  Y  E          E   SL  H   V D +F  +   TY ++   D    
Sbjct: 171 GHKDGKVSKYDGEN--------GEYLDSLELHEQSVSDIQFSPDR--TYFITSSRDSASK 220

Query: 299 VWDMEKKDELAVY--DCGERLNCLAVVDETV 327
           + D+   D L  Y  DC     C+  + E V
Sbjct: 221 LVDVTSFDVLKTYEADCPLNSACITPLKEFV 251

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 29  PLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLK 88
           P+F  + H      SV       +Y+V+G  D  +  YD +  + L +L  H+ S+++++
Sbjct: 143 PVFEILTHDDFGIASVASWGFEGKYIVAGHKDGKVSKYDGENGEYLDSLELHEQSVSDIQ 202

Query: 89  FSKSKT 94
           FS  +T
Sbjct: 203 FSPDRT 208

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 36  HFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
            F  H   V  +D+ K+   ++SGS D+ I+++ + K + L TLL H   ++ ++   ++
Sbjct: 102 RFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRVVPNE 160

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
             + D        ++SA  D  +  W +  ++      GH + IN +   P   +  S  
Sbjct: 161 KADDDSVT-----IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAG 215

Query: 154 EDHSIRLWNLMTVKKAAVLKLRN 176
           +D  I LWNL   K    L  ++
Sbjct: 216 KDGEIMLWNLAAKKAMYTLSAQD 238

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 15/96 (15%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S          G  N  LLSAS D  +I W++  D + FG    +
Sbjct: 11  GTLEGHNGWVTSLATS---------AGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            KGH   + D  +      A+S S D ++RLW++ T
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVAT 96

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           ++  + LSAS D  + +W V   E +    GH + +  VDI     + IS S D +I++W
Sbjct: 75  ADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVW 134

Query: 162 NL 163
            +
Sbjct: 135 TI 136

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 103/228 (45%), Gaps = 14/228 (6%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           + K+L + +ED  I IW ++  +   TLKGH   I  +D  PS    +S S D ++R+W+
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 163 LMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNK-VLIYKTAAAKVHCEIDM-NKK 220
           L T   +  L + +           G G + A   L++ V ++ +    +   +D  N+ 
Sbjct: 477 LTTGTCSLTLSIEDGVTT--VAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENEL 534

Query: 221 TIMHLETE-----TLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVK 275
              H ++      T DGK  +  ++ D ++  +   GL  ++    E E +  GH + V 
Sbjct: 535 GTGHRDSVYSVVFTRDGKGVVSGSL-DRSVKLWNLNGLSGQKSHA-ECEVTYTGHKDFVL 592

Query: 276 DFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVV 323
                +ND   Y++S   D  V+ WD +  + L +   G R + ++V 
Sbjct: 593 SVATTQND--EYILSGSKDRGVLFWDTKSGNPLLMLQ-GHRNSVISVT 637

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 102/278 (36%), Gaps = 38/278 (13%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C     ++L +G+ D+ IRI+DL+ +K + TL  H+  I +L +            S NK
Sbjct: 413 CFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFP----------SGNK 462

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV-SEDHSIRLWNLM 164
            L+S S D  + IW +       TL      +  V + P     I+  S D ++R+W+  
Sbjct: 463 -LVSGSGDRTVRIWDLTTGTCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTVRVWDSD 520

Query: 165 TVKKAAVLKLRNYSQNGQ-----FVRWIGNGDYFAVALLNKVL----IYKTAAAKVH--C 213
           T      L   N    G       V +  +G       L++ +    +   +  K H  C
Sbjct: 521 TGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAEC 580

Query: 214 EIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNR 273
           E+         L   T     YI     D  + F+ T        K   P   L GH N 
Sbjct: 581 EVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDT--------KSGNPLLMLQGHRNS 632

Query: 274 VKDFKFYKN-----DFGTYMVSIGSDGRVVVWDMEKKD 306
           V             ++G +    G D +  +W   KK+
Sbjct: 633 VISVTVANGHPLGPEYGVFATGSG-DCKARIWKYSKKN 669

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 78/180 (43%), Gaps = 40/180 (22%)

Query: 34  IFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELG-TLLAHQGSITNLKFS 90
           +  F+AH   ++ + V  +K ++++GS+D  I++++ +K      T   H+  + ++ F+
Sbjct: 90  VTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFN 149

Query: 91  KSKTENGDGEG------------------------------------SNNKWLLSASEDN 114
             K  N    G                                     +  +L++ S+D 
Sbjct: 150 -PKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDG 208

Query: 115 KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKL 174
            I +W  +   N  TL+GH+A ++    HP+  + IS SED ++++WN  T K    L +
Sbjct: 209 TIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLNI 268

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 24/149 (16%)

Query: 4   NQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHAL-SVKCLDV----SKRYLVSGS 58
           NQF    G  +H I   S+   +      P F  +AH    V  +D      K YL++ S
Sbjct: 154 NQFA--SGCLDHTIKVWSIGQDV------PNFTLKAHETKGVNYVDYYPLQDKPYLITTS 205

Query: 59  NDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           +D  I+++D Q +  + TL  H  +++   F  +              ++S SED  + I
Sbjct: 206 DDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTL-----------PIIISGSEDGTLKI 254

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNR 147
           W    ++   TL   + R   +  HPS +
Sbjct: 255 WNANTYKLEKTLNIGLERSWCIATHPSGK 283

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 56/116 (48%), Gaps = 15/116 (12%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K ++V GS+D  +R+Y+    +++    AH   I ++    +K            ++L+ 
Sbjct: 67  KNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTK-----------PFVLTG 115

Query: 111 SEDNKIIIWRV-KDWENFGTLKGHIARINDVDIHP--SNRVAISVSEDHSIRLWNL 163
           S+D  I +W   K+W    T  GH   +  V  +P   N+ A S   DH+I++W++
Sbjct: 116 SDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFA-SGCLDHTIKVWSI 170

>Kwal_47.17555
          Length = 417

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 16/123 (13%)

Query: 43  SVKCLDVSKR---YL-VSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGD 98
           S  C+D  +    YL  +G     I IYD Q      TL  H   IT++KF  S      
Sbjct: 107 SFTCIDQYESDGDYLYATGDQGGIISIYDSQAEVTR-TLEGHYAEITDVKFFPS------ 159

Query: 99  GEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158
                 + LLS S D ++ +W   D  N  TLKGH + +  + I    R  +S S+D S+
Sbjct: 160 -----GEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSL 214

Query: 159 RLW 161
           +LW
Sbjct: 215 KLW 217

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           S+  +L +  +   II       E   TL+GH A I DV   PS  V +S S D  +++W
Sbjct: 116 SDGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVW 175

Query: 162 NLMTVKKAAVLK 173
           + +       LK
Sbjct: 176 STLDGSNPRTLK 187

>Kwal_27.11126
          Length = 996

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (51%), Gaps = 14/124 (11%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K ++ +G+  + + ++DL+  + L     H+G+I  +  SK           N K+  S 
Sbjct: 151 KVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASK-----------NGKYAASC 199

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM---TVK 167
           S+D  I +W +K  +   T  GH ARI ++    ++   ISVSED + R+W++    T+ 
Sbjct: 200 SDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLS 259

Query: 168 KAAV 171
           +A+V
Sbjct: 260 QASV 263

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           +K     K Y+ +G+    + I+DL    ++  LL H+GSI  +  S           +N
Sbjct: 142 IKVFGPDKVYVNAGTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLS-----------NN 190

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
            +++ S S+D  I +W ++  +       H ARI ++    ++   ISVSED + R+WN+
Sbjct: 191 GRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNI 250

Query: 164 M 164
           +
Sbjct: 251 I 251

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 26/127 (20%)

Query: 193 FAVALLNKVLIYKTAAAKVHCEIDMNK-----KTIMHLETETLDG--KIYICVAMSDGNI 245
           + +   NKVLI       ++CE+   K     ++I++     + G  K+Y+      G +
Sbjct: 107 YLLTCYNKVLI-----CDLNCEVLFRKSLGGERSILYSGIIKVFGPDKVYVNAGTVMGGV 161

Query: 246 HFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKN--DFGTYMVSIGSDGRVVVWDME 303
             +     L  E K+     +LLGH   +    FY N  + G Y+ S   D  + +WD+E
Sbjct: 162 IIWD----LFSETKIH----NLLGHEGSI----FYVNLSNNGRYVASCSDDRSIRLWDLE 209

Query: 304 KKDELAV 310
              +L+V
Sbjct: 210 TGKQLSV 216

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 14/134 (10%)

Query: 33  PIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           P+  F  H   V  +       Y+ +GS+D+  R++D+     +   L H   + + + S
Sbjct: 609 PLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVS 668

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVA 149
                  DG     +WL + SED  I +W +   +    ++GH    ++ +  +    V 
Sbjct: 669 P------DG-----RWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVL 717

Query: 150 ISVSEDHSIRLWNL 163
           IS   DHS+R+W++
Sbjct: 718 ISGGADHSVRVWDV 731

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 76  TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
           TL+ H G++ +  FS            +N +L+S SED  + +W +         KGH  
Sbjct: 528 TLVGHSGTVYSTSFSP-----------DNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH 576

Query: 136 RINDVDIHPSNRVAISVSEDHSIRLW 161
            + DV   P      S S D + RLW
Sbjct: 577 PVWDVKFSPLGHYFASASHDQTARLW 602

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 71/183 (38%), Gaps = 21/183 (11%)

Query: 1   MAKNQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGS 58
            + +   ++ GS +  +   S+D        T + +++ H   V  +  S    Y  S S
Sbjct: 541 FSPDNMYLVSGSEDKTVKLWSMDT------HTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 59  NDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           +D+  R++       L     H   +  + F             N  ++ + S D    +
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHP-----------NGCYVFTGSSDKTCRM 643

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYS 178
           W V   ++     GH A +    + P  R   + SED  I LW++ T K+  + ++R + 
Sbjct: 644 WDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKR--IKQMRGHG 701

Query: 179 QNG 181
           +N 
Sbjct: 702 KNA 704

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 66/183 (36%), Gaps = 55/183 (30%)

Query: 129 TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIG 188
           TL GH   +      P N   +S SED +++LW++ T    A++  + ++     V++  
Sbjct: 528 TLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDT--HTALVNYKGHNHPVWDVKFSP 585

Query: 189 NGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFY 248
            G YFA A                           H +T     +++ C        H Y
Sbjct: 586 LGHYFASA--------------------------SHDQT----ARLWAC-------DHIY 608

Query: 249 PTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDEL 308
           P                   GH+N V    F+ N  G Y+ +  SD    +WD+   D +
Sbjct: 609 PLR--------------IFAGHTNDVDTVSFHPN--GCYVFTGSSDKTCRMWDVSTGDSV 652

Query: 309 AVY 311
            ++
Sbjct: 653 RLF 655

>Scas_713.50
          Length = 983

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 13/125 (10%)

Query: 39  AHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H L V  +D+S   + +++ S D++I+I+ L       +L AHQ SI N+KF       
Sbjct: 609 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPE---- 664

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                S+N    S S+D  I  W    +E    L  H + +  + I       +S S DH
Sbjct: 665 -----SHN--FFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHDH 717

Query: 157 SIRLW 161
           SIR+W
Sbjct: 718 SIRIW 722

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 8/135 (5%)

Query: 32  TPIFHFQAHALSVKCL--DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T + +   H+ ++  L  D S   L+SGS D +I ++DL     L  L +H+ +IT +  
Sbjct: 139 TVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWC 198

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV-DIHPSNRV 148
             ++  N + E +   WL+S S+D  I IW +K  +    ++ HIA   +   +   N +
Sbjct: 199 --NEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQ---CVETHIAHTGECWSLAVRNDL 253

Query: 149 AISVSEDHSIRLWNL 163
            I+ S D  ++ W L
Sbjct: 254 VITTSSDSQVKFWQL 268

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 20/119 (16%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L  G ND  ++++DL  +  L  L  H  +IT LKF  S T            L+S S D
Sbjct: 121 LAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTR-----------LISGSRD 169

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDV---DIHPSNRVA------ISVSEDHSIRLWNL 163
           + II+W +        L+ H   I  +   ++  +N+        IS S+D  I++W+L
Sbjct: 170 SNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDL 228

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 65/133 (48%), Gaps = 7/133 (5%)

Query: 38  QAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKEL--GT---LLAHQGSITNLKFS 90
           +AH  ++  LD++   + L++GS D+ ++ ++ Q  +EL  GT    +   G   +    
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
            S           +K+L  +  DN + ++ +   + F +L GH   +  +DI   +++ I
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 151 SVSEDHSIRLWNL 163
           + S D +I++W L
Sbjct: 628 TSSADKNIKIWGL 640

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 24/123 (19%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKR--------YLVSGS 58
           R+I GS + NI+    DL  +  L+    H  A    + C +V+          +L+S S
Sbjct: 162 RLISGSRDSNIIVW--DLVSEVGLYKLRSHKDA-ITGIWCNEVTNNNQEENELDWLISTS 218

Query: 59  NDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
            D  I+I+DL+ ++ + T +AH G   +L                N  +++ S D+++  
Sbjct: 219 KDGLIKIWDLKIQQCVETHIAHTGECWSL-------------AVRNDLVITTSSDSQVKF 265

Query: 119 WRV 121
           W++
Sbjct: 266 WQL 268

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 44/205 (21%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRI 65
           IIVGS +  I   + +   K      +  F+AH   ++ + V  +K Y++SGS+D  +++
Sbjct: 70  IIVGSDDFRIRVFNYNTGEK------VVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKL 123

Query: 66  YDLQKRKEL-GTLLAHQGSITNLKFSK---------------------SKTEN-----GD 98
           ++ +    L  T   H+  +  + F+                        T N     G 
Sbjct: 124 WNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 183

Query: 99  GEGSN---------NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
             G N           ++++AS+D  I IW  +      TL+GH++ ++    HP+  + 
Sbjct: 184 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPII 243

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKL 174
           IS SED ++++WN  T K    L +
Sbjct: 244 ISGSEDGTLKIWNSSTYKVEKTLNV 268

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K Y+++ S+D  I+I+D Q +  + TL  H  +++   F  +              ++S 
Sbjct: 198 KPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTL-----------PIIISG 246

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
           SED  + IW    ++   TL   + R   +  HP+ R
Sbjct: 247 SEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGR 283

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           W++  S+D +I ++     E     + H   I  + +HP+    +S S+D +++LWN
Sbjct: 69  WIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWN 125

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 55/118 (46%), Gaps = 19/118 (16%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K +++ GS+D  IR+++    +++    AH   I ++    +K            ++LS 
Sbjct: 67  KNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTK-----------PYVLSG 115

Query: 111 SEDNKIIIWRVKDWENF----GTLKGHIARINDVDIHPSNRVAI-SVSEDHSIRLWNL 163
           S+D  + +W   +WEN      T +GH   +  V  +P +     S   D ++++W+L
Sbjct: 116 SDDLTVKLW---NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL 170

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 69/156 (44%), Gaps = 29/156 (18%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF------- 89
           FQ H+  V+ +DV   Y++SGS+D  +R+        L     H+  I  +KF       
Sbjct: 293 FQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDS 352

Query: 90  --SKSKTENGDG-EGSNNKWLLSASEDNKIIIWRVK-----------------DWENFGT 129
              + +T + D  +    ++ +SAS D  I IW +                  ++    T
Sbjct: 353 PEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLT 412

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           LKGH++ + D+ I    +   S ++D S+R W+L T
Sbjct: 413 LKGHLSWVRDISIR--GQYLFSCADDKSVRCWDLNT 446

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 64/311 (20%), Positives = 110/311 (35%), Gaps = 77/311 (24%)

Query: 33  PIFHFQAHALSVKCLDV---------SKRYLV--SGSNDEHIRIYDLQ----KRKELGTL 77
           P+   Q+H  ++  +DV          K YLV  + S D  I ++       K +++ +L
Sbjct: 190 PLASLQSHTKAITSMDVLFTNYTNSSKKNYLVIVTASKDLQIHVFKWVSEECKFQQIRSL 249

Query: 78  LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARI 137
           L H+  ++ +K           + +N+  + S S D  + IW   +  +  T + H   +
Sbjct: 250 LGHEHIVSAVKI---------WQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWV 300

Query: 138 NDVDIHPSNRVAISVSEDHSIRL--WNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAV 195
             +D+       IS S D ++RL  W                S NG  V   G G  F +
Sbjct: 301 RSIDV--LGDYIISGSHDTTLRLTHWP---------------SGNGLSV---GTGHEFPI 340

Query: 196 ALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLD-----GKIYICVAMSDGNIHFY-- 248
             +  +   + +               +   T + D     G  Y   A  D  I  +  
Sbjct: 341 EKVKFIHFIEDSPE-------------IRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEI 387

Query: 249 PTEGLLTEEPKVEEPE-------FSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           P   L+     +  P         +L GH + V+D        G Y+ S   D  V  WD
Sbjct: 388 PLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIR----GQYLFSCADDKSVRCWD 443

Query: 302 MEKKDELAVYD 312
           +     L V++
Sbjct: 444 LNTGQCLHVWE 454

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 105/262 (40%), Gaps = 44/262 (16%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S ++             LLS S D  +I W++  + + +G    +
Sbjct: 27  GTLEGHNGWVTSLSTSPAQPNM----------LLSGSRDKTLITWKLTGEDQQYGVPVRS 76

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK--------KAAVLKLRNYSQNG 181
            KGH   + D  +    + A+S S D ++RLW+L + K        K+ V+ +    +  
Sbjct: 77  FKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRAT 136

Query: 182 QFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNK--KTIMHLETETLDGKIYICVA 239
           Q V         + +    V ++ T    V   +  N     +    +E  D  + +  A
Sbjct: 137 QIV---------SASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISA 187

Query: 240 MSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVV 299
             D  +  +  +    E           +GH+N V       +  G+   S G DG++++
Sbjct: 188 GMDKVVKVWDLQSFTIEA--------DFIGHNNYVTTVTPSPD--GSIFASAGKDGQIIL 237

Query: 300 WDMEKKDELAVYDCGERLNCLA 321
           W++ +K  L   D  + +  +A
Sbjct: 238 WNLNEKTALYTLDAKDEVFAVA 259

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 9/132 (6%)

Query: 34  IFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           I  F  H   V  + +  R   +VS S D+ +++++      + TLL H   ++N++ + 
Sbjct: 116 IKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVV-TLLGHNDWVSNVRIAP 174

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAIS 151
           S  E  D   +    ++SA  D  + +W ++ +       GH   +  V   P   +  S
Sbjct: 175 S--EKSDDAVT----VISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFAS 228

Query: 152 VSEDHSIRLWNL 163
             +D  I LWNL
Sbjct: 229 AGKDGQIILWNL 240

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 61/115 (53%), Gaps = 12/115 (10%)

Query: 54  LVSGSNDEHIRIYD-LQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           +V+ S+D  + +++ L+  K +  +  HQ  + ++ FS            + K+++SAS 
Sbjct: 376 MVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP-----------DGKYIVSASF 424

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
           DN I +W  K+     T +GH+A +  V      R+ +S S+D ++++W++ T K
Sbjct: 425 DNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 479

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 111/290 (38%), Gaps = 36/290 (12%)

Query: 32  TPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELG-TLLAHQGSITNLK 88
           TP      H   V C+  S     + +GS D  IR++D +  K LG  L  H   IT+L 
Sbjct: 179 TPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLT 238

Query: 89  FSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRV 148
           +           GS  + L SAS+D  I IW         TL GH   ++ V       +
Sbjct: 239 WEPIHLVE---PGSKPR-LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWG-GEGI 293

Query: 149 AISVSEDHSIRLWNL------MTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVL 202
             S S D ++R W++      + + K+    + + S +  +   +G  DY  V   N   
Sbjct: 294 LYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANA-- 351

Query: 203 IYKTAAAKVHCEID-MNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVE 261
             K A  K     + + +K   H E         + V  SD    F      L    K  
Sbjct: 352 --KEARDKALQNYEKVARKNGKHEE---------LMVTASDDFTMF------LWNPLKGT 394

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVY 311
           +P   + GH   V    F  +  G Y+VS   D  + +WD ++   L+ +
Sbjct: 395 KPISRMTGHQKLVNHVAFSPD--GKYIVSASFDNSIKLWDGKEGTFLSTF 442

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 68/157 (43%), Gaps = 17/157 (10%)

Query: 11  GSYEHNILCLSLDLS--LKTPL--FTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIR 64
           G +E  ++  S D +  L  PL    PI     H   V  +  S   +Y+VS S D  I+
Sbjct: 370 GKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIK 429

Query: 65  IYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDW 124
           ++D ++   L T   H  S+  + +S           S+ + L+S S+D  + +W VK  
Sbjct: 430 LWDGKEGTFLSTFRGHVASVYQVAWS-----------SDCRLLVSCSKDTTLKVWDVKTR 478

Query: 125 ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           +    L GH   +  VD     +   S  +D  +RLW
Sbjct: 479 KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 21/149 (14%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           +V+G  D   RI+D   +    TL  H+  +  + +S       DGE      + + S D
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWS------ADGEV-----IATGSMD 209

Query: 114 NKIIIWRVKDWENFG-TLKGHIARINDVDIHP-------SNRVAISVSEDHSIRLWNLMT 165
           N I +W  +  +  G  L+GH   I  +   P       S     S S+D +IR+W+  +
Sbjct: 210 NTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWD--S 267

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFA 194
            ++  ++ L  ++ +   V+W G G  ++
Sbjct: 268 SRRVCLMTLGGHTNSVSCVKWGGEGILYS 296

>Kwal_27.12053
          Length = 755

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (41%), Gaps = 24/124 (19%)

Query: 52  RYLVSGSNDEHIRIYDLQ-------------KRKELGTLLAHQGSITNLKFSKSKTENGD 98
           R   +G  D  I+I+ L              +R    TL+ H G++ +  FS        
Sbjct: 440 RLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSP------- 492

Query: 99  GEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158
               +N++LLSASED  + +W    + +    KGH   I DV   P      + S D + 
Sbjct: 493 ----DNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTA 548

Query: 159 RLWN 162
           RLW+
Sbjct: 549 RLWS 552

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           Y+ +GS+D+  R++D+     +   L H   +T+   S       DG     +WL + SE
Sbjct: 580 YVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSP------DG-----RWLSTGSE 628

Query: 113 DNKIIIWRVKDWENFGTLKGHIAR-INDVDIHPSNRVAISVSEDHSIRLWNL 163
           D  I +W +   +    ++GH    +  +       V IS   DHS+R+W++
Sbjct: 629 DGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/172 (18%), Positives = 70/172 (40%), Gaps = 18/172 (10%)

Query: 17  ILCLSLDLSLK---TPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKR 71
           +L  S D +++   T  +T + +++ H   +  +  S    Y  + S+D+  R++     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHI 556

Query: 72  KELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK 131
             L     H   +  + F             N  ++ + S D    +W +   ++     
Sbjct: 557 YPLRIFAGHLNDVDTVSFHP-----------NGTYVFTGSSDKTCRMWDITSGDSVRLFL 605

Query: 132 GHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQF 183
           GH A +    + P  R   + SED  I +W++ T K+  + ++R + +N  +
Sbjct: 606 GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKR--LKQMRGHGKNAVY 655

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 65/183 (35%), Gaps = 55/183 (30%)

Query: 129 TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIG 188
           TL GH   +      P NR  +S SED ++RLW+  T    +++  + ++     V +  
Sbjct: 477 TLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTY--TSLVNYKGHNHPIWDVAFSP 534

Query: 189 NGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFY 248
            G YFA A                           H +T     +++ C        H Y
Sbjct: 535 LGHYFATA--------------------------SHDQT----ARLWSC-------DHIY 557

Query: 249 PTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDEL 308
           P                   GH N V    F+ N  GTY+ +  SD    +WD+   D +
Sbjct: 558 PLR--------------IFAGHLNDVDTVSFHPN--GTYVFTGSSDKTCRMWDITSGDSV 601

Query: 309 AVY 311
            ++
Sbjct: 602 RLF 604

>Scas_585.8
          Length = 460

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 25/160 (15%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIY--DLQKRKELGTLLAHQGSITNLKFSKS 92
            QAH  +V C+  S    ++ SG  D  I+I+  +    KE     AH   I ++ FS  
Sbjct: 127 MQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFEN--AHTECIRDISFS-- 182

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                    +N+   ++ S+DN + IW   + +   TL GH   I   D HP   + +S 
Sbjct: 183 ---------NNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSA 233

Query: 153 SEDHSIRLWNLMTVK--------KAAVLKLRNYSQNGQFV 184
           S+D+ ++LW+  + +        K  VLK R     G  +
Sbjct: 234 SKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLL 273

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 39  AHALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H L V  +D+S   + +++ S D++I+I+ L       +L AHQ SI N+KF       
Sbjct: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQ---- 626

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDH 156
                S+N    S S+D  +  W  + +E    L  H + +  + +       +S S DH
Sbjct: 627 -----SHN--FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDH 679

Query: 157 SIRLW 161
           SIR+W
Sbjct: 680 SIRIW 684

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L  G  D  I+++DL  +  L     H+ +IT L+F        DG G+    L+S S+D
Sbjct: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF--------DGTGTR---LISGSKD 142

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + II+W +        L+ H   I        + + IS S+D  I+LW+L T
Sbjct: 143 SNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWL-ISTSKDGMIKLWDLKT 193

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 18/135 (13%)

Query: 32  TPIFHFQAHALSVKCL--DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           T + +F  H  ++  L  D +   L+SGS D +I ++DL     L  L +H+ SIT    
Sbjct: 112 TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC 171

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV-DIHPSNRV 148
                    GE     WL+S S+D  I +W +K  +   T   HIA   +   +   + +
Sbjct: 172 Q--------GE----DWLISTSKDGMIKLWDLKTHQCIET---HIAHTGECWGLAVKDDL 216

Query: 149 AISVSEDHSIRLWNL 163
            I+   D  +++W L
Sbjct: 217 LITTGTDSQVKIWKL 231

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 63/136 (46%), Gaps = 15/136 (11%)

Query: 39  AHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQ---------KRKELGTLLAHQGSITNL 87
           AH  ++  LD++   + LV+GS D+ ++ +D +         K K L  L  H  +   L
Sbjct: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLEL 530

Query: 88  KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
                          ++++L  +  DN + ++ +   + + +L GH   +  +DI   ++
Sbjct: 531 TDDILCVR----VSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586

Query: 148 VAISVSEDHSIRLWNL 163
           + I+ S D +I++W L
Sbjct: 587 MIITSSADKNIKIWGL 602

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 13/121 (10%)

Query: 44  VKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEG 101
           + C+ VS   RYL     D  ++++ L   K   +L  H+  + ++  S           
Sbjct: 534 ILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS----------- 582

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            ++K ++++S D  I IW +   +   +L  H   I +V   P +    S S+D  ++ W
Sbjct: 583 FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYW 642

Query: 162 N 162
           +
Sbjct: 643 D 643

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 73/179 (40%), Gaps = 33/179 (18%)

Query: 69  QKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR-------- 120
           Q RK L  +  H GS+T LKFS            +NK+L S S+D  ++IW         
Sbjct: 65  QLRKPLANMSRHTGSVTALKFS-----------PDNKYLASGSDDKILLIWEKEEGAVQP 113

Query: 121 -------VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLK 173
                  ++ W     L  H   I D+   P + + ++V  D SI +WN  T +K     
Sbjct: 114 LFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFD 173

Query: 174 LRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDG 232
           +      G  V +     YFA A  ++ +       + H   D++  TI H+ TE   G
Sbjct: 174 VHQSHVKG--VVFDPANKYFATASDDRTV----KVFRYHKGTDLS-FTIEHIITEPFQG 225

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 62/149 (41%), Gaps = 28/149 (18%)

Query: 30  LFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIY---------------DLQKRK 72
           L  P+ +   H  SV  L  S   +YL SGS+D+ + I+               DL+   
Sbjct: 66  LRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWN 125

Query: 73  ELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKG 132
               L+AH   I ++ ++            ++  L++   D  II+W    +E       
Sbjct: 126 VRRRLVAHDNDIQDICWA-----------PDSSILVTVGLDRSIIVWNGSTFEKIKRFDV 174

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLW 161
           H + +  V   P+N+   + S+D +++++
Sbjct: 175 HQSHVKGVVFDPANKYFATASDDRTVKVF 203

>Kwal_26.7570
          Length = 218

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 15/98 (15%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S ++             LLS S D  +I W++  D + +G    +
Sbjct: 11  GTLEGHNGWVTSLATSPAQPNL----------LLSGSRDKSLITWKLTGDDQQYGVPVRS 60

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
            +GH   + D  + P    A+S S D ++RLW L T K
Sbjct: 61  FRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGK 98

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
           T   DGE     + LSAS D  + +W +   +      GH + +  V I       +S S
Sbjct: 72  TVTPDGE-----YALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSAS 126

Query: 154 EDHSIRLWNLM 164
            D ++++WN +
Sbjct: 127 RDKTVKVWNTL 137

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 52/122 (42%), Gaps = 27/122 (22%)

Query: 76  TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
           +L  H G IT+L +  S            K LLSAS D ++ IW   D  N  TL GH A
Sbjct: 141 SLDGHSGHITSLHYFPS-----------GKVLLSASIDMQLKIWSAADGTNPRTLFGHTA 189

Query: 136 RINDVDIHPSNRVAISVSEDHSIRLWNLMT----------------VKKAAVLKLRNYSQ 179
            I    +    R  +S S+D S+RLW   +                V    VL ++++S 
Sbjct: 190 PITGCGLIERGRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQVLNVQSHSH 249

Query: 180 NG 181
           NG
Sbjct: 250 NG 251

>Sklu_2384.3 YKL018W, Contig c2384 6547-7533
          Length = 328

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 73/159 (45%), Gaps = 15/159 (9%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C D   +YL++ + ++++ +YD    + L T+ + +    + KF+ +++E          
Sbjct: 33  CFDDHGQYLLTATANDNMHLYDAVSCRFLNTIASKKYGCHSAKFTHAQSEC--------- 83

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
              S  +   I    ++  +      GH A ++D+++ P   V +S S D S+RLW+L T
Sbjct: 84  IYSSTMKSFDIRHLNLETNQYLRYFTGHGALVSDIEMSPLEDVFLSASYDESVRLWDLRT 143

Query: 166 VKKAAVLK-----LRNYSQNGQFVRWIGNGDYFAVALLN 199
            K  A++         Y  +G  V  IGN +   + L N
Sbjct: 144 SKAQAIVPSLVPTCIAYDPSG-LVFAIGNPENHEIGLYN 181

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 104/242 (42%), Gaps = 35/242 (14%)

Query: 106 WLLSASEDNKIIIWRV----KDWENFGTLKGHIARINDV---DIHPSN--RVAISVSEDH 156
           W+ +AS+D+ +I+WR     +D+  +    GH+  +N V   ++ P +     I+ S D 
Sbjct: 404 WVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDL 463

Query: 157 SIRLW-----------NLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVL-IY 204
           +I+ W           +L+ VK +   + R + ++   +    N   FA A  +K   I+
Sbjct: 464 TIKKWKVPKVTSDEPEDLILVKTSEYTR-RAHEKDINAISISPNDSLFATASYDKTCKIW 522

Query: 205 KTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPE 264
                +    +  +K+ +  +     D  +  C    D  I  +  E     +       
Sbjct: 523 NLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSG--DKTIKIWSLESYAVVK------- 573

Query: 265 FSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDC-GERLNCLAVV 323
            +L GH+N V+   F   +    ++S G+DG V++WD+   + +   D    R+  LAV+
Sbjct: 574 -TLEGHTNAVQRCSFINKN--KQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVM 630

Query: 324 DE 325
           ++
Sbjct: 631 ND 632

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 58/141 (41%), Gaps = 13/141 (9%)

Query: 38  QAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
           +AH   +  + +S       + S D+  +I++L   +   TL  H+  + ++ F +    
Sbjct: 492 RAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQY--- 548

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSED 155
                   +K L + S D  I IW ++ +    TL+GH   +        N+  IS   D
Sbjct: 549 --------DKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGAD 600

Query: 156 HSIRLWNLMTVKKAAVLKLRN 176
             + +W+L T +    L   N
Sbjct: 601 GLVIIWDLSTGESVKTLDAHN 621

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 11/110 (10%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + L + S D+ I+I+ L+    + TL  H  ++    F            + NK L+S  
Sbjct: 550 KLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFI-----------NKNKQLISTG 598

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            D  +IIW +   E+  TL  H  RI  + +       ++   D     W
Sbjct: 599 ADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L SG  +  I+++DL KR    T+  H  ++  L F  +  E G  +      LLS   D
Sbjct: 162 LASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQ------LLSGGRD 215

Query: 114 NKIIIWRVKDWENFGTLK 131
           N + ++     + +  LK
Sbjct: 216 NILNLFEFNSTKKYKLLK 233

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 15/126 (11%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L  H+  +T +K++K     GD        L S S+D+   +W   + E  GTL GH   
Sbjct: 6   LTGHERPLTQVKYNK----EGD-------LLFSCSKDSSASVWYSLNGERLGTLDGHTGT 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
           I  +D+    +  ++ S D+SI+LW++   +  A  K     +  +F      G+YF +A
Sbjct: 55  IWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPC---GNYF-LA 110

Query: 197 LLNKVL 202
           +L+ V+
Sbjct: 111 ILDNVM 116

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 62/177 (35%), Gaps = 45/177 (25%)

Query: 29  PLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNL 87
           P+   I H    A +V       +Y+++G  D  I  YD+    E + ++  H+ SI+++
Sbjct: 143 PIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDM 202

Query: 88  KFSKSKTENGDGEGSNNKWLLSAS------------EDNKIIIWRVKDW----------- 124
           +FS   T         N +L+  S              N  +I  +K++           
Sbjct: 203 QFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKD 262

Query: 125 ---------------------ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRL 160
                                E  G ++GH   +N V I P      S  ED  IRL
Sbjct: 263 VTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRL 319

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 103/246 (41%), Gaps = 34/246 (13%)

Query: 102 SNNKWLLSASEDNKIIIWRVKD----WENFGTLKGHIARINDVDI-HPSNR----VAISV 152
           S+  WL +AS+D+ +I+WR  +    +E F    GH   +  + + +  NR      ++ 
Sbjct: 392 SDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTA 451

Query: 153 SEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVH 212
           S D +I+ W +        ++L +  +  ++ R     D  A+++     I+ TA+    
Sbjct: 452 SNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKT 511

Query: 213 CEI------------DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKV 260
           C+I              +K+ +  +     D  +  C    D +I+ +  E     +   
Sbjct: 512 CKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSG--DRSINLWSLESFTVLK--- 566

Query: 261 EEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDC-GERLNC 319
                +L GH+N V+   F   +    +VS G+DG V +WD    + +   D    R+  
Sbjct: 567 -----TLEGHTNAVQRVSFINGN--KQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWA 619

Query: 320 LAVVDE 325
           LAV ++
Sbjct: 620 LAVAND 625

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 108/269 (40%), Gaps = 33/269 (12%)

Query: 26  LKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSIT 85
           L+T   T      + A  + C D S   L  G  D  + ++D+       +L  H  +I+
Sbjct: 89  LETKRTTRSMKISSPAYVLDC-DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATIS 147

Query: 86  NLKFSKSKTENGDGEGSNNKWLLSASEDNKII-IWRVKDWENFGTLKGHIARINDVDIH- 143
           ++KF         GE  +  WLL++ + N ++ IW +       T++ H A +  +DI  
Sbjct: 148 SVKFY--------GEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRV 199

Query: 144 --PSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKV 201
              +  + +S   D  + + +    KK  +L+     +  +   +IG+         N  
Sbjct: 200 QEGAESLLLSGGRDDVVHVHHFDMKKKCKLLQTIPVKRQIESCGFIGD---------NTS 250

Query: 202 LIYKTAAAKVHCEIDMN-----KKTIMHLETETLDGKIYI-----C-VAMSDGNIHFYPT 250
           LIY      V+  I +      K+T   +E   + G + +     C + +SD  +     
Sbjct: 251 LIYTAGGDAVYQIISLESGKSIKQTAQPVEELFIVGVLPVQNSTKCYLVLSDQTLFLIDV 310

Query: 251 EGLLTEEPKVEEPEFSLLGHSNRVKDFKF 279
           E  L++  K+ E E  + G+   + D + 
Sbjct: 311 EKALSQTEKMIEIEKKIAGNHGTIADMRL 339

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L + S D  I ++ L+    L TL  H  ++  + F      NG      NK L+S   D
Sbjct: 545 LATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFI-----NG------NKQLVSTGAD 593

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
             + IW     E   TL  H  RI  + +    ++ I+   D   + W
Sbjct: 594 GLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFW 641

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 15/142 (10%)

Query: 38  QAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
           +AH   +  + +S       + S D+  +I+++   +   TL  H+  +  + F +    
Sbjct: 485 RAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYD-- 542

Query: 96  NGDGEGSNNKWLL-SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                     WLL + S D  I +W ++ +    TL+GH   +  V     N+  +S   
Sbjct: 543 ----------WLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGA 592

Query: 155 DHSIRLWNLMTVKKAAVLKLRN 176
           D  +++W+  T +    L   N
Sbjct: 593 DGLVKIWDCSTGECVRTLDAHN 614

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 88/205 (42%), Gaps = 44/205 (21%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRI 65
           IIVGS +  I   + +   K      +  F+AH   ++ L V  ++ Y++S S+D  +++
Sbjct: 70  IIVGSDDFKIRVFNYNTGEK------VVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKL 123

Query: 66  YDLQKRKEL-GTLLAHQGSITNLKFSKSKTEN-------------GDGEGSNN------- 104
           ++ +K   L  T   H+  + ++ F+                     G+ ++N       
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHL 183

Query: 105 ---------------KWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
                           +L+++S+D  + +W  +      TL+GH++ ++    HP   + 
Sbjct: 184 EKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPII 243

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKL 174
           IS SED ++++WN  T K    L L
Sbjct: 244 ISGSEDGTVKIWNSNTYKLERTLNL 268

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 57/115 (49%), Gaps = 13/115 (11%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K +++ GS+D  IR+++    +++    AH   I  L    +++           ++LSA
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRS-----------YVLSA 115

Query: 111 SEDNKIIIWRV-KDWENFGTLKGHIARINDVDIHPSNRVAISVS-EDHSIRLWNL 163
           S+D  + +W   K+W    T +GH   +  V  +P +    + +  DH++++W+L
Sbjct: 116 SDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSL 170

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 11/97 (11%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K YL++ S+D  ++++D Q +  + TL  H  +++   +                 ++S 
Sbjct: 198 KPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPI-----------IISG 246

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
           SED  + IW    ++   TL   + R   V  HP+ +
Sbjct: 247 SEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGK 283

>Scas_680.11
          Length = 347

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 112/279 (40%), Gaps = 60/279 (21%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L+ H+  +T +K+++     GD        L S S+DN   +W   + E  GTL GH   
Sbjct: 6   LMGHERPLTQVKYNR----EGD-------LLFSCSKDNFASVWYSVNGERLGTLNGHAGT 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLW------NLMTVKKAAVLKLRNYSQNGQFVRWIGNG 190
           I  +D+       ++ S D+SI++W      N+ +      +K  ++S  G +V      
Sbjct: 55  IWSIDVDKFTEYCVTGSADYSIKMWKVETGENVYSWDSPVPVKNVSFSPCGNYV------ 108

Query: 191 DYFAVALLNKVLIYKTAAAKVHCE--------IDMNKKTIMHLETE-----------TLD 231
                A+L+ V+ Y  +      +        I+  ++ I  +ET+           + +
Sbjct: 109 ----AAVLDNVMKYPGSINIYQLKRNPETNEIIEFVEEPIHKIETQEGLSAAVSADWSTE 164

Query: 232 GKIYICVAMSDGNIHFYPTE-GLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVS 290
           GK +I  A  +G +  Y  + GL   E        S+  H   + D +F  +   TY ++
Sbjct: 165 GK-FIIAAHKEGEVSKYDVDNGLQFVE--------SIKLHKALITDLQFSPDR--TYFIT 213

Query: 291 IGSDGRVVVWDMEKKDELAVY--DCGERLNCLAVVDETV 327
              D    + D+E    L  +  DC     C+  + E V
Sbjct: 214 SSRDSHAHIVDVETLAVLKDFEIDCPLNTACITPLKEFV 252

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 10/116 (8%)

Query: 51  KRYLVSGSNDEHIRIYDLQ-----KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           + Y ++ S D H  I D++     K  E+   L +   IT LK        G G+ + + 
Sbjct: 208 RTYFITSSRDSHAHIVDVETLAVLKDFEIDCPL-NTACITPLK---EFVILGGGQDARDV 263

Query: 106 WLLSASEDNKIIIWRVKDWEN-FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRL 160
              SASE      +  K +E   G +KGH   +N V + P     +S  ED  +RL
Sbjct: 264 TTTSASEGKFEARFHHKIFEEEIGRVKGHFGPLNCVAVSPQGTSYVSGGEDGLVRL 319

>Kwal_56.24163
          Length = 729

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           +  +L+++S+D  + IW  +      TL+GH+A ++    HPS  + +S SED ++++WN
Sbjct: 54  DKPYLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

Query: 163 LMTVKKAAVLKL 174
             T K    L L
Sbjct: 114 SNTYKLEKTLNL 125

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 18/128 (14%)

Query: 25  SLKTPLFTPIFHFQAH-ALSVKCLDV----SKRYLVSGSNDEHIRIYDLQKRKELGTLLA 79
           SL  P  T  F  QAH    V  +D      K YL++ S+D  ++I+D Q +  + TL  
Sbjct: 26  SLGQP--TANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATLEG 83

Query: 80  HQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND 139
           H  +++   F  S              +LS SED  + +W    ++   TL   + R   
Sbjct: 84  HMANVSYAVFHPSL-----------PIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWC 132

Query: 140 VDIHPSNR 147
           +  HP+ +
Sbjct: 133 IATHPTGK 140

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 73/155 (47%), Gaps = 18/155 (11%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           ++++ G     I +Y + ++   G L+ H G I+ L+F+ +           NK LLSAS
Sbjct: 331 KFVIPGPKGA-IFVYQITEKTPTGKLIGHHGPISVLEFNDT-----------NKLLLSAS 378

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAV 171
           +D  + IW   +  +     GH   I        ++V IS S D S+RLW+L   K+  +
Sbjct: 379 DDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKV-ISCSMDGSVRLWSL---KQNTL 434

Query: 172 LKLRNYSQNGQFVRWIG-NGDYFAVALLN-KVLIY 204
           L L        F   I  +G  +AVA ++ +V +Y
Sbjct: 435 LALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVY 469

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 35/183 (19%), Positives = 80/183 (43%), Gaps = 15/183 (8%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGS---------NNKWLLSASEDNKIIIWRVKDWE 125
           GT++ H   +     S    EN  G+GS         ++K+++   +   I ++++ +  
Sbjct: 293 GTVMQHF-ELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPK-GAIFVYQITEKT 350

Query: 126 NFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVR 185
             G L GH   I+ ++ + +N++ +S S+D ++R+W+              +SQ+     
Sbjct: 351 PTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNC--FYGHSQSIVSAS 408

Query: 186 WIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNI 245
           W+G+    + ++   V ++      +   + +     +     + DG+ Y  VA  DG +
Sbjct: 409 WVGDDKVISCSMDGSVRLWSLKQNTL-LALSIVDGVPIFAGRISQDGQKY-AVAFMDGQV 466

Query: 246 HFY 248
           + Y
Sbjct: 467 NVY 469

>Kwal_14.906
          Length = 328

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 90/205 (43%), Gaps = 25/205 (12%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW 106
            D   RYL++ S ++++ +YD    + L T+ + +    + KF+ ++          N+ 
Sbjct: 34  FDDHGRYLLTASANDNMHLYDAMNCRFLNTVASKKYGCHSAKFTHAQ----------NEC 83

Query: 107 LLSA---SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           + S+   S D + +      +  + T  GH A ++D+++ P N   +S S D S+RLW++
Sbjct: 84  VYSSTMKSFDIRHLNLETNQYLRYFT--GHGALVSDIEMSPLNDTFLSASYDESVRLWDM 141

Query: 164 MTVKKAAVLK-----LRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMN 218
              K  A++         Y  +G  V  +GN +   + L N   +       V      N
Sbjct: 142 RASKAQAIVPSLVPACIAYDPSG-LVFALGNPENCEIGLYNLKQLKNGPFLVVKVNPAFN 200

Query: 219 KKTIMHLETETLDGKIYICVAMSDG 243
           + T M       DGK YI +A S G
Sbjct: 201 QWTKMEFSN---DGK-YILLASSAG 221

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 99/228 (43%), Gaps = 14/228 (6%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           + K+L + +ED  I IW +   +   TL+GH   I  +D  P+    +S S D ++R+W+
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 163 LMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNK-VLIYKTAAA------KVHCEI 215
           L T + +  L + +           G+G Y A   L++ V ++ +             E+
Sbjct: 423 LRTGQCSLTLSIEDGVTT--VAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENEL 480

Query: 216 DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVK 275
               K  ++    T DG+  I  ++ D ++  +   GL  ++      E +  GH + V 
Sbjct: 481 STGHKDSVYSVVFTRDGQGVISGSL-DRSVKLWDLRGLNGQKSHATC-EVTYTGHKDFVL 538

Query: 276 DFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVV 323
                ++D   Y++S   D  V+ WD    + L +   G R + ++V 
Sbjct: 539 SVATTQDD--EYILSGSKDRGVLFWDTASGNPLLMLQ-GHRNSVISVA 583

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 13/114 (11%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
           + ++++ G     + +Y +   K LG LL H  +IT L+F+KS           NK LLS
Sbjct: 310 TDKFVIPGPGGS-LLVYTIGNNKPLGRLLGHTSTITTLEFNKS-----------NKSLLS 357

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           AS+DN I +WR  +         H   I+      ++ + IS + D ++++W++
Sbjct: 358 ASDDNTIKVWRGGNSSAANDFTDHTKTISSAH-WINDDLIISTAYDGTVKVWSI 410

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/154 (18%), Positives = 66/154 (42%), Gaps = 13/154 (8%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWL-----LSASEDNKIIIWRVKDWENFGT 129
           GT L H        F +   EN D  G + +W+     +       ++++ + + +  G 
Sbjct: 282 GTQLQH------FSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGR 335

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN 189
           L GH + I  ++ + SN+  +S S+D++I++W       +A     ++++      WI +
Sbjct: 336 LLGHTSTITTLEFNKSNKSLLSASDDNTIKVWR--GGNSSAANDFTDHTKTISSAHWIND 393

Query: 190 GDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIM 223
               + A    V ++  +   +  E  ++ + I 
Sbjct: 394 DLIISTAYDGTVKVWSISKNSIVAEASLDSEPIF 427

>Scas_592.4*
          Length = 318

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 7/131 (5%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
            +D     ++SGS D+ I+++ + K + L TLL H   ++ ++ + +  +N D       
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTD-QNDDAVT---- 167

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            ++SA  D  +  W +  ++      GH   +N V   P   +  S  +D  I LWNL  
Sbjct: 168 -VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAE 226

Query: 166 VKKAAVLKLRN 176
            K    L  ++
Sbjct: 227 KKAMYTLSAQD 237

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 100/264 (37%), Gaps = 48/264 (18%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S  +             LLS S D  +I W++  D + FG    +
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL----------LLSGSRDKTLISWKLTGDDQKFGVPVRS 60

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN 189
            KGH   + D  +      A+S S D ++RLW++ T +               + R++G+
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGET--------------YQRFVGH 106

Query: 190 -GDYFAVALLNKVLI---------YKTAAAKVHCEIDM--NKKTIMHLETETLDGKIYIC 237
             D  +VA+  K  +          K    K  C   +  +   +  +     D      
Sbjct: 107 KSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAV 166

Query: 238 VAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRV 297
             +S GN        L        + E   +GH+  V       +  GT + S G DG +
Sbjct: 167 TVISAGNDKMVKAWNL-----NQFQIEADFVGHNGNVNAVTASPD--GTLIASAGKDGEI 219

Query: 298 VVWDMEKKDELAVYDCGERLNCLA 321
           ++W++ +K  +      + +  LA
Sbjct: 220 MLWNLAEKKAMYTLSAQDEVFSLA 243

>Scas_721.115*
          Length = 318

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 7/131 (5%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
            +D     ++SGS D+ I+++ + K + L TLL H   ++ ++ + +  +N D       
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTD-QNDDSVT---- 167

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            ++SA  D  +  W +  ++      GH   +N V   P   +  S  +D  I LWNL  
Sbjct: 168 -VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAE 226

Query: 166 VKKAAVLKLRN 176
            K    L  ++
Sbjct: 227 KKAMYTLSAQD 237

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 100/264 (37%), Gaps = 48/264 (18%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S  +             LLS S D  +I W++  D + FG    +
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL----------LLSGSRDKTLISWKLTGDDQKFGVPVRS 60

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN 189
            KGH   + D  +      A+S S D ++RLW++ T +               + R++G+
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGET--------------YQRFVGH 106

Query: 190 -GDYFAVALLNKVLI---------YKTAAAKVHCEIDM--NKKTIMHLETETLDGKIYIC 237
             D  +VA+  K  +          K    K  C   +  +   +  +     D      
Sbjct: 107 KSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSV 166

Query: 238 VAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRV 297
             +S GN        L        + E   +GH+  V       +  GT + S G DG +
Sbjct: 167 TVISAGNDKMVKAWNL-----NQFQIEADFVGHNGNVNTVTASPD--GTLIASAGKDGEI 219

Query: 298 VVWDMEKKDELAVYDCGERLNCLA 321
           ++W++ +K  +      + +  LA
Sbjct: 220 MLWNLAEKKAMYTLSAQDEVFALA 243

>Kwal_55.22067
          Length = 451

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 17/130 (13%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLL--AHQGSITNLKFSKS 92
            QAH  +V  +  S    +L+SG +D  I+I+  Q    +  +L  AH   I  + FS  
Sbjct: 121 MQAHDSAVAVMKYSHAGDWLISGDSDGTIKIW--QPNFNMVKVLDEAHTQCIRGISFS-- 176

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                   G+++K  ++ S+DN + IW   + +   TL GH   +   D HP+  +  S 
Sbjct: 177 --------GTDSK-FVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASG 227

Query: 153 SEDHSIRLWN 162
           S+D+ ++LW+
Sbjct: 228 SKDNLVKLWD 237

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 19/100 (19%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK----G 132
           + AH  ++  +K+S +    GD       WL+S   D  I IW+     NF  +K     
Sbjct: 121 MQAHDSAVAVMKYSHA----GD-------WLISGDSDGTIKIWQ----PNFNMVKVLDEA 165

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           H   I  +    ++   ++ S+D+ +++WN    ++ + L
Sbjct: 166 HTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTL 205

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 15/112 (13%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           I ++ + + K +G L+ H  ++T L ++           S+NK LLSAS+D  +  WR  
Sbjct: 318 ILVFSIGESKPIGKLVGHTKTLTVLCYN-----------SDNKLLLSASDDKTLRTWRGG 366

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKL 174
           +  +     GH   I   D    +R+ IS S D S+R+W   +VK+ A++ L
Sbjct: 367 NANSSNCFYGHTQSITYADWLDDDRL-ISTSMDGSVRVW---SVKQNALVGL 414

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 107/232 (46%), Gaps = 21/232 (9%)

Query: 105 KWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
           K+L + +ED  I IW +++ +    L+GH   I  +D  PS    +S S D ++R+W+L 
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 165 TVKKAAVLKLRNYSQNGQFVRWI--GNGDYFAVALLNK-VLIYKTAAAKVHCEIDM-NKK 220
           T + +  L +    ++G     +  G+G Y A   L++ V ++ +    +   +D  N+ 
Sbjct: 516 TGQCSLTLSI----EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 221 TIMHLETE-----TLDGKIYICVAMSDGNIHFYPTEGLL----TEEPKVEEPEFSLLGHS 271
              H ++      T DG+  +  ++ D ++  +  +       ++ P     E + +GH 
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSL-DRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHK 630

Query: 272 NRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVV 323
           + V      +ND   Y++S   D  V+ WD +  + L +   G R + ++V 
Sbjct: 631 DFVLSVATTQND--EYILSGSKDRGVLFWDKKSGNPLLMLQ-GHRNSVISVA 679

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 13/121 (10%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C     ++L +G+ D  IRI+D++ RK +  L  H+  I +L +  S    GD       
Sbjct: 450 CFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS----GDK------ 499

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV-SEDHSIRLWNLM 164
            L+S S D  + IW ++  +   TL      +  V + P +   I+  S D ++R+W+  
Sbjct: 500 -LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSE 557

Query: 165 T 165
           T
Sbjct: 558 T 558

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 14/188 (7%)

Query: 121 VKDWENFGTLKGHIAR--INDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYS 178
            KD EN  T     +   I  V   P  +   + +ED  IR+W++   K   V+ L+ + 
Sbjct: 428 AKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRK--IVMILQGHE 485

Query: 179 QNGQFVRWIGNGDYFAVALLNK-VLIYKTAAAKVHCEIDMN-KKTIMHLETETLDGKIYI 236
           Q+   + +  +GD       ++ V I+     +  C + ++ +  +  +     DGK YI
Sbjct: 486 QDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVSPGDGK-YI 542

Query: 237 CVAMSDGNIHFYPTE-GLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDG 295
                D  +  + +E G L E  +++    S  GH + V    F ++  G  +VS   D 
Sbjct: 543 AAGSLDRAVRVWDSETGFLVE--RLDSENESGTGHKDSVYSVVFTRD--GQSVVSGSLDR 598

Query: 296 RVVVWDME 303
            V +W+++
Sbjct: 599 SVKLWNLQ 606

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 78/194 (40%), Gaps = 44/194 (22%)

Query: 1   MAKNQFRIIVGSYE-HNILCLSLDLSLKTP-----------------------LFTPIFH 36
           MA N+  ++ G+ E HN    SL  S   P                          P+  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKS 60

Query: 37  FQAHALSVK--CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F+ H+  V+   L  +  Y +SGS D+ +R++D+   +   T + H+G + ++   K  +
Sbjct: 61  FKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKAS 120

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR-----VA 149
                       ++S S D  I +W +K  +   TL GH   ++ V I  S+        
Sbjct: 121 M-----------IISGSRDKSIKVWSIKG-DCLATLIGHNDWVSQVRIANSSDDDDKVTV 168

Query: 150 ISVSEDHSIR-LWN 162
           IS   D  ++ LWN
Sbjct: 169 ISAGNDKMVKVLWN 182

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK-DWENFG----T 129
           GTL  H G +T+L  S          G  N  LLSAS D  +I W++  D + FG    +
Sbjct: 11  GTLEGHNGWVTSLATS---------AGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVKS 60

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            KGH   + D  +  +   A+S S D ++RLW++ T
Sbjct: 61  FKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVAT 96

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           N  + LS S D  + +W V   E F T  GH   +  V I     + IS S D SI++W+
Sbjct: 76  NGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWS 135

Query: 163 L 163
           +
Sbjct: 136 I 136

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 89/205 (43%), Gaps = 44/205 (21%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDV--SKRYLVSGSNDEHIRI 65
           I+VGS ++ +   + +   K      +  F AH   ++ + V  SK Y+++GS+D  +++
Sbjct: 70  IVVGSDDNKVRVFNYNTGEK------VADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKL 123

Query: 66  YDLQKRKEL-GTLLAHQGSITNLKFSK---------------------SKTEN-----GD 98
           ++ +    L  T   H+  +  + F+                        T N     G 
Sbjct: 124 WNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQ 183

Query: 99  GEGSN---------NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
            +G N           +++++S+D  + I+  +      TL+GH++ ++    HP+  + 
Sbjct: 184 EKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPII 243

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKL 174
           IS SED +++LWN  T K    L L
Sbjct: 244 ISGSEDGTVKLWNSSTYKLEKTLNL 268

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 58/128 (45%), Gaps = 13/128 (10%)

Query: 37  FQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F   +  VK +D+  S+ ++++      + I++ + ++E+ ++      +   KF   K 
Sbjct: 9   FSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKN 68

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                      W++  S+DNK+ ++     E       H   I  + +HPS    ++ S+
Sbjct: 69  -----------WIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD 117

Query: 155 DHSIRLWN 162
           D +++LWN
Sbjct: 118 DLTVKLWN 125

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 58/141 (41%), Gaps = 20/141 (14%)

Query: 11  GSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDV----SKRYLVSGSNDEHIRIY 66
           G  +H +   SL  S  TP FT   H       V  +D      K Y+++ S+D  ++I+
Sbjct: 159 GCLDHKVKVWSLGQS--TPNFT--LH-TGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF 213

Query: 67  DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN 126
           D Q +  + TL  H  +++   F  +              ++S SED  + +W    ++ 
Sbjct: 214 DYQTKSCVATLEGHMSNVSFAVFHPTL-----------PIIISGSEDGTVKLWNSSTYKL 262

Query: 127 FGTLKGHIARINDVDIHPSNR 147
             TL   + R   +  HP  R
Sbjct: 263 EKTLNLGLERSWCIATHPVGR 283

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 13/113 (11%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
           + ++++ G    ++ +Y +   + +G L+ H+G+I+ L+F+           S  K L S
Sbjct: 329 TDKFVIPGPGG-NLLVYTMSDSRPIGKLVGHRGTISQLEFN-----------SETKLLAS 376

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           A++DN I +W   +  +     GH   I  +    +N + IS S D S++LW+
Sbjct: 377 AADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKW-VNNDMLISASMDGSVKLWD 428

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 17/130 (13%)

Query: 37  FQAHALSVKCLDVS--KRYLVSGSNDEHIRIY--DLQKRKELGTLLAHQGSITNLKFSKS 92
            QAH  +V  +  S    +++SG  D  I+I+  +    KE+    AH  SI ++ FS  
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDA--AHTESIRDMAFS-- 186

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                    SN+   ++ S+DN + IW   + +    L GH   +   D HP   +  S 
Sbjct: 187 ---------SNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASA 237

Query: 153 SEDHSIRLWN 162
           S+D+ ++LW+
Sbjct: 238 SKDNLVKLWD 247

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 19/100 (19%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK----G 132
           + AH  ++T +K+S            ++ W++S   D  I IW+     NF  +K     
Sbjct: 131 MQAHDSAVTTMKYSH-----------DSDWMISGDADGMIKIWQ----PNFSMVKEIDAA 175

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           H   I D+    ++   ++ S+D+ +++WN    K+  VL
Sbjct: 176 HTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVL 215

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 117/293 (39%), Gaps = 51/293 (17%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIY--DLQKRKELGTLLAHQGSITNLKFSKS 92
            QAH  SV  +  S    +++SG  D  I+I+  +    KEL  +  H   I ++ FS  
Sbjct: 120 MQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDRI--HTEGIRDVAFS-- 175

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                    +N+   ++ S+DN + IW   + +    L GH   +   D HP   + +S 
Sbjct: 176 ---------NNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSG 226

Query: 153 SEDHSIRLWNLMTVK--------KAAVLKLRNYSQNGQFVRWIGNGDYFAV----ALLNK 200
           S+D+ ++LW+  + +        K  VLK R     G  +  I       V    A +N+
Sbjct: 227 SKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNE 286

Query: 201 VLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNI-HFYPTEGLLTEEPK 259
           ++        V  E+D      M LE  T++  ++  V   DG++ HF    G  TE+P 
Sbjct: 287 LMC-------VRDEVDF-----MELEWSTINESMF-TVGCYDGSLKHF--DLGQDTEKPI 331

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYD 312
              P      H   +    +  N  G  + +   D  +  W   +  +   +D
Sbjct: 332 HIIP----FAHEKCISAIAY--NPVGHILATAAKDRTIRFWTRARPVDPNAFD 378

>Scas_720.45
          Length = 755

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           +  +L+++S+D    +W  +      TL+GH+A ++    HP+  + IS SED ++++WN
Sbjct: 54  DKPYLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWN 113

Query: 163 LMTVKKAAVLKL 174
             T K    L L
Sbjct: 114 SATYKVEKTLSL 125

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 11/97 (11%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSA 110
           K YL++ S+D   +++D Q +  + TL  H  +++   F  +              ++S 
Sbjct: 55  KPYLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTL-----------PIIISG 103

Query: 111 SEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
           SED  + IW    ++   TL   + R   +  HP+ +
Sbjct: 104 SEDGTLKIWNSATYKVEKTLSLGLERSWCIATHPTGK 140

>Scas_630.6
          Length = 621

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
           DGE     +L + +ED  I IW +K+ +    LKGH   I  +D  P  +  +S S D S
Sbjct: 352 DGE-----FLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRS 406

Query: 158 IRLWNLMTVKKAAVLKLRN 176
           IR+W+L T + +  L + +
Sbjct: 407 IRIWDLKTGQCSLTLSIED 425

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 58/141 (41%), Gaps = 24/141 (17%)

Query: 34  IFHFQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +   + H   +  LD     + LVSGS D  IRI+DL K  +    L+ +  +T +  S 
Sbjct: 376 VMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDL-KTGQCSLTLSIEDGVTTVAVSP 434

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIW---------RVKDWENFGTLKGHIARINDVDI 142
           +       EG   K + + S D  + IW         R+      G   GH   +  V  
Sbjct: 435 N-------EG---KLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG--NGHQDSVYSVAF 482

Query: 143 HPSNRVAISVSEDHSIRLWNL 163
               +  +S S D +++LWNL
Sbjct: 483 TKDGQHVVSGSLDRTVKLWNL 503

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 39  AHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96
            H  SV  +  +K  +++VSGS D  +++++L   +  GT       I +  F  S   +
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQS-GTGKCEVTYIGHKDFVLSVATS 530

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGH------IARIN-DVDIHPSNRVA 149
            D     +K++ S S+D  +IIW          L+GH      +A +N +VD   + ++ 
Sbjct: 531 ND-----DKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLF 585

Query: 150 ISVSEDHSIRLW 161
            + S D   R+W
Sbjct: 586 ATGSGDCKARIW 597

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           +Y+ SGS D  + I+D      +  L  H+ S+ ++    S  +    +G N K   + S
Sbjct: 534 KYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVD----DGKNYKLFATGS 589

Query: 112 EDNKIIIWR 120
            D K  IW+
Sbjct: 590 GDCKARIWK 598

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 15/143 (10%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           I+ F +H   +  L      LVSGS D  IR +DL   K + TL  +  +  NL  S+S 
Sbjct: 498 IYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNL--SRSM 555

Query: 94  TENGDGEGSNNKWLLSA-----------SEDNKIIIWRVKDWENFGTLKGHIARINDVDI 142
             +G    +N+  ++ A           ++D  + +W ++      TL+GH   +  +  
Sbjct: 556 IGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF 615

Query: 143 HPSNRVAISVSEDHSIRLWNLMT 165
              N V  S+  D+SIR+W+L T
Sbjct: 616 DSLNLVTGSL--DNSIRIWDLRT 636

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 39  AHALSVKCLDVSKRY---LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
           AH  +V CLD +  +     +G  D  I++++L K K + ++  H  +++ ++  +  T 
Sbjct: 409 AHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTL 468

Query: 96  NGDGEGSNNK-WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
              G  +  K W +  + DN  I     D     T   HI  I  +    +N V  S S+
Sbjct: 469 ITGGRDALLKMWDIQKAIDNDSI---PSDEVCIYTFDSHIDEITALSFEANNLV--SGSQ 523

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVR-WIGNG 190
           D +IR W+L   K    L + N++  G   R  IG+G
Sbjct: 524 DRTIRQWDLNNGKCVQTLDI-NFATGGNLSRSMIGSG 559

>Kwal_33.15475
          Length = 783

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 97/230 (42%), Gaps = 32/230 (13%)

Query: 89  FSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFG---TLKGHIARINDVDIHPS 145
           F  +  +   G+ + ++ +L+ +    I +W+  D  + G   TLKGH A +  V   P 
Sbjct: 8   FIGANRQTQAGDYNCDREILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPG 67

Query: 146 NRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYK 205
             + +S SED  +RLW      + A+  ++    +   +         ++++++ +L   
Sbjct: 68  TNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTIT--------SLSVISNILSVG 119

Query: 206 TAAAKVHCEIDMNKKTIMHLETETLDGKIY-ICVAMS--DGNIHFYPTEGLLTEEPKVEE 262
            A   V   +  N + I+ L +  L   +Y +C+A+   +G+ +     G     P+V  
Sbjct: 120 CADGSVSLWLTENNQAIL-LHSFNLQTNVYPLCMALKLVEGDKYLLAIGG---TNPRVFI 175

Query: 263 PEFSLL--------------GHSNRVKDFKFYKNDFGTYMVSIGSDGRVV 298
             F+L               GH + VK   FY+   G  +++ GS  R +
Sbjct: 176 YSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYI 225

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 17/130 (13%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLL--AHQGSITNLKFSKS 92
            QAH  +V  ++ S    +L+SG +D  I+I+  Q    +  +L  AH   + ++ FS  
Sbjct: 119 MQAHDSAVTTMEYSHAGDWLISGDSDGIIKIW--QPNFNMVKVLDQAHMECVRDVSFS-- 174

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                   G+++K  ++ S+DN + IW   + +    L GH   +   D HP+  + +S 
Sbjct: 175 --------GTDSK-FVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGLIVSG 225

Query: 153 SEDHSIRLWN 162
           S+D+ I+LW+
Sbjct: 226 SKDNLIKLWD 235

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 19/100 (19%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK----G 132
           + AH  ++T +++S +    GD       WL+S   D  I IW+     NF  +K     
Sbjct: 119 MQAHDSAVTTMEYSHA----GD-------WLISGDSDGIIKIWQ----PNFNMVKVLDQA 163

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           H+  + DV    ++   ++ S+D+ +++WN    ++  VL
Sbjct: 164 HMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVL 203

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 40  HALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDG 99
           ++ S+K +  S+  + +G+      ++DL K + +  L  H+GSI  ++ S+        
Sbjct: 138 YSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSE-------- 189

Query: 100 EGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIR 159
              +NK + S S+D  I +W  +  +       H ARI ++    ++   +SVSED + R
Sbjct: 190 ---HNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCR 246

Query: 160 LWNLM 164
           +WN++
Sbjct: 247 VWNII 251

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 117 IIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAV 171
           I+W +   E    L GH   I  +     N++  S S+D SIRLW+  T K+ ++
Sbjct: 162 IVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSI 216

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 124/362 (34%), Gaps = 98/362 (27%)

Query: 36  HFQAH-ALSVKCLDVSK--RYLVSGSNDEHIRIYDLQK-----------------RKELG 75
           H + H +  V   DVS   + L +G  D  IRI+ +                    K L 
Sbjct: 11  HREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLS 70

Query: 76  TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR--------------- 120
           T+  H GS+T +KFS       DG     K+L S S+D  ++IW                
Sbjct: 71  TMSRHAGSVTTVKFSP------DG-----KYLASGSDDRILLIWELEGGTTQPMFGAEST 119

Query: 121 -VKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQ 179
            ++ W     L  H   I D+   P + + +SV  D +I +WN  T +K     +     
Sbjct: 120 DIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHV 179

Query: 180 NGQFVRWIGNGDYFAVALLNKVL----IYKTAAAKVHCEIDMNKKTIMHLETETLDGKIY 235
            G  V +     YFA A  ++ +     +KT       E         H+ TE   G   
Sbjct: 180 KG--VVFDPANKYFATASDDRTIKMFRYHKTGETSFSVE---------HVITEPFKGSPL 228

Query: 236 IC----VAMSDGNIHFY-------PTEGLLTEEPKVEEPEFSLLGH-------SNRVKDF 277
                 ++ S    H         P   +   E    E   SL+GH       S   + F
Sbjct: 229 TTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGTWESPVSLVGHDQPTEVASFNPRIF 288

Query: 278 KFYKNDFGT----------------YMVSIGSDGRVVVWDMEKKDELAVYD--CGERLNC 319
           K  K+D  T                 + S G D  + VW   K   L V    CG+ +  
Sbjct: 289 KRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARPLIVAQDICGKSITD 348

Query: 320 LA 321
           ++
Sbjct: 349 MS 350

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 63/150 (42%), Gaps = 29/150 (19%)

Query: 30  LFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQ---KRKELGT-------- 76
           L  P+     HA SV  +  S   +YL SGS+D  + I++L+    +   G         
Sbjct: 65  LMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHW 124

Query: 77  -----LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK 131
                L+AH   I ++ ++            ++  ++S   D  IIIW    +E      
Sbjct: 125 NVRRRLVAHDNDIQDICWAP-----------DSSIMVSVGLDRAIIIWNGSTFEKVKRFD 173

Query: 132 GHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            H + +  V   P+N+   + S+D +I+++
Sbjct: 174 VHQSHVKGVVFDPANKYFATASDDRTIKMF 203

>Scas_397.2
          Length = 410

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 12/129 (9%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           Y+V G+ +  I +YD Q   E     AH   IT LKF  S            + +LS S 
Sbjct: 112 YIV-GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPS-----------GEVVLSGSS 159

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           D ++ +W +KD       +GH ++I D  +    R  +S S D +++LW   +       
Sbjct: 160 DMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGSTVRTF 219

Query: 173 KLRNYSQNG 181
             R    +G
Sbjct: 220 MRRENPNDG 228

>Kwal_27.12667
          Length = 721

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 21/149 (14%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTL---LAHQGSITNLKFS 90
           +  F AH   +  L      LVSGS D  IR +DL   K L T+    A++G  T+  FS
Sbjct: 495 VHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRG--TSGGFS 552

Query: 91  KSKTENGDGE---GSNNKWLLSA-----------SEDNKIIIWRVKDWENFGTLKGHIAR 136
           K  + N         N+  ++ A           ++D  + +W ++  +   TL+GH   
Sbjct: 553 KISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDA 612

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           +  +     N V  S+  D SIR+W+L T
Sbjct: 613 VTGLQFDSVNLVTGSL--DRSIRIWDLRT 639

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 75/179 (41%), Gaps = 33/179 (18%)

Query: 38  QAHALSVKCLDVSKRY---LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           +AH  S+ CLD    +     +G  D  ++I++L K+ ++G L  H  S++ ++   S +
Sbjct: 401 KAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS 460

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWE---NFGTLKG-----------HIARINDV 140
                       L++   D  + +W ++  E   N G  +G           H+  I   
Sbjct: 461 ------------LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI--T 506

Query: 141 DIHPSNRVAISVSEDHSIRLWNLMTVK--KAAVLKLRNYSQNGQFVRWIGNGDYFAVAL 197
            +H      +S S+D +IR W+L T K  +   +   N   +G F +   N    ++ L
Sbjct: 507 ALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILL 565

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           Y+ +G+    + +++L     +  L  H+GSI    F    +++G       + + S S+
Sbjct: 153 YVCAGTVMGGVVVWELHTGAVVQRLEGHEGSI----FCAVVSDDG-------RLVASCSD 201

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           D  I +W ++  E  G   GH ARI D+         +SVSED + R+W
Sbjct: 202 DRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVW 250

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 16/133 (12%)

Query: 36  HFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
             + H  S+ C  VS   R + S S+D  IR++ L+  +++G    H   I +L+F +  
Sbjct: 176 RLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVA 235

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRV--KDWENFGTLKGHIAR-INDVDIHPSNRVAI 150
            +           L+S SED    +W V  +  +       H  + +  VD+   + VA+
Sbjct: 236 DK-----------LVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQEDDMVAV 284

Query: 151 SVSEDHSIRLWNL 163
           +   D  +RL +L
Sbjct: 285 TAGNDGRLRLVDL 297

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 116 IIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAV 171
           +++W +        L+GH   I    +    R+  S S+D SIR+W+L T ++  +
Sbjct: 163 VVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGI 218

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 89/271 (32%), Gaps = 90/271 (33%)

Query: 54  LVSGSNDEHIRI----YDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
            ++GS D +I++     D  + +   TL  H   +   +F             N +  +S
Sbjct: 650 FITGSEDTNIKLNCFDVDTGEIRTFWTLKEHVSGLQRCEFI------------NKRLFVS 697

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIA------------RINDVDIH----PSNRVAISVS 153
            S   ++ +W+V D   F     H+             RI D          N V  +V 
Sbjct: 698 CSAREELFLWQVTD--TFDIPYVHLLQKLPVSSSNPDLRIMDFSCKFVNGTENFVIATVC 755

Query: 154 EDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHC 213
            D SIRLW   + K A  L +              NG Y    +LN  LI          
Sbjct: 756 SDSSIRLWYYDSEKNAFTLLV--------------NGFYTQCCILNAELI---------- 791

Query: 214 EIDMNKKTIMHLETETLDGKIYICVAMSDGNI---------------HFYPTEGLLTEEP 258
                           L G++Y+ V+ +DG++                    EG    E 
Sbjct: 792 ---------------VLQGRLYLLVSATDGHLVVWDMAPVMPFAVEDQLQQLEGAAMAET 836

Query: 259 KVEEPEFSLLGHSNRVKDF--KFYKNDFGTY 287
           K+ EP   L  H + VK       K++F  Y
Sbjct: 837 KLPEPSVLLKVHQSGVKALGVSVRKSEFVVY 867

>CAGL0I07073g complement(681102..682283) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin, start by similarity
          Length = 393

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 75/187 (40%), Gaps = 20/187 (10%)

Query: 164 MTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIM 223
           + VK+  V    + S NG     + NG  F   L +   +Y+     +H  ID N  T+ 
Sbjct: 175 IPVKEPCVATALDISSNGLIATGLENGTVFVSQLTSLKPLYQFEGYGLH-GIDQNSNTVR 233

Query: 224 HLETETLDGKIYICV--AMSDGNIHFYPTE-----GLLTEEPKVEEPEFSLLGHSNRVKD 276
           +++     G++      + S GNI  Y TE     G  T      +       H   V  
Sbjct: 234 NVKFSPT-GRLLAVANDSGSYGNITLYETEFGERIGNFTMATHSTQTSIGSFAHDGWVFG 292

Query: 277 FKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVDETVEKYETMKKR 336
             F  N+ G ++ S G D +V VWD++ +         ER++ L +    +E  E + + 
Sbjct: 293 LAF--NETGEFLASCGYDSKVRVWDVKLR---------ERVSTLHITAGDIEVEEDILQE 341

Query: 337 DSESADL 343
           D E   L
Sbjct: 342 DEEGNSL 348

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 90/235 (38%), Gaps = 35/235 (14%)

Query: 35  FHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           +     A++   +D   R +VS   D  I  YD  + K LG L      IT++ + +S  
Sbjct: 496 YRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESKYLGKL-QMDAPITSMVYHRS-- 552

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                    +     A +D  I++      +    L GH  RI   D  P  R  +S S 
Sbjct: 553 ---------SDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASL 603

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA--LLNKVLIYKTAAAKVH 212
           D +IR W+L T      +K+ + + N   +++  NGD  A    + N + I+        
Sbjct: 604 DSTIRTWDLPTGSCIDGVKIESVATN---LKFSPNGDMLATTHVIGNGIFIW-------- 652

Query: 213 CEIDMNKKTIMHLETETLD----GKIYICVAMSDGNIHFYPTEGLLTEEPKVEEP 263
                N+     + T+ +D     KI +  A   GN  F   EG   +     EP
Sbjct: 653 ----TNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFL--EGAFQDGGDDHEP 701

>Scas_702.16
          Length = 816

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 88/222 (39%), Gaps = 49/222 (22%)

Query: 17  ILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKEL 74
           IL L  ++ +   L  P+     H  SV CL  S   +YL SGS+D  + I+ L + + +
Sbjct: 55  ILSLKDEVPIDKELKKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPI 114

Query: 75  GT----------------LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
                             L+AH   I ++ ++            ++  L+S   D  +II
Sbjct: 115 QPIFGGESEKERWAVRKRLVAHDNDIQDICWA-----------PDSSLLVSVGLDRAVII 163

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAV------- 171
           W    +E       H + +  V   P+N+   + S+D +++++    +  A+        
Sbjct: 164 WNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRYHKIGDASFTIEHVVT 223

Query: 172 -----------LKLRNYSQNGQFVRWIG--NGDYFAVALLNK 200
                       +  ++S +GQ +      NG   +VA++N+
Sbjct: 224 EPFKGSPLTTYFRRLSWSPDGQHIAAPNATNGPVSSVAIINR 265

>Kwal_23.6429
          Length = 750

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 13/121 (10%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C     ++L +G+ D+ IRI+DL  R+ + TL  H+  I +L +  S    GD       
Sbjct: 477 CFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPS----GD------- 525

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV-SEDHSIRLWNLM 164
            L+S S D  + IW ++  +   TL      +  V + P +   I+  S D ++R+W+  
Sbjct: 526 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKLIAAGSLDRTVRIWDSE 584

Query: 165 T 165
           T
Sbjct: 585 T 585

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           + K+L + +ED  I IW +       TL+GH   I  +D  PS    +S S D ++R+W+
Sbjct: 481 DGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 540

Query: 163 LMTVKKAAVLKLRN 176
           L T + +  L + +
Sbjct: 541 LRTGQCSLTLSIED 554

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 59/144 (40%), Gaps = 24/144 (16%)

Query: 34  IFHFQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +   Q H   +  LD   S   LVSGS D  +RI+DL+  +   TL    G +T +  S 
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSP 563

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIW---------RVKDWENFGTLKGHIARINDVDI 142
                GDG     K + + S D  + IW         R+      GT  GH   +  V  
Sbjct: 564 -----GDG-----KLIAAGSLDRTVRIWDSETGFLVERLDSENELGT--GHKDSVYSVVF 611

Query: 143 HPSNRVAISVSEDHSIRLWNLMTV 166
                  +S S D S++LWNL + 
Sbjct: 612 TRDGHGVVSGSLDRSVKLWNLRSA 635

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 6/79 (7%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGH------IARINDVDIHPSNRVAISVSEDH 156
           N++++LS S+D  ++ W          L+GH      +A  ND  + P   V  + S D 
Sbjct: 668 NDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDC 727

Query: 157 SIRLWNLMTVKKAAVLKLR 175
             R+W        A  KLR
Sbjct: 728 KARIWKYSKQTSNAEPKLR 746

>Scas_542.5
          Length = 327

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (44%), Gaps = 21/156 (13%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           +YL++ S  +++ +YD    + L T+ + +    + KF+ ++ E               S
Sbjct: 39  QYLLTASASDNMHLYDAVGCRFLNTIGSKKYGCHSAKFTHAQNE------------CIYS 86

Query: 112 EDNKIIIWRVKDWENFGTLK---GHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKK 168
              K    R  + E    L+   GH A ++D+++ P N   +S S D S+RLW+L   K 
Sbjct: 87  STMKSFDIRHLNLETNQYLRYFIGHDALVSDIEMSPLNDTFLSASYDESVRLWDLRVSKA 146

Query: 169 AAVLK-----LRNYSQNGQFVRWIGNGDYFAVALLN 199
            A++         Y  +G  V  +GN + F + L N
Sbjct: 147 QAIVPSVVPHCIAYDPSG-LVFALGNPENFEIGLYN 181

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 17/140 (12%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLL--AHQGSITNLKFSKS 92
            QAH  +V  +  S    +L+SG  D  I+I+  Q    +  +L  AH   + ++ FS S
Sbjct: 117 MQAHDSAVTVMQYSHAGDWLISGDADGTIKIW--QPNFNMVKVLDRAHTECMRDISFSYS 174

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
             +            ++ S+DN + IW   + +    L GH   +   D HP   + +S 
Sbjct: 175 DQK-----------FVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSG 223

Query: 153 SEDHSIRLWNLMTVKKAAVL 172
           S+D+ I+LW+  T +  + +
Sbjct: 224 SKDNLIKLWDPRTGRNVSTI 243

>YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 and
           COMPASS complex and pre-mRNA cleavage factor II complex
           [990 bp, 329 aa]
          Length = 329

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 75/159 (47%), Gaps = 17/159 (10%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW 106
            D + ++L++ S+++ +++Y     K L T+ + +    +  F+ ++          N+ 
Sbjct: 35  FDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHAQ----------NEC 84

Query: 107 LLSASEDNKIIIW-RVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           + S++  N  I +  ++  +      GH A +ND+ ++P N   +S S D S+RLW+L  
Sbjct: 85  IYSSTMKNFDIKYLNLETNQYLRYFSGHGALVNDLKMNPVNDTFLSSSYDESVRLWDLKI 144

Query: 166 VKKAAVLK-----LRNYSQNGQFVRWIGNGDYFAVALLN 199
            K   ++         Y  +G  V  +GN + F + L N
Sbjct: 145 SKPQVIIPSLVPNCIAYDPSG-LVFALGNPENFEIGLYN 182

>Kwal_23.4118
          Length = 939

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 95/240 (39%), Gaps = 32/240 (13%)

Query: 35  FHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           +     A+S   +D   R +VS   D  +  YD  K   LG L      +T++ + +S  
Sbjct: 499 YRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSSYLGKL-QLDAPVTSMVYHRS-- 555

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                    +     A +D  I++      +    L GH  RI+  D  P  R  IS S 
Sbjct: 556 ---------SDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSL 606

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALL--NKVLIYKTAAAKVH 212
           D + R W+L T      ++L + + N   +R+  N D+ A   +  N +LI+        
Sbjct: 607 DGTARTWDLPTGCCIDGIRLDSVATN---IRFSPNADFVATTHVNGNGILIW-------- 655

Query: 213 CEIDMNKKTIMHLETETLDGKIY--ICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGH 270
                N+     L  + ++ + +  I  +MS G       +G    E K +E E S +GH
Sbjct: 656 ----TNRAQFRALPAKQMEEEDFSSIATSMSFGKTETSMLDGAFDSE-KTDENEDSEIGH 710

 Score = 32.3 bits (72), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 267 LLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           L GHSNR+  F F  +  G +++S   DG    WD+
Sbjct: 582 LWGHSNRISSFDFSPD--GRWIISTSLDGTARTWDL 615

>Scas_717.68
          Length = 908

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 94/214 (43%), Gaps = 23/214 (10%)

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRW 186
           F   K H A + D+D   +N + I+ S D +++LW+L   ++   LK   +      VR+
Sbjct: 321 FKIFKEHTADVLDLDWSKNNFL-ITSSMDRTVKLWHL---ERQTSLKTFQHQDFVTCVRF 376

Query: 187 IGNGDYFAVA--LLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGN 244
               D F ++  L +KV ++     ++  E D  +  I  L     DGK Y  V   +G 
Sbjct: 377 HPTDDRFFISGCLDHKVRLWSILENEITFEFDC-QDLITSLTLSPGDGK-YTIVGTFNGY 434

Query: 245 IHFYPTEGL--------LTEEPKVEEPEFSLLGHSNRVKDFKFYK--NDFGTYMVSIGSD 294
           +H   T+GL        + +  +      + + H  RV   + +K   D    +V   SD
Sbjct: 435 VHVLLTKGLEQVSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSD 494

Query: 295 GRVVVWDMEKK---DELAVYDCG--ERLNCLAVV 323
            R+ ++D+EKK   + L  +  G  +   CLA V
Sbjct: 495 SRIRIFDLEKKKLLEYLKGFQSGASQHKACLATV 528

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           + K+L + +ED  I IW ++  +    LKGH   I  +D  PS    +S S D ++R+W+
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 163 LMTVKKAAVLKLRNYSQNGQFVRWI--GNGDYFAVALLNKVL 202
           L T +    L +    ++G     +  G+G + A   L++ +
Sbjct: 626 LKTGQCTLTLSI----EDGVTTVAVSPGDGKFIAAGSLDRAV 663

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 13/118 (11%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C     ++L +G+ D+ IRI+D++++K +  L  H+  I +L +  S    GD       
Sbjct: 562 CFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPS----GDK------ 611

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV-SEDHSIRLWN 162
            L+S S D  + IW +K  +   TL      +  V + P +   I+  S D ++R+W+
Sbjct: 612 -LVSGSGDRTVRIWDLKTGQCTLTLSIEDG-VTTVAVSPGDGKFIAAGSLDRAVRVWD 667

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 60/144 (41%), Gaps = 24/144 (16%)

Query: 34  IFHFQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +   + H   +  LD   S   LVSGS D  +RI+DL+  +   TL    G +T +  S 
Sbjct: 590 VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDG-VTTVAVSP 648

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIW---------RVKDWENFGTLKGHIARINDVDI 142
                GDG     K++ + S D  + +W         R+      GT  GH   +  V  
Sbjct: 649 -----GDG-----KFIAAGSLDRAVRVWDSDTGFLVERLDSENELGT--GHKDSVYSVVF 696

Query: 143 HPSNRVAISVSEDHSIRLWNLMTV 166
                  +S S D S++LWNL  V
Sbjct: 697 TRDGNGVVSGSLDRSVKLWNLRNV 720

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 65/143 (45%), Gaps = 24/143 (16%)

Query: 38  QAHALSVKCLDVSKRY---LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           +AH   + CLD    +     +GS D  ++++DL K+K++ TL  H  SI+ ++  +  T
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYST 453

Query: 95  ENGDGEGSNNK-WLL---------SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHP 144
               G  +  K W +         ++SEDN   ++         T   H+  I  +    
Sbjct: 454 LITGGRDAVLKLWDIDKAMADEASNSSEDNDACLY---------TFDSHVDEITAISFDG 504

Query: 145 SNRVAISVSEDHSIRLWNLMTVK 167
            N V  S S+D ++R W+L + K
Sbjct: 505 DNLV--SGSQDRTVRQWDLNSGK 525

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTL--------LAHQGSIT 85
           ++ F +H   +  +      LVSGS D  +R +DL   K   T+        +  Q +I 
Sbjct: 487 LYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIP 546

Query: 86  NLKFSKSKTENGDGEGS---NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI 142
            L+ S   T+     G+    +  L + ++D  + +W ++  +    L+GH   I  +  
Sbjct: 547 -LRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQF 605

Query: 143 HPSNRVAISVSEDHSIRLWNLMT 165
              N V  ++  D SIR+W+L T
Sbjct: 606 DSVNLVTGAM--DRSIRIWDLRT 626

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 246 HFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGS-DGRVVVWDMEK 304
            FY +   +T  PK  + + + L       DF      FGT M S GS D  V VWD+ K
Sbjct: 381 QFYDSGSKITSLPKAHDEDITCL-------DFDM---PFGT-MCSAGSLDHSVKVWDLSK 429

Query: 305 KDELAV 310
           K ++A 
Sbjct: 430 KKQIAT 435

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 37  FQAH--ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
            QAH  A++V     +  ++VSGS D  ++I+            AH   +  + FS +  
Sbjct: 119 MQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQ 178

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
           +            +S S+DN + IW   + +    L GH   +   D HP   + +S S+
Sbjct: 179 K-----------FVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSK 227

Query: 155 DHSIRLWN 162
           D+ I+ W+
Sbjct: 228 DNLIKFWD 235

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 19/100 (19%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK----G 132
           + AH  ++T + +S +    GD       W++S S D ++ IW+     NF  +K     
Sbjct: 119 MQAHDSAVTVMTYSHT----GD-------WMVSGSADGELKIWQ----PNFNMVKVMDQA 163

Query: 133 HIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           H+  + ++   P+++  +S S+D+ +++WN    ++  VL
Sbjct: 164 HMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVL 203

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 93/215 (43%), Gaps = 32/215 (14%)

Query: 116 IIIWRVKDWEN---FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
           I +W+  D  +   F TLKGH A +  V       + +S SED  +R+WN   +++  + 
Sbjct: 35  IALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMD 94

Query: 173 KLRNYSQNGQFVRWIGNGDY--FAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETL 230
           ++       + ++ I +  +     A+L  +L+   A   +     +  + ++  E    
Sbjct: 95  EV-------ECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQ 147

Query: 231 DGKIYICVAM--------------SDGNIHFYPTEGLLTEEPKVEEPEFS--LLGHSNRV 274
            G   +C++M              ++ N+  Y    L++    V + EF+  L GH + +
Sbjct: 148 KGVFPLCLSMHEIEKTQFILAIGGTNVNVFIY---SLVSNSEGVSKLEFATKLEGHEDWI 204

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVV-VWDMEKKDEL 308
           K   F +   G Y+++ GS  R + +W +   +++
Sbjct: 205 KSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKI 239

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 11/146 (7%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTL-------LAHQGSITNLKF 89
           F  H  SV  L  +   +VSGSND+ +R +DL   K + ++       +  Q S++ L  
Sbjct: 371 FDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQ-SVSKLDI 429

Query: 90  SKS-KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRV 148
           + S  T    G    +  L++ ++D  + +W ++     G+L+GH   I  +    S   
Sbjct: 430 TPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSE-- 487

Query: 149 AISVSEDHSIRLWNLMTVKKAAVLKL 174
            I+ S D S R+W+L     A +L  
Sbjct: 488 LITGSMDKSTRIWDLRMGSVAELLSF 513

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 109 SASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           +A+ DN+I +W +   +  G L GH A +N        R+  S  +D S+++W++
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDV 352

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 63/158 (39%), Gaps = 31/158 (19%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN---LKFSKSK 93
           F  H+  VK +DV   Y++SGS D  +R+        L     H+  I     + FS SK
Sbjct: 261 FSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSK 320

Query: 94  TENGDGEGSNN---------KWLLSASEDNKIIIWRVK-----------------DWENF 127
                    N          K+  SA+ DN I IW V                   ++  
Sbjct: 321 ICTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCV 380

Query: 128 GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
            TL+GH + + D+ +   +    S S+D +I+ W+L T
Sbjct: 381 MTLRGHTSWVKDLKLRGDH--LFSCSDDETIKCWDLNT 416

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 125/336 (37%), Gaps = 72/336 (21%)

Query: 33  PIFHFQAHALSVKCLDV-----------SKRYLVSGSNDEHIRIYDLQKR----KELGTL 77
           P+    AH+ ++  ++V           S   + + S D  I +YD        K + + 
Sbjct: 158 PLAVTTAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSF 217

Query: 78  LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARI 137
            AH  ++     S  KT   D    N+  L S+S D  + +WRV D     +   H   +
Sbjct: 218 NAHDSTV-----SSQKTWQKD----NDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWV 268

Query: 138 NDVDIHPSNRVAISVSEDHSIRL--WNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAV 195
             +D+   +   +S S D ++RL  W                S NG  V   G G  F +
Sbjct: 269 KSIDVL--DEYILSGSLDSTLRLTHWP---------------SGNGLSV---GTGHEFPI 308

Query: 196 ALLNKVLIYKTAAAKVHCEI--DMNKKTIMHLETETLDGKIYICVAMSDGNIHFY--PTE 251
               +VLI   + +K+      D N+    H     L  K Y   A  D  I  +  P  
Sbjct: 309 ---ERVLIIPFSDSKICTSPYRDQNE----HSAFAPLRFK-YCASAARDNTIKIWEVPLP 360

Query: 252 GLLTEEPKVEEPE-------FSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
            L      V            +L GH++ VKD K      G ++ S   D  +  WD+  
Sbjct: 361 QLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKLR----GDHLFSCSDDETIKCWDLNT 416

Query: 305 KDELAVYDC--GERLNCLAVVDE-TVEKYETMKKRD 337
            + +  +       +NC+ +  E T+E++    +R+
Sbjct: 417 GNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQRE 452

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 105/265 (39%), Gaps = 46/265 (17%)

Query: 77  LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIAR 136
           L  H+  +T +KF      N DG+      + + S+D+   IW   + E  GTL  H   
Sbjct: 6   LKGHERPLTQVKF------NRDGD-----LVFACSKDSVASIWYAINGERLGTLDDHSGT 54

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWNLMT-------VKKAAVLKLRNYSQNGQFVRWIGN 189
           I  +D+  S   A++   D   ++W + T         ++ VL++  +S +G  +  + +
Sbjct: 55  IWSIDVDESTTYALTGGADFCFKIWKVATGVAVHSVSTRSPVLRV-EFSPDGSKLLIVLD 113

Query: 190 GDYFAVALLNKVLIYK------TAAAKVHCEIDMNKKTI-----MHLETETLDGKIYICV 238
                +  +  +++Y            V  E D    TI     + + + + +GK YI  
Sbjct: 114 A---VMGHIGSIVVYSLIRNENGEIVNVKEEPDYEITTIEQATKVFVASWSYNGK-YIIA 169

Query: 239 AMSDGNIH-FYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRV 297
              DG I  +Y   G   +  K+         H   +KD +F  +   TY ++   D   
Sbjct: 170 GHEDGQISAYYGENGEFVQAKKI---------HEKSIKDIQFSPDR--TYFITSSRDSVA 218

Query: 298 VVWDMEKKDELAVYDCGERLNCLAV 322
            + D++  + L  Y     LN  ++
Sbjct: 219 SLVDVDTFEVLKTYKADCPLNSASI 243

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 10/128 (7%)

Query: 40  HALSVKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLA----HQGSITNLKFSKSK 93
           H  S+K +  S  + Y ++ S D    + D+   + L T  A    +  SIT LK     
Sbjct: 193 HEKSIKDIQFSPDRTYFITSSRDSVASLVDVDTFEVLKTYKADCPLNSASITPLK---EF 249

Query: 94  TENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
              G G+ + +    SA E   +  I+     +  G +KGH   +N V + P+     S 
Sbjct: 250 VILGGGQDAKDVTTTSAREGKFEARIYHKVFQDEIGRVKGHFGPLNYVAVSPTGTSYASG 309

Query: 153 SEDHSIRL 160
            ED  IRL
Sbjct: 310 GEDGYIRL 317

>Kwal_23.6240
          Length = 913

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 85/197 (43%), Gaps = 20/197 (10%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           FQ H  +V  L  +KR   L S S D  +R +DL + +   T  A +     ++F     
Sbjct: 379 FQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAE----RIQF----- 429

Query: 95  ENGDGEGSNNKWLLSASEDNKII-IWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
            N      + + + + S D+  + +W V+  +   TL GH   ++ +     N V  S S
Sbjct: 430 -NCLAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASAS 488

Query: 154 EDHSIRLWNLMTVKKAAVLKLRNYSQNGQF-VRWIGNGDYFAVALLNKVLIYKTAAAKVH 212
            D +IR+W++   +   V  L  Y+      VR  GN +  A  L  ++L +     K  
Sbjct: 489 WDKTIRIWSIFG-RSQQVEPLEVYADVLSLSVRPDGN-EVAAATLDGQILFFDVHEGKQV 546

Query: 213 CEIDMNKKTIM---HLE 226
             ID  KK I+   HLE
Sbjct: 547 NAID-GKKDILSGRHLE 562

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 14/142 (9%)

Query: 29  PLFTPI--FHFQAHALSVKCLDVSKRYLVSGSND-EHIRIYDLQKRKELGTLLAHQGSIT 85
           P FT I       +A++  C++ S  +L  GS+    + +Y+ Q       +L  QG   
Sbjct: 286 PEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSES---YILKQQG--- 339

Query: 86  NLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS 145
           +   + + T + DG       +++ASED KI IW V       T + H A ++ +     
Sbjct: 340 HFDATNAVTYSPDGSR-----VVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKR 394

Query: 146 NRVAISVSEDHSIRLWNLMTVK 167
            +V  S S D ++R W+L+  +
Sbjct: 395 GQVLFSASLDGTVRAWDLVRYR 416

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 113/322 (35%), Gaps = 50/322 (15%)

Query: 31  FTPIFHFQAHA---LSVKCLDVSK--RYLVSGSNDEHIRIYDL-QKRKELG--TLLAHQG 82
           F P    + HA    ++  L  S+  R+L+S S D   RI+ L  + K L   T   H+ 
Sbjct: 133 FAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRD 192

Query: 83  SITNLKFSKSK----TENGDG-----EGSNNKWLLSASEDNKIII------WRVKDWENF 127
            +    FS  +    T + DG     E +      S  +D +  I      WR+     F
Sbjct: 193 YVMGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWRITKKNYF 252

Query: 128 GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWI 187
              +   AR+  V  H ++   +    +   RL+ L        L +   + N   V   
Sbjct: 253 YASQ---ARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDS 309

Query: 188 GNGDYFAVALLNKVLIYK----TAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDG 243
           G    F  + L ++L+Y+    +   K     D          T + DG   +  A  DG
Sbjct: 310 GEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAV-----TYSPDGS-RVVTASEDG 363

Query: 244 NIHFYPT-EGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
            I  +    G             +   H+  V    F K   G  + S   DG V  WD+
Sbjct: 364 KIKIWDVVSGFCL---------VTFQEHTAAVSALAFAKR--GQVLFSASLDGTVRAWDL 412

Query: 303 EKKDELAVYDCGERL--NCLAV 322
            +      +   ER+  NCLA 
Sbjct: 413 VRYRNFRTFTAAERIQFNCLAA 434

>Scas_603.5
          Length = 589

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           +V+ L      L +GS D  IR++DL+  K + TLL HQG IT+L+F  +K   G  + +
Sbjct: 443 TVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDAN 502

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 13/99 (13%)

Query: 67  DLQKRKELGTLLA-HQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKII-IWRVKDW 124
           DL+    LGTL + +  ++T L F  S            K L +A + N  I +W ++  
Sbjct: 279 DLKSGSHLGTLDSVYTDTVTCLDFDLS-----------TKMLYTAGKYNTSIKVWDLETN 327

Query: 125 ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           +    L  HIA +  + +HP ++  I+ S+D +++LW+L
Sbjct: 328 DQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDL 366

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 17/167 (10%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTP------IFHFQAHALSVKCLDVSKRYLVSGSNDE 61
           +I GS +  +    L L+ +T L +       I  F+AH   +  +     YL+S S D+
Sbjct: 352 LITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDK 411

Query: 62  HIRIYDLQKRKELGTL---LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
            IR +DL     + TL   L+H  S TN+K S  +     G       L + S+D  I +
Sbjct: 412 SIRQWDLTTGNCVQTLEATLSH-NSGTNIKDSTVEALQSVGAA-----LATGSKDGIIRL 465

Query: 119 WRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           W ++  +   TL  H   I  +    +    I+ S D +I + +L T
Sbjct: 466 WDLRSGKVVRTLLKHQGPITSLQFDSTK--IITGSTDANISVSDLRT 510

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 58/138 (42%), Gaps = 28/138 (20%)

Query: 43  SVKCLDV---SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDG 99
           +V CLD    +K    +G  +  I+++DL+   ++  L  H  S+T ++           
Sbjct: 296 TVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHP-------- 347

Query: 100 EGSNNKWLLSASEDNKIIIW--------RVKDWEN----FGTLKGHIARINDVDIHPSNR 147
              ++K L++ S+D  + +W         +    N      T + H A I  V     N 
Sbjct: 348 ---DSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY--DNE 402

Query: 148 VAISVSEDHSIRLWNLMT 165
             +S S D SIR W+L T
Sbjct: 403 YLLSASRDKSIRQWDLTT 420

>CAGL0L09757g complement(1046898..1047878) highly similar to
           sp|P36104 Saccharomyces cerevisiae YKL018w, start by
           similarity
          Length = 326

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           C D   ++L++ S  + + +YD    + L T+ + +      KF+ +++E          
Sbjct: 33  CFDDHGQHLLASSASDTMHLYDSVGCRFLNTIASKKYGCHAAKFTHAQSE---------- 82

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLK---GHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
                S   K    R  + E    L+   GH A ++D+ + P N   +S S D S+R+W+
Sbjct: 83  --CIYSSTMKTFDIRHLNLETNQYLRYFVGHGALVSDIQMSPINDSFLSASYDESVRVWD 140

Query: 163 LMTVKKAAVLK 173
           L T K  A++ 
Sbjct: 141 LRTSKAQAIIP 151

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 15/163 (9%)

Query: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           ++     A++   +D   R +VS   D  +  YD  K   LG L      IT++ + +S 
Sbjct: 499 VYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKSTFLGKL-KLDSPITSMVYHRS- 556

Query: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
                     +     A +D  I++      +    L GH  RI+  D  P  R  +S S
Sbjct: 557 ----------SDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSS 606

Query: 154 EDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
            D +IR W+L T      +K+ N   N   +++  NGD  A  
Sbjct: 607 LDSTIRTWDLPTGGCIDGMKVENVITN---IKFSPNGDLLATT 646

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 267 LLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           L GHSNR+  F F  +  G ++VS   D  +  WD+
Sbjct: 583 LWGHSNRISSFDFSPD--GRWIVSSSLDSTIRTWDL 616

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 79/198 (39%), Gaps = 28/198 (14%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
           S++++ + S D+ ++I+ L+    L TL  H  ++    F   +           K L+S
Sbjct: 548 SEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQ-----------KQLVS 596

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT---- 165
           A  D  I +W +   +    L GH  RI  + +     + IS   D   + W   T    
Sbjct: 597 AGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

Query: 166 --------VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDM 217
                   V+      L NY  NG++     N    A+ L + + ++    + +  + + 
Sbjct: 657 QGALEENKVRVEQEQSLTNYMNNGEW----SNAFLLALQLDHPMRLFNVLRSSMGSQPEQ 712

Query: 218 -NKKTIMHLETETLDGKI 234
            N K I + E ++L G +
Sbjct: 713 ANGKVIFNQELDSLIGTL 730

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/136 (17%), Positives = 60/136 (44%), Gaps = 13/136 (9%)

Query: 32  TPIFHFQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF 89
           + I+   AH   +  + ++       + S D+  +++++   + + TL  H+  + ++ F
Sbjct: 486 SSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSF 545

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVA 149
            +S+           KW+ + S D  + IW ++ +    TL+GH   +         +  
Sbjct: 546 CESE-----------KWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQL 594

Query: 150 ISVSEDHSIRLWNLMT 165
           +S   D  I++W++ +
Sbjct: 595 VSAGADGLIKVWDIAS 610

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/247 (19%), Positives = 101/247 (40%), Gaps = 39/247 (15%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWEN-------FGTLKGHIARINDV---DIHPSN--RVAI 150
           + +WL +AS+D   I+W    W N       + T  GH A ++ V   ++   N  +  I
Sbjct: 401 DGQWLATASKDKTAILWH---WNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYII 457

Query: 151 SVSEDHSIRLWNLMTVK----------KAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNK 200
           + S D +++ W +  +K          K+++     + ++   +    N   FA A  +K
Sbjct: 458 TASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDK 517

Query: 201 VL-IYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPK 259
              ++     +    +  +K+ +   +    + + +I     D  +  +  E     +  
Sbjct: 518 TCKLWNVDTGEPVATLANHKRGLW--DVSFCESEKWIATCSGDKTVKIWSLESFTVLK-- 573

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDC-GERLN 318
                 +L GH+N V+   F        +VS G+DG + VWD+   D +   D    R+ 
Sbjct: 574 ------TLEGHTNAVQRCSFMNKQ--KQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIW 625

Query: 319 CLAVVDE 325
            L+V+++
Sbjct: 626 ALSVLED 632

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 56/134 (41%), Gaps = 13/134 (9%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V   D +   +  G  D  I + D++      +   H G+I++LKF         GE   
Sbjct: 108 VMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFY--------GELGT 159

Query: 104 NKWLLSASEDNKII-IWRVKDWENFGTLKGHIARINDVDIHPSNRV----AISVSEDHSI 158
           N WLL + + N +  +W +   +   T++ H + I  +D   ++       I+   D+ +
Sbjct: 160 NIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVL 219

Query: 159 RLWNLMTVKKAAVL 172
            LW      K++ L
Sbjct: 220 NLWRFNIKGKSSKL 233

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           + SGS D  I+ +D+  R+++ +  AH G+IT L  +     +    G+ N ++LS+S+D
Sbjct: 83  IASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQN-FVLSSSDD 141

Query: 114 NKIIIWRV 121
             + +W V
Sbjct: 142 KTVKLWSV 149

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 21/124 (16%)

Query: 6   FRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHI 63
           F  +V S +HN     +       +   +  F+ H  +V  +D+S     +V+ S D+ I
Sbjct: 272 FNFVVASEDHNAYYYDM-----RNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTI 326

Query: 64  RIYDLQK--RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRV 121
           RI+ + K   +E+      Q  +   KFS            ++K+++S S+D  + +WR 
Sbjct: 327 RIFPINKGHSREIYHTKRMQ-HVFQAKFS-----------MDSKYVMSGSDDGNVRLWRA 374

Query: 122 KDWE 125
           K WE
Sbjct: 375 KAWE 378

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 53/134 (39%), Gaps = 33/134 (24%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS------------- 109
           I ++D+ + K L  L     +I  +KF+++        GS+N  +L              
Sbjct: 198 INLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQ 257

Query: 110 -------------------ASEDNKIIIWRVKDWEN-FGTLKGHIARINDVDIHPSNRVA 149
                              ASED+    + +++        K H++ + DVDI P+    
Sbjct: 258 TMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEV 317

Query: 150 ISVSEDHSIRLWNL 163
           ++ S D +IR++ +
Sbjct: 318 VTASYDKTIRIFPI 331

>Kwal_27.11585
          Length = 823

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 103/246 (41%), Gaps = 32/246 (13%)

Query: 103 NNKWLLSASEDNKIIIWRV----KDWENFGTLKGHIARINDVDIHPSNR-----VAISVS 153
           N +WL + S+D+ +I+W++    + ++ +    GH   +  V +    R       I+ S
Sbjct: 411 NGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITAS 470

Query: 154 EDHSIRLWNLMTVKKAAV----LKLRNYSQNGQ-----FVRWIGNGDYFAVALLNKVL-I 203
            D +I+ W++       V    +K+ +Y++         +    N   FA A  +K   I
Sbjct: 471 NDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKI 530

Query: 204 YKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEP 263
           +   + ++   +  +K+ +  +     D  +  C    D  I  +  E +   +      
Sbjct: 531 WNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSG--DKTIKVWSLESMSVVK------ 582

Query: 264 EFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDC-GERLNCLAV 322
             +L GH+N V+   F   +    +VS G+DG + VWD+   + +   D    R+  L+V
Sbjct: 583 --TLEGHTNAVQRCSFINRN--KQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSV 638

Query: 323 VDETVE 328
           + +  E
Sbjct: 639 LSDGKE 644

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 27/181 (14%)

Query: 31  FTPIFHFQAHALSVKCLDVS-------KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGS 83
           F P   F  HA  V  + +          ++++ SND  I+ + + K        ++   
Sbjct: 436 FKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPT------SNDVD 489

Query: 84  ITNLKFSK------SKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARI 137
           + N+K S        K  N      N+    +AS D    IW V   E  GTL  H   +
Sbjct: 490 MHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGL 549

Query: 138 NDVDIHPSNRVAISVSEDHSIRLWNL--MTVKKA------AVLKLRNYSQNGQFVRWIGN 189
            DV     +++  + S D +I++W+L  M+V K       AV +    ++N Q V    +
Sbjct: 550 WDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGAD 609

Query: 190 G 190
           G
Sbjct: 610 G 610

>Kwal_26.8975
          Length = 445

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 87/201 (43%), Gaps = 47/201 (23%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLD-VSKRYLVSGSNDEHIRI 65
           +I+ GSY+  +   +L   ++         +  H+ +V+ +  +S   LVSG+ND  +R+
Sbjct: 114 KIVSGSYDGIVRTWNLSGKVEK-------QYAGHSGAVRAVKYISSTRLVSGANDRTLRL 166

Query: 66  Y----------------DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW--- 106
           +                D+++ K L  L AH+  +  +  S  +  +G  + S   W   
Sbjct: 167 WKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTN 226

Query: 107 ----------------LLSASEDNKIIIWR---VKDWENFGTLKGHIARINDVDIHPSNR 147
                           + SA++  + +  +   V+       L+ H A + +V    +++
Sbjct: 227 HKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESHTAPVEEVLFDFADK 286

Query: 148 -VAISVSEDHSIRLWNLMTVK 167
            V  SVS+DH+I+ W+L+T +
Sbjct: 287 TVGYSVSQDHTIKTWDLVTAR 307

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 19/129 (14%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKSKTENGDGEGS 102
           V  LDV    +VSGS D  +R ++L  + E      H G++  +K+ S ++  +G  + +
Sbjct: 105 VSALDVGGDKIVSGSYDGIVRTWNLSGKVE-KQYAGHSGAVRAVKYISSTRLVSGANDRT 163

Query: 103 NNKWL---------LSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
              W          L+A ED+      V++ +    L+ H A +  VD+   +R+ IS S
Sbjct: 164 LRLWKTKNDELKNNLAAEEDD------VEEGKTLAILEAHKAPVVTVDVS-GDRI-ISGS 215

Query: 154 EDHSIRLWN 162
            D+SI  W+
Sbjct: 216 YDNSIGFWS 224

>Scas_657.13
          Length = 411

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 26/147 (17%)

Query: 31  FTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKF 89
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++TN++F
Sbjct: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD--------------WENFGTLKGHIA 135
           S  +    DG       L+++ ED + IIW + D               E      GH +
Sbjct: 314 SPDQ----DG------ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363

Query: 136 RINDVDIHPSNRVAISVSEDHS-IRLW 161
            IND  ++P+    ++ SE+ + I++W
Sbjct: 364 AINDFSMNPNIPWLMASSEEENIIQVW 390

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           +  P  S+ GH   V + +F  +  G  M S G D R ++WD+
Sbjct: 294 ISRPLHSMAGHDGAVTNMEFSPDQDGILMTS-GEDRRAIIWDI 335

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 26/145 (17%)

Query: 44  VKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKS--------- 92
           V  LDVS   R++ SGS D  +R +++  + E      H G++  +K+  +         
Sbjct: 106 VSALDVSDDFRHIYSGSYDGVVRTWNMSGKVE-KQYSGHTGAVKAVKYISNTRIVSAGND 164

Query: 93  ------KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSN 146
                 KT+N DG  SNN    +  E+++     ++D +    L+GH A +  +D+  ++
Sbjct: 165 RSLRLWKTKNDDGSVSNN----TGDENDE---ENIEDGKTLAILEGHKAPVVSLDVASNS 217

Query: 147 RVAISVSEDHSIRLWNLMTVKKAAV 171
           R+ +S S D+++ LW+ +  +  A+
Sbjct: 218 RI-LSASYDNTVALWSTIYKEMTAI 241

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 66/192 (34%), Gaps = 72/192 (37%)

Query: 36  HFQAHALSVKCLD-VSKRYLVSGSNDEHIRIY--------------------DLQKRKEL 74
            +  H  +VK +  +S   +VS  ND  +R++                    +++  K L
Sbjct: 139 QYSGHTGAVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTL 198

Query: 75  GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR-------------- 120
             L  H+  + +L  +            +N  +LSAS DN + +W               
Sbjct: 199 AILEGHKAPVVSLDVA------------SNSRILSASYDNTVALWSTIYKEMTAIDHLEE 246

Query: 121 ------------------------VKDWENFGTLKGHIARINDVDI-HPSNRVAISVSED 155
                                   ++       L+ H   +  V   H  N V  SVS+D
Sbjct: 247 IQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQD 306

Query: 156 HSIRLWNLMTVK 167
           H+I+ W+L+T +
Sbjct: 307 HTIKTWDLVTAR 318

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 108/253 (42%), Gaps = 53/253 (20%)

Query: 30  LFTPIFHFQAHALSVKCLDVS--KRYLVSG---SNDEH--IRIYDLQKRKELGTLLA-HQ 81
           L+  +     H   +  +DVS  ++ +VS    +N +H  IRI+DL    E+   L+ H 
Sbjct: 552 LWPEVEKLYGHGYEITSVDVSPDQKLVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHS 611

Query: 82  GSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTL-----KGHIAR 136
            +IT L+FS            ++K+LLS   D K  +W     +N  TL     K H   
Sbjct: 612 LTITRLRFSP-----------DSKYLLSVCRDRKWAVWERNFDDNTFTLKYTDEKPHSRI 660

Query: 137 INDVDIHP--SNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFA 194
           I D +  P     V ++ S D  +++W+L T +  A   L        F++   N    A
Sbjct: 661 IWDGEWAPLEFGNVFLTTSRDRKVKVWSLETSESNAFSML-------HFIK--LNSPITA 711

Query: 195 VALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYIC-VAMSDGNIHFYPTEGL 253
           +++ NKV+               N K I+ +  ET  G+I+I   + SDG       E  
Sbjct: 712 ISIYNKVI---------------NNKLIVAVGLET--GEIFIYNYSKSDGFELISQFEQY 754

Query: 254 LTEEPKVEEPEFS 266
           +T   ++E   +S
Sbjct: 755 ITPSDRIERLRWS 767

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 81/199 (40%), Gaps = 27/199 (13%)

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRW 186
           + TLKGH A +  V   P   + +S SEDH ++LW     +   +  ++  +     +  
Sbjct: 51  YATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELECIQTITHYSHTI-- 108

Query: 187 IGNGDYFAVALLNKVLIYKTAAAKVHC---EIDMNKKTIMHLETETLDGKIYICVAMSD- 242
                  ++  L  +++  +A   V     E + +   I+  E         +C ++S+ 
Sbjct: 109 ------VSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLSNV 162

Query: 243 -GNIHFYPTEG----------LLTEEPKVEEPEFS--LLGHSNRVKDFKF-YKNDFGTYM 288
            GN +     G          +L+E   +E    +  L GH + VK  +F ++   G Y+
Sbjct: 163 VGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYL 222

Query: 289 VSIGSDGRVV-VWDMEKKD 306
           +  GS  R + +W +   D
Sbjct: 223 LCSGSQDRYIRIWRIRTND 241

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 38  QAH--ALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
           Q H   L+  C       +V+ S++  I+I+D+     L T   H G ++ ++F+K    
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAK---- 393

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKG-HIARINDVDIHPSNRVAISVSE 154
                    + L SAS D  +  W +  + NF T       + N + + PS  V  + SE
Sbjct: 394 -------KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSE 446

Query: 155 D-HSIRLWNLMT 165
           D   I +W++ T
Sbjct: 447 DSFDIFVWSVQT 458

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 61/131 (46%), Gaps = 13/131 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F  HA  V  ++ +K+   L S S D  ++ +DL + +   T  A +     ++F+    
Sbjct: 379 FDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATE----RIQFNSLAV 434

Query: 95  ENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
           +       + + + + SED+  I +W V+  +   TL GH   I+ +     N V  S S
Sbjct: 435 D------PSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASAS 488

Query: 154 EDHSIRLWNLM 164
            D +IR+W+L 
Sbjct: 489 WDKTIRVWSLF 499

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 55/132 (41%), Gaps = 14/132 (10%)

Query: 37  FQAHALSVKC--LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F A+   VKC     +   L  G ++   R+Y+L +   +  L   Q ++  +       
Sbjct: 252 FHANRAKVKCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQLSMGQNAVNTVAI----- 306

Query: 95  ENGDGEGSNNKWL-LSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
            N  GE     WL   +S+  ++I++  +        +GH   +N +   P     ++ S
Sbjct: 307 -NSSGE-----WLAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTAS 360

Query: 154 EDHSIRLWNLMT 165
            +  I++W++ +
Sbjct: 361 HEGKIKIWDVAS 372

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 74/187 (39%), Gaps = 19/187 (10%)

Query: 9   IVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDL 68
            VGS E  I   +L   L+   +         A++   +D   R +VS   D  I  YD 
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKY----RLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDF 537

Query: 69  QKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFG 128
            K   LG L      +T++ + +S           +     A +D  I++      +   
Sbjct: 538 TKSAFLGKL-QLDAPVTSMVYHRS-----------SDLFAVALDDLSIVVIDAVTQKVVR 585

Query: 129 TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIG 188
            L GH  R+   D  P  R  +S S D +IR W+L T      ++L + + N   +++  
Sbjct: 586 QLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVRLDSVATN---LKFSP 642

Query: 189 NGDYFAV 195
           NGD  A 
Sbjct: 643 NGDLLAT 649

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 267 LLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           L GHSNRV  F F  +  G ++VS   D  +  WD+
Sbjct: 587 LWGHSNRVTAFDFSPD--GRWIVSASLDSTIRTWDL 620

>Scas_629.12
          Length = 671

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
           DGE     +L + +ED  I IW +++ +    LKGH   +  +D  P+    +S S D +
Sbjct: 398 DGE-----FLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRT 452

Query: 158 IRLWNLMTVKKAAVLKL 174
           +R+W+L T + +  L +
Sbjct: 453 VRIWDLRTGQCSLTLSI 469

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 24/141 (17%)

Query: 34  IFHFQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSK 91
           +   + H   V  LD   +   LVSGS D  +RI+DL+  +   TL    G +T +  S 
Sbjct: 422 VMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSP 480

Query: 92  SKTENGDGEGSNNKWLLSASEDNKIIIW---------RVKDWENFGTLKGHIARINDVDI 142
           +     DG     K++ + S D  + +W         R+      GT  GH   +  V  
Sbjct: 481 N-----DG-----KFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT--GHRDSVYSVVF 528

Query: 143 HPSNRVAISVSEDHSIRLWNL 163
                  +S S D +++LWN+
Sbjct: 529 TRDGNEVVSGSLDKTVKLWNM 549

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           +Y++SGS D  I  +D +    L  L  H+ S+ ++  +     NG   G       + S
Sbjct: 590 KYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVA-----NGSALGPKYNVFATGS 644

Query: 112 EDNKIIIWR 120
            D K  IW+
Sbjct: 645 GDCKARIWK 653

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGH------IARINDVDIHPSNRVAISVSEDH 156
           ++K++LS S+D  I+ W  +       L+GH      +A  N   + P   V  + S D 
Sbjct: 588 DDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDC 647

Query: 157 SIRLW 161
             R+W
Sbjct: 648 KARIW 652

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 55/132 (41%), Gaps = 28/132 (21%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V  LDV   Y+ SGS D  +R Y+L  + E      H G I  + +  S           
Sbjct: 106 VSSLDVGSNYIYSGSYDGIVRTYNLSGKVE-KQYSGHSGPIRAVHYISSTR--------- 155

Query: 104 NKWLLSASEDNKIIIWRVK-------------DWENFGTLKGHIARINDVDIHPSNRVAI 150
              L+SA  D  + +W+ K             D +    L+GH A +  +D+  S    +
Sbjct: 156 ---LVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDV--SKDRIL 210

Query: 151 SVSEDHSIRLWN 162
           S S D+++ LW+
Sbjct: 211 SASCDNTVSLWS 222

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 71/182 (39%), Gaps = 63/182 (34%)

Query: 36  HFQAHALSVKCLD-VSKRYLVSGSNDEHIRIY-------------DLQKRKELGTLLAHQ 81
            +  H+  ++ +  +S   LVS  ND  +R++             +++  K L  L  H+
Sbjct: 137 QYSGHSGPIRAVHYISSTRLVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHK 196

Query: 82  GSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWR--------VKDWENFG----- 128
             + ++  SK +             +LSAS DN + +W         +   E+ G     
Sbjct: 197 APVVSIDVSKDR-------------ILSASCDNTVSLWSTNYKEMTVIDPMEDLGGNVST 243

Query: 129 --------TLK-GHIARINDVDIHPS--------------NRVAISVSEDHSIRLWNLMT 165
                   TLK G I R   + +  S              + V  SVS+DH+I+ W+L+T
Sbjct: 244 AAKKRRKLTLKDGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLIT 303

Query: 166 VK 167
            K
Sbjct: 304 AK 305

>KLLA0E18139g 1608371..1609351 highly similar to sp|P36104
           Saccharomyces cerevisiae YKL018w singleton, start by
           similarity
          Length = 326

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 71/160 (44%), Gaps = 19/160 (11%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW 106
            D   +YL++ +  +++ +YD    + L T+ + +    + KF+ +++E           
Sbjct: 34  FDDHGQYLLTATASDNMHLYDAVSCRFLNTIASKKYGCHSAKFTHAQSE----------- 82

Query: 107 LLSASEDNKIIIWRVKDWEN--FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
            + +S      I  +    N      +GH A ++D+ + P +   +S S D S+RLW+L 
Sbjct: 83  CIYSSTMKSFDIRHLNLETNTYLRYFQGHGALVSDIQMSPLDDTFLSASYDESVRLWDLR 142

Query: 165 TVKKAAVLK-----LRNYSQNGQFVRWIGNGDYFAVALLN 199
           + K  A++         Y  +G  V  IGN +   V L N
Sbjct: 143 SSKAQALIPSLVPTCIAYDPSG-LVFAIGNPENHEVGLYN 181

>Scas_718.6*
          Length = 546

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 73/165 (44%), Gaps = 38/165 (23%)

Query: 20  LSLDLSLKTPLFTPIF-----HFQ--------AHALSVKCLDVSKRYLVSGSNDEHIRIY 66
           +SLDL   T L+  I      HF+          +L V    V K  LV    +  I +Y
Sbjct: 295 ISLDLDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY 354

Query: 67  DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE-DNKIIIWRVKDWE 125
            +   K +G LL HQG+I+ ++F+            N++ LL++S+ D  I IW  +   
Sbjct: 355 SIDDNKPIGKLLGHQGTISCIEFN-----------VNSRLLLTSSDSDYSIRIWHGQKEN 403

Query: 126 NFGTLKGH------IARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
                 GH      ++ IND        + IS S D S+R+W+++
Sbjct: 404 CCNCFYGHSQSIISLSWIND-------DLVISASMDGSVRIWSVV 441

>Scas_720.83d
          Length = 915

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           FQ H  SV  +  +KR   L S S D  +R +DL + +   T  A +     ++F     
Sbjct: 381 FQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAE----RIQF----- 431

Query: 95  ENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
            N      + + + + S DN  I +W V+  +   TL GH   ++ +     N V  S S
Sbjct: 432 -NCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASAS 490

Query: 154 EDHSIRLWNLM 164
            D ++R+W++ 
Sbjct: 491 WDKTVRVWSIF 501

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 60/162 (37%), Gaps = 34/162 (20%)

Query: 37  FQAHALSVKCLD--VSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN-------- 86
           F A+   VKC+        LV G  +   R+Y+L     L  L   Q  I          
Sbjct: 254 FYANQCKVKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGE 313

Query: 87  -LKFSKSK----------------TENGDGEGSNN-------KWLLSASEDNKIIIWRVK 122
            L F  SK                 + G  + +N+         +++A+ED KI +W V 
Sbjct: 314 WLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVV 373

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
                 T + H + +  V      +V  S S D ++R W+L+
Sbjct: 374 SGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLI 415

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 91/216 (42%), Gaps = 27/216 (12%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           SN+   L +   N++ ++ + + ++F     H   I  +D++    + ISV ED    L 
Sbjct: 23  SNDGTQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIATIDLNKQGTLLISVDEDGRAILT 82

Query: 162 NLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAA------------ 209
           N    K   VL   N+ +    V++  +G  FA+A    + I+KT  A            
Sbjct: 83  NF---KAKTVLHHFNFKEKCYQVKFSPDGKLFALATGRFLQIWKTPDATEDRQFAPFVRY 139

Query: 210 KVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLG 269
           +VH     + + I+ L T +LD +  I  +  D     +  +   +EE  +    F+  G
Sbjct: 140 RVHAG---HFQDILSL-TWSLDSRFIISTS-KDLTARIWSID---SEEKDLASMTFA--G 189

Query: 270 HSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKK 305
           H + V    F  +    Y VS   DG + VW+  KK
Sbjct: 190 HRDYVMGAFFSADQEKIYTVS--KDGALFVWEFTKK 223

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 270 HSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERL--NCLAV 322
           H++ V   +F K   G  + S   DG V  WD+ +      +   ER+  NCLAV
Sbjct: 384 HTSSVTQVQFAKR--GQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAV 436

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 84/207 (40%), Gaps = 55/207 (26%)

Query: 26  LKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIY---------------DL 68
           +K P F+   H ++    +  +DVS   + + +G  D  IRI+               D 
Sbjct: 4   VKFPWFS--HHEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDR 61

Query: 69  QKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFG 128
              + L ++  H GS+T +KFS       DG      +L S S+D  ++IW + D EN G
Sbjct: 62  DTHRPLASMSRHTGSVTCVKFSP------DG-----NYLASGSDDRILLIWAM-DEENHG 109

Query: 129 ----------------TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
                            L  H   I D+   P + + ++V  D S+ +WN +  +     
Sbjct: 110 GSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFE----- 164

Query: 173 KLRNYSQNGQFVRWI---GNGDYFAVA 196
           +L+ +  +   V+ +       YFA A
Sbjct: 165 RLKRFDVHQSLVKGVIFDPANKYFATA 191

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 74/190 (38%), Gaps = 37/190 (19%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGT-------------- 76
           P+     H  SV C+  S    YL SGS+D  + I+ + +    G+              
Sbjct: 66  PLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRK 125

Query: 77  -LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
            L+AH   I ++ ++            ++  L++   D  +I+W   ++E       H +
Sbjct: 126 RLVAHDNDIQDICWA-----------PDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQS 174

Query: 136 RINDVDIHPSNRVAISVSEDHSIRLWNL-------MTVKKAAVLKLRNYSQNGQFVR--W 186
            +  V   P+N+   + S+D ++R++          T+++  V           F R  W
Sbjct: 175 LVKGVIFDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSW 234

Query: 187 IGNGDYFAVA 196
             +G + AV 
Sbjct: 235 SPDGQHIAVP 244

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 86/205 (41%), Gaps = 57/205 (27%)

Query: 7   RIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLD-VSKRYLVSGSNDEHIRI 65
           RI+ GSY+  +   +L   ++         +  H  +V+ +  +S   LVSG ND  +R+
Sbjct: 115 RIVSGSYDGVVRTWNLSGKIEK-------QYSGHTGAVRAVKFISSTRLVSGGNDRTLRL 167

Query: 66  Y-----DLQKRKEL-GTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIW 119
           +     D++   EL GT  AH  +I  L+  ++   + D +G     +LSAS DN I  W
Sbjct: 168 WKTKNDDVKHVDELEGTEEAHTLAI--LEGHQAPVVSVDVQGDR---ILSASYDNSIGFW 222

Query: 120 R-----------------------------------VKDWENFGTLKGHIARINDVDIHP 144
                                               V+       L+ H A +  V I  
Sbjct: 223 STNHKDMTAVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVEQV-IFA 281

Query: 145 SN--RVAISVSEDHSIRLWNLMTVK 167
           SN   VA SVS+DH+I+ W+L+T +
Sbjct: 282 SNDSTVAYSVSQDHTIKTWDLVTSR 306

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 29/133 (21%)

Query: 44  VKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
           V  LDV    +VSGS D  +R ++L  + E      H G++  +KF  S           
Sbjct: 106 VSALDVGAERIVSGSYDGVVRTWNLSGKIE-KQYSGHTGAVRAVKFISSTR--------- 155

Query: 104 NKWLLSASEDNKIIIWRVK--------------DWENFGTLKGHIARINDVDIHPSNRVA 149
              L+S   D  + +W+ K              +      L+GH A +  VD+   +R+ 
Sbjct: 156 ---LVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQ-GDRI- 210

Query: 150 ISVSEDHSIRLWN 162
           +S S D+SI  W+
Sbjct: 211 LSASYDNSIGFWS 223

>Scas_674.20
          Length = 297

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/265 (20%), Positives = 98/265 (36%), Gaps = 46/265 (17%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D+ I+I++++    KE+ TL  H G +  + ++  K           
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTI------- 69

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
             L S S D K++IW+ ++  W        H A +N V   P    A+            
Sbjct: 70  --LASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGAL------------ 115

Query: 163 LMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTI 222
           L+       + +  + +NG     I +     V           +A+     +  NK T 
Sbjct: 116 LLAASSDGKVSVVEFKENGTLTPIIIDAHNIGV----------NSASWAPATLQENKPTK 165

Query: 223 MHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKN 282
              E+             +D  +  +        E +    E +L GHS+ V+D  +  +
Sbjct: 166 SPEESRRF------VTGGADNLVKIWK----YNNESQTYLLEDTLQGHSDWVRDVAWSPS 215

Query: 283 D-FGTYMVSIGSDGRVVVWDMEKKD 306
               +Y+ S+  D   ++W  E  D
Sbjct: 216 VLLRSYIASVSQDKTCIIWTQENND 240

>Scas_571.4
          Length = 601

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 20/125 (16%)

Query: 103 NNKWLLSASEDNKIIIWRV---------KDWEN-------FGTLKGHIARINDVDIHPSN 146
           N+  + SAS+D KI IW +         +D EN          L GH  ++  V  HP  
Sbjct: 101 NDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPRI 160

Query: 147 R-VAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYK 205
           R V  S S D ++++WN   +KK  V+    +S     + +  +G Y A    NK L   
Sbjct: 161 RNVLASSSLDFTVKIWN---IKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIW 217

Query: 206 TAAAK 210
             A+K
Sbjct: 218 DIASK 222

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI-SVSE 154
           N  G GS    +L A E     + R  D  +    +GH  ++ D D  P N   I S S+
Sbjct: 58  NSPGGGSGAFAILRADE-----VGRTPD--HVSLFRGHKGQVLDTDFDPFNDFKIASASD 110

Query: 155 DHSIRLWNL 163
           D  I +WN+
Sbjct: 111 DGKIGIWNI 119

>Scas_442.2*
          Length = 795

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 87/235 (37%), Gaps = 66/235 (28%)

Query: 30  LFTPIFHFQAHALSVKCLDVSK--RYLVSG---SNDEH--IRIYDLQKRKELGTLLA-HQ 81
           L+  I     H   + CLDVS   +++ S    +  +H  +RI++     E+   LA H 
Sbjct: 557 LWPEIEKLYGHGYEITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNWLEVKPPLAFHT 616

Query: 82  GSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN------FGTLKGHIA 135
            ++T L+FS            ++K+LLS   D + ++W  +D E       + T K H  
Sbjct: 617 LTVTKLRFSP-----------DSKYLLSVCRDRQWVVWE-RDPETDKFTLKYKTAKPHTR 664

Query: 136 RINDVDIHP--SNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYF 193
            I D D  P     V ++ S D +I+LW     K      L N       V         
Sbjct: 665 IIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSN--FDLENSLNMTSLV--------- 713

Query: 194 AVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFY 248
                                      T + +    LDG++ I   + DG+I+ Y
Sbjct: 714 ---------------------------TALSVXDSVLDGRLLIAXGLEDGSIYIY 741

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 90/228 (39%), Gaps = 49/228 (21%)

Query: 116 IIIWRVKDWEN----FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW--NLMTVKK- 168
           I +W   D EN    F TLKGH A +  V         +S SEDH +++W  N    ++ 
Sbjct: 38  IALWNPLD-ENSQGVFATLKGHEAEVTCVKFITDTPYMVSCSEDHHVKIWKQNPGVAREV 96

Query: 169 ---AAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHL 225
                V  L +YS               A+A+L  ++    A  KV   +   K+ +  L
Sbjct: 97  DGWTCVQTLDHYSHT-----------VVALAVLPGLIAVGCADGKVSLWVQKMKEDVFIL 145

Query: 226 ETE----------------TLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFS--L 267
             E                 +D K  + V  ++ N+  +      T E  +E  + +  L
Sbjct: 146 GEEFEVQKGVLPLALAFSKVIDDKYLLAVGGTNVNVFVFSFVLNATAE-TIETLQLAAKL 204

Query: 268 LGHSNRVKDFKF-YKNDFGTYMVSIGSDGRVV-VWD------MEKKDE 307
            GH + +K   F ++   G Y++  GS  R + +W       M+K+DE
Sbjct: 205 EGHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDE 252

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 62/162 (38%), Gaps = 15/162 (9%)

Query: 35  FHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           +     A++   LD   R +VS   D  +  YD  K   LG L      IT + + +S  
Sbjct: 498 YKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKL-KLDAPITAMVYHRS-- 554

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSE 154
                    +     A +D  I++           L GH  RI   D  P  R  +S S 
Sbjct: 555 ---------SDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASL 605

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVA 196
           D +IR W+L T      + + N + N   V++  NGD  A  
Sbjct: 606 DSTIRTWDLPTGGCIDGIIVDNVATN---VKFSPNGDLLATT 644

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 50/126 (39%), Gaps = 26/126 (20%)

Query: 9   IVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDL 68
           IVG Y+ N   L   L L  P+   ++H  +   ++   D+S            I + D 
Sbjct: 525 IVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLS------------IVVIDA 572

Query: 69  QKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFG 128
             ++ +  L  H   IT   FS         EG   +W++SAS D+ I  W   D    G
Sbjct: 573 VTQRVVRQLWGHSNRITAFDFSP--------EG---RWIVSASLDSTIRTW---DLPTGG 618

Query: 129 TLKGHI 134
            + G I
Sbjct: 619 CIDGII 624

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 267 LLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDM 302
           L GHSNR+  F F     G ++VS   D  +  WD+
Sbjct: 581 LWGHSNRITAFDFSPE--GRWIVSASLDSTIRTWDL 614

>Kwal_55.21450
          Length = 503

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/344 (20%), Positives = 126/344 (36%), Gaps = 78/344 (22%)

Query: 14  EHNILCLSLDLSLKTPLFTPIFH-FQAH---ALSVKCLDVSKRYLVSGSNDEHIRIYDLQ 69
           E N+  L  + S +  L   + H +  H     S+  L  S    +S  ND  ++I+DL 
Sbjct: 182 EENVDFLKPERSFRCYLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLY 241

Query: 70  KRKE-LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIW-----RVKD 123
           + +E L     H  ++  + F+   +E            LS S D +I IW     +V+ 
Sbjct: 242 RDRELLRDYRGHSKAVRGISFNSEGSE-----------FLSVSFDQQIKIWDTETGKVRH 290

Query: 124 WENFGTLKGHIARINDVDIHPSNR----VAISVSEDHSIRLWNLMTVKK----------- 168
             ++  +       N  +  PSN     V +S SE   IR ++L T  K           
Sbjct: 291 QYSYSCIP------NCAEFRPSNSNEFIVGLSNSE---IRHYDLRTSHKNGLVQVYDHHL 341

Query: 169 AAVLKLRNYSQNGQFV--------RWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKK 220
           ++++ L+ +    +FV        R   N     +  ++    Y      +H E +    
Sbjct: 342 SSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHPEQN---- 397

Query: 221 TIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEE-PEFSLLGHSNRVKDFKF 279
              +   +++D  IY                   + +PK +  P+    GH        F
Sbjct: 398 ---YFAAQSMDNAIY-----------------AFSMKPKYKRHPKKHFSGHKCAGFGIGF 437

Query: 280 YKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVV 323
             +  G Y+ S  + GRV +WD +    L  +D  ++   + V 
Sbjct: 438 GFSPDGQYIASGDTRGRVYIWDWKTTHLLKHFDVPDKKTIVTVA 481

>Scas_711.11
          Length = 695

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 16/80 (20%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           +++C D +   L +G+ D  +R++DL+  K +  L  H GSIT LKF             
Sbjct: 544 ALQCFDAA---LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKF------------- 587

Query: 103 NNKWLLSASEDNKIIIWRVK 122
           +NK +++ S D  + IW ++
Sbjct: 588 DNKNIVTGSIDKTVRIWDLR 607

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           D+ I IW +   +  G + GH+A +N + I  +N + +S  +D  ++LWNL
Sbjct: 394 DHVIKIWDLSRSKQIGRMTGHVATVNCMQI--TNNMLVSGGKDALLKLWNL 442

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
            + H+ S+ CL    + +V+GS D+ +RI+DL +   L  +L  +  + ++ F K+K
Sbjct: 575 LEGHSGSITCLKFDNKNIVTGSIDKTVRIWDL-RSGILSDMLTFEKPVLSVDFDKNK 630

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 18/77 (23%)

Query: 9   IVGSYEHNILCLSLDLSLKTPLFTP-----------------IFHFQAHALSVKCLDVSK 51
           I  +++ NI CL  DL   T L T                  I     H  +V C+ ++ 
Sbjct: 367 IQKAHDDNITCLDFDLPFGT-LCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITN 425

Query: 52  RYLVSGSNDEHIRIYDL 68
             LVSG  D  +++++L
Sbjct: 426 NMLVSGGKDALLKLWNL 442

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 27/188 (14%)

Query: 3   KNQFRIIVGSYEHNILCLSLDLSLK-----TPL-------FTPIFH-FQAHALSVKCLDV 49
           KN   +I GS +  +    L+LS +     +PL        TP  H F+ H   +  L  
Sbjct: 389 KNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSF 448

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTL-LAHQGSITNLKFSKSKTENG----------- 97
               LVSGS D+ I  +DL   K +  L L    + +++K       NG           
Sbjct: 449 DSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMI 508

Query: 98  DGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHS 157
                 N  L + ++D  + +W ++  +    L+GH   I  +       V  S+  D+S
Sbjct: 509 GALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSM--DNS 566

Query: 158 IRLWNLMT 165
           +R+W+L T
Sbjct: 567 VRIWDLRT 574

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 80  HQGSITNLKFSKSKTENGDGEGSNNKW--LLSASEDNKII-IWRVKDWENFGTLKGHIAR 136
           H  SIT L F             +  W  L S+S  ++I+ +W +      G L GH+A 
Sbjct: 334 HGNSITALDF-------------DTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLAT 380

Query: 137 INDVDIHPSN-RVAISVSEDHSIRLWNL 163
           +N + I   N  + I+ S+D +++LW+L
Sbjct: 381 VNCMQIDKKNYNMLITGSKDATLKLWDL 408

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 33  PIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKS 92
           P+   + H   +  L      LV+GS D  +RI+DL+    L  ++A+   +++L F   
Sbjct: 537 PVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILD-VIAYDLPVSSLDFDGK 595

Query: 93  KTENGDGEGSNN 104
               G  EG  N
Sbjct: 596 LITVGANEGGVN 607

>ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH]
           complement(165316..166389) [1074 bp, 357 aa]
          Length = 357

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 109/270 (40%), Gaps = 42/270 (15%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW 106
            D   +YL+S +  +++ +YD    + L T+ + +      KF+ +++E           
Sbjct: 64  FDDHGQYLLSATACDNMHLYDAAGCRFLNTVASKKYGCHAAKFTHAQSE----------- 112

Query: 107 LLSASEDNKIIIWRVKDW-----ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
                  + +I + ++       +     +GH A ++D+ + P +   +S S D S+RLW
Sbjct: 113 ---CVYSSTMISFDIRHLNLETNQYLRYFQGHEALVSDLAMSPLDDTFLSASYDESVRLW 169

Query: 162 NLMTVKKAAVLK--LRN---YSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEID 216
           +L T K  A++   + N   Y  +G  V  +GN +   + L N   +       V  +  
Sbjct: 170 DLRTSKAQAIVPSVVPNSVAYDPSG-LVFALGNPESQEIGLYNVRQLKAGPFMVVKVDPR 228

Query: 217 MNKKTIMHLETETLDGKIYICVAMSDG-NIHFYPTEGLLTEEPKVEEP----EFSLLGHS 271
            ++ T M       DG+ Y+ +A S G  +     +G    E    +P    EF   G +
Sbjct: 229 FSQWTKMEFSN---DGR-YLLLASSAGRQLILDAFDGAQLFELTGTKPFPLREFMDAGSA 284

Query: 272 NRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
               D        G Y +    DGR+  W+
Sbjct: 285 CFTPD--------GRYTLGTDYDGRIAFWN 306

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 122/319 (38%), Gaps = 54/319 (16%)

Query: 20  LSLDLSLKTPLFTPIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKE---- 73
           L+ ++ L   L  P+     H  S+ C+  S   +YL SGS+D  + I+ L + +     
Sbjct: 58  LTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPA 117

Query: 74  LGT------------LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRV 121
            G+            L+AH   I ++ ++            ++  L++   D  +I+W  
Sbjct: 118 FGSEHEREHWTVRKRLVAHDNDIQDICWA-----------PDSSILVTVGLDRSVIVWNG 166

Query: 122 KDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL-------MTVKKAAVLKL 174
             +E       H + +  V   P+N+   + S+D +++++          T++       
Sbjct: 167 STFEKLKRFDVHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPF 226

Query: 175 RNYSQNGQFVR--WIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMH-LETETLD 231
           +       F R  W  +G + AV       +   A        D N   I H   TE   
Sbjct: 227 KESPLTTYFRRPSWSPDGQHIAVPNATNGPVSSMAIVN-RGTWDTNVSLIGHDAPTE--- 282

Query: 232 GKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSI 291
                 VA  +  + F    G+  ++ K ++PE +L+G  N  K   F KN   + + + 
Sbjct: 283 ------VARFNPRL-FERNAGV--KQKKDDDPENALVGQ-NDDKVHHFDKN-IDSVVATA 331

Query: 292 GSDGRVVVWDMEKKDELAV 310
           G D  + VW   +   + V
Sbjct: 332 GQDKSLAVWSTSRPRPILV 350

>Scas_719.30
          Length = 940

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 59/156 (37%), Gaps = 21/156 (13%)

Query: 46  CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
            LD   R +VS   D  +  YD  K   LG L      IT + + +S           + 
Sbjct: 510 ALDGMNRKMVSCGLDGIVGFYDFNKSTFLGKL-QLDAPITKMVYHRS-----------SD 557

Query: 106 WLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
                 +D  I++             GH  RI  +D  P  R  +S S D +IR W+L T
Sbjct: 558 LFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPT 617

Query: 166 ------VKKAAVLKLRNYSQNGQFV---RWIGNGDY 192
                 +K  +V     +S NG  +     IGNG Y
Sbjct: 618 GGCIDGIKLESVATDVKFSPNGDMLATTHVIGNGIY 653

>YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein
           containing four WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of retinoblastoma binding
           protein 4 (human RBBP4), which associates with histone
           acetylation proteins [1572 bp, 523 aa]
          Length = 523

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 71/159 (44%), Gaps = 16/159 (10%)

Query: 19  CLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           C+  DL     + T +    +    V+ L  S +   S   D  +R++DL  R    + +
Sbjct: 268 CIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL--RSLAHSTI 325

Query: 79  AHQGSITNLKFSKSKTENGDGEGSN------------NKWLLSASEDNKIIIWRVKDWEN 126
            ++   +++  + + T     +GS+            N     A++ NKIII  +++ E+
Sbjct: 326 IYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPES 385

Query: 127 -FGTLKGHIARINDVDIHPSNR-VAISVSEDHSIRLWNL 163
               L+GH + +N +  HP+ R V +S  +D  +  W+L
Sbjct: 386 PILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

>Scas_659.9
          Length = 475

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 15/83 (18%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL-----KFSKSKTENGDGEGSNNKWLL 108
           L +GS D  ++ +++  R+EL +  AH G IT L       SK K EN         ++L
Sbjct: 83  LATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLSKQKNEN---------FML 133

Query: 109 SASEDNKIIIWRVKDWENFGTLK 131
           S S+D  + +W V   E++  LK
Sbjct: 134 SCSDDKTVKLWSVNS-EDYANLK 155

 Score = 32.0 bits (71), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 61/146 (41%), Gaps = 35/146 (23%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL- 108
           SK   V+G     I+++D  + K L  L     +I+ +KF++++T+     GS+N  +L 
Sbjct: 184 SKSNFVTGG--AKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLY 241

Query: 109 ---SASEDNKI--------IIWRVKDWENF---------------------GTLKGHIAR 136
              + S   KI        I W   +  NF                        K H++ 
Sbjct: 242 DLRTNSPTQKIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSA 301

Query: 137 INDVDIHPSNRVAISVSEDHSIRLWN 162
           + DVD  P+    ++ S D +IR++N
Sbjct: 302 VMDVDFSPTGDEIVTGSYDKTIRIFN 327

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 16/93 (17%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQK--RKELGTLLAHQGSITNLKFSKS 92
           F+ H  +V  +D S     +V+GS D+ IRI++      +E+      Q  +  +KFS  
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQ-HVFQVKFS-- 351

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
                     + K+++S S+D  + +WR K WE
Sbjct: 352 ---------MDAKYIVSGSDDGNVRLWRSKAWE 375

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 20/117 (17%)

Query: 103 NNKWLLSASEDNKIIIWRVK----------------DWENFGTLKGHIARINDVDIHP-S 145
           N+  + S S+D+KI IW +                 D +    L GH  ++  V  HP +
Sbjct: 93  NDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVA 152

Query: 146 NRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVL 202
             V  S S D++++LWN+ T K    LK  +   +  F     +G+Y A    +K L
Sbjct: 153 ENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFSY---DGNYLATVARDKKL 206

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 57/162 (35%), Gaps = 34/162 (20%)

Query: 37  FQAHALSVKCLDV--SKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITN-------- 86
           F A+   VKC+    + R L  G      R+YDL     +  L   Q  +          
Sbjct: 256 FYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGE 315

Query: 87  -LKFSKSK-----------------------TENGDGEGSNNKWLLSASEDNKIIIWRVK 122
            L F  SK                       + N      +   +++ASED KI +W + 
Sbjct: 316 WLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDIT 375

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLM 164
                 T + H + +  V      +V  S S D ++R W+L+
Sbjct: 376 SGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLI 417

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 13/131 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F+ H  SV  +  +KR   + S S D  +R +DL + +   T    +     ++F     
Sbjct: 383 FEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTE----RIQF----- 433

Query: 95  ENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
            N      + + + + S DN  I +W V+  +    L GH   ++ +     N V  S S
Sbjct: 434 -NCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASAS 492

Query: 154 EDHSIRLWNLM 164
            D +IR+W++ 
Sbjct: 493 WDKTIRIWSIF 503

>Kwal_27.12070
          Length = 418

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (47%), Gaps = 19/123 (15%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L S  +   I ++D++        L H GS++ L+++                L +A +D
Sbjct: 306 LCSADSAGRINLWDIRDFSSPIRSLDHHGSVSALQWNPHHPTI----------LATAGQD 355

Query: 114 NKII-IWRVK---DWENFGTLKGHIARINDVDIHPSNR-VAISVSEDHSIRLW----NLM 164
           + ++ IW +    D E   T  GH+  +ND+   P++  +  SVS D+SI+LW    NLM
Sbjct: 356 DGLVKIWDLSQPVDQELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLM 415

Query: 165 TVK 167
           T K
Sbjct: 416 TPK 418

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 13/102 (12%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D+ I+I++++    K + TL+ H+G +  + ++  K           
Sbjct: 17  LDYYGKKLATCSSDKTIKIFEVEGESHKLVDTLVGHEGPVWRVDWAHPKFGTI------- 69

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHP 144
             L S S D K+IIW+ ++  W        H A +N V   P
Sbjct: 70  --LASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAP 109

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 266 SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDME--KKDELAVY 311
           +L+GH   V    +    FGT + S   DG+V++W  E  +  ++AV+
Sbjct: 48  TLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVH 95

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 13/96 (13%)

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIN 138
           AH   IT  +F      NG G        LS+S D ++ IW         T  GH   +N
Sbjct: 156 AHASHITKTQF----FPNGHG-------FLSSSIDMRLKIWDASTGTELRTFIGHTRSVN 204

Query: 139 DVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKL 174
           D  +    R  +S S D S++LW   T   A V  L
Sbjct: 205 DFAMVDRGRNFVSASSDGSLKLWECST--SACVFTL 238

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 266 SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVD 324
           + +GH+  V DF     D G   VS  SDG + +W+      +   +  + +NC+++ +
Sbjct: 195 TFIGHTRSVNDFAMV--DRGRNFVSASSDGSLKLWECSTSACVFTLNSNDGINCISLAN 251

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 11/71 (15%)

Query: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           S+  L +   D ++ +YDL++ +K L ++  H+ S+T+L+FS  +    DG       L 
Sbjct: 269 SENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQ----DG------LLT 318

Query: 109 SASEDNKIIIW 119
           S+  D +II+W
Sbjct: 319 SSGSDRRIIMW 329

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 236 ICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDG 295
           +  A +D N++ Y          ++++P  S+ GH + V   +F  +  G  + S GSD 
Sbjct: 273 LAAAGTDSNVYLYDLR-------RLQKPLHSMAGHEDSVTSLEFSPHQDG-LLTSSGSDR 324

Query: 296 RVVVWDM 302
           R+++WD+
Sbjct: 325 RIIMWDL 331

>YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransferase
           subunit 2, contains seven WD (WD-40) repeats [1206 bp,
           401 aa]
          Length = 401

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 63/128 (49%), Gaps = 26/128 (20%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           S   L +   D ++ +YDL+  KE L  +  H+ ++ NL+FS     + DG       ++
Sbjct: 263 SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST----HVDGV------VV 312

Query: 109 SASEDNKIIIWRVK---------DWEN-----FGTLKGHIARINDVDIHPSNRVAISVSE 154
           S+  DN++++W +K         D E+          GH + +ND D++P     ++ +E
Sbjct: 313 SSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAE 372

Query: 155 DHSI-RLW 161
           + +I ++W
Sbjct: 373 EENILQVW 380

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 66/166 (39%), Gaps = 26/166 (15%)

Query: 150 ISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFV----RWIG-NGDYFAVAL------L 198
           +S S+DH++ LW + +        +R ++     +    +W   N D F          +
Sbjct: 177 LSGSDDHTVALWEVGS-GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235

Query: 199 NKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEP 258
           N V    T    V C    N     H  +  L        A  D  ++ Y    +     
Sbjct: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL------AAAGMDSYVYLYDLRNM----- 284

Query: 259 KVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
             +EP   + GH + V + +F  +  G  +VS GSD R+++WD+++
Sbjct: 285 --KEPLHHMSGHEDAVNNLEFSTHVDGV-VVSSGSDNRLMMWDLKQ 327

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 90/241 (37%), Gaps = 25/241 (10%)

Query: 27  KTPLFTPIFH-FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSIT 85
           K P   P+F    A  L        +R LVSGS+D  I ++++             G++ 
Sbjct: 69  KAPDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVE 128

Query: 86  NLKFSKSKTENGDGEG------SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARIND 139
           ++   K  T +    G      +    L S+S D+ + +W V+   N   L  H   +  
Sbjct: 129 HVAPVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLT-HPDMVTS 187

Query: 140 VDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLK--LRNYSQNGQFVRWIGNGDYFAVAL 197
           +          +V  D  +R+W+   ++K  V+   + +     Q V W+GN D  A   
Sbjct: 188 MSFSYGGTYLATVCRDKMLRVWD---IRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTG 244

Query: 198 LNKVLIYKTAAAKV----------HCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHF 247
            +K+   + A                 +D +   +M    ++   KI       DGNI +
Sbjct: 245 FSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDS--NKILYVAGKGDGNIRY 302

Query: 248 Y 248
           Y
Sbjct: 303 Y 303

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 18/191 (9%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F+ H  +V  +  +K+   L S S D  +R +DL + +      A +     ++F+    
Sbjct: 379 FEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATE----RVQFTCLAV 434

Query: 95  ENGDGEGSNNKWLLSASEDNK--IIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
           E   GE      ++SA   +   + +W V+  +   TL GH   ++ +     N V  S 
Sbjct: 435 E-PSGE------VVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASA 487

Query: 153 SEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALL-NKVLIYKTAAAKV 211
           S D +IR+W++   +   V  L  ++ +   +    +G + AV+ L  ++ I+  A+ K 
Sbjct: 488 SWDKTIRIWSIFG-RSQQVEPLEVFA-DILAITITPDGKHVAVSTLKGQLTIFDIASGKQ 545

Query: 212 HCEIDMNKKTI 222
              ID  K  I
Sbjct: 546 IGNIDCRKDII 556

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 68/170 (40%), Gaps = 34/170 (20%)

Query: 37  FQAHALSVKC--LDVSKRYLVSGSNDEHIRIYDLQ-----KRKELGTLLAHQGSITN--- 86
           F A+   VKC    ++   L+ G ++   R+Y++      ++  +G    +  S+ N   
Sbjct: 252 FYANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGE 311

Query: 87  -LKFSKSK----------------TENGDGEGSNN-------KWLLSASEDNKIIIWRVK 122
            L F  SK                 + G  + +N+         +++A+ED KI +W V 
Sbjct: 312 WLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVA 371

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVL 172
                 T + H + +  V      +V  S S D ++R W+L+  +   V 
Sbjct: 372 SGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVF 421

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 4/55 (7%)

Query: 270 HSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGER--LNCLAV 322
           H++ V   +F K   G  + S   DG V  WD+ +     V+   ER    CLAV
Sbjct: 382 HTSAVTAVQFAKK--GQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAV 434

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 64/149 (42%), Gaps = 27/149 (18%)

Query: 30  LFTPIFHFQAHALSVKCLDVSK--RYLVSG---SNDEH--IRIYDLQKRKELGTLLA-HQ 81
           L+  I     H   + C+DVS   + L S    +N  H  +RI+      +L      H 
Sbjct: 560 LWPEIEKLYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHN 619

Query: 82  GSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTL-----KGHIAR 136
            +IT L+FSK           +N+ LLS S D    +W   D + F TL     K H   
Sbjct: 620 LTITRLRFSK-----------DNRHLLSVSRDRMWAVWYRNDDDTF-TLKYSDQKPHSRI 667

Query: 137 INDVDIHPSN--RVAISVSEDHSIRLWNL 163
           I D D  P++     ++ S D ++++W L
Sbjct: 668 IWDGDWLPASCGTAFVTASRDKTVKIWRL 696

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 90/214 (42%), Gaps = 39/214 (18%)

Query: 116 IIIWRVKDWENFG---TLKGHIARINDVDIHPSNRVAISVSEDHSIRLW----------- 161
           I +W   D  N G   TLK H A +  V    + ++ +S S D +I +W           
Sbjct: 58  IALWNPLDEHNAGVYCTLKAHNAEVTSVKFIGAEKLLVSASADATINVWRGDERWELAQT 117

Query: 162 ------NLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEI 215
                 ++ ++  AA L +  ++ +G    W  + D F ++  ++ LI K     +   +
Sbjct: 118 LEGPKSSVTSLAVAAGLIVAGFA-DGTLSVWSEHDDAFVLS--SQFLIRK---GFLPLAL 171

Query: 216 DMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVK 275
            + K +         DG   + V+ +  ++  Y      T + ++     ++ GH + +K
Sbjct: 172 ALQKLS---------DGCYMLAVSGTSTDLMVYSVCVAATVDVELSA---TVEGHEDWIK 219

Query: 276 DFKFYKNDFGTYMVSIGSDGRVV-VWDMEKKDEL 308
           D  F  N  G +M++ G+  R + +W ++  + +
Sbjct: 220 DLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNI 253

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           F+ H  SV  +  +K  + + S S D  ++ +DL + +   T  A +     ++FS    
Sbjct: 394 FEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATE----RIQFSCLAA 449

Query: 95  ENGDGEGSNNKWLLSASEDN-KIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
           +         + + + S DN  I +W V+  +   TL GH   ++ +     N +  S S
Sbjct: 450 D------PTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASAS 503

Query: 154 EDHSIRLWNLM 164
            D +IR+W++ 
Sbjct: 504 WDKTIRVWSIF 514

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 29  PLFTPI--FHFQAHALSVKCLDVSKRYLVSGSND-EHIRIYDLQKRKELGTLLAHQGSIT 85
           P FT I       +A++   ++ S  +L  GS+    + +Y+ Q    +     H  ++ 
Sbjct: 301 PDFTFIQQLSMGQNAVNTVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALN 360

Query: 86  NLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS 145
            L +S       DG       +++A+ED KI IW +       T + H + +  V    +
Sbjct: 361 ALAYSP------DGAR-----IVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKN 409

Query: 146 NRVAISVSEDHSIRLWNLMTVK 167
            ++  S S D +++ W+LM  +
Sbjct: 410 GQIMFSSSLDGTVKAWDLMRFR 431

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 57/133 (42%), Gaps = 14/133 (10%)

Query: 36  HFQAHALSVKC--LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93
           +F A    VKC         L+ G ++   R+Y+L     +  L   Q ++  +  ++S 
Sbjct: 266 YFYAKNAKVKCAAFHADSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVNTVAVNRS- 324

Query: 94  TENGDGEGSNNKWL-LSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISV 152
                GE     WL   +S   +++++  +        +GH   +N +   P     ++ 
Sbjct: 325 -----GE-----WLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTA 374

Query: 153 SEDHSIRLWNLMT 165
           +ED  I++W++++
Sbjct: 375 AEDGKIKIWDIVS 387

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 5/61 (8%)

Query: 270 HSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERL--NCLAVVDETV 327
           H++ V   +F KN  G  M S   DG V  WD+ +      +   ER+  +CLA  D T 
Sbjct: 397 HTSSVTSVQFAKN--GQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLA-ADPTG 453

Query: 328 E 328
           E
Sbjct: 454 E 454

>Scas_658.1
          Length = 442

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 4/102 (3%)

Query: 107 LLSASEDNKIIIWRVKDWENF-GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           LLS   DN + +W      N     KGH   IN +D +      IS S DH+I++W+   
Sbjct: 165 LLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQ 224

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLN-KVLIYKT 206
            K    L  ++   + +F  +  N   F V   N K+  Y T
Sbjct: 225 GKVKTKLHFKSTPNDVKFRPF--NSSEFIVGFANSKIYHYDT 264

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 61/131 (46%), Gaps = 16/131 (12%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKT 94
           ++ H+ ++  LD +      +S S D  I+I+D ++ K + T L  + +  ++KF     
Sbjct: 189 YKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGK-VKTKLHFKSTPNDVKF----- 242

Query: 95  ENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLK---GHIARINDVDIHPSNRVAIS 151
                   N+   +    ++KI  +  +  EN G ++    H++ I  +   P     IS
Sbjct: 243 -----RPFNSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFIS 297

Query: 152 VSEDHSIRLWN 162
            SED ++R+W+
Sbjct: 298 SSEDKTVRIWD 308

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 19/108 (17%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDL-QKRKELGTLLAHQGSITNLKFSKSKTENGDGEG 101
           S+  L  S   L+SG ND  ++++D   KR  L     H  +I +L F      N DG  
Sbjct: 154 SLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDF------NDDGTN 207

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHI---ARINDVDIHPSN 146
                 +S+S D+ I IW  +     G +K  +   +  NDV   P N
Sbjct: 208 -----FISSSFDHTIKIWDTEQ----GKVKTKLHFKSTPNDVKFRPFN 246

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 127/317 (40%), Gaps = 46/317 (14%)

Query: 27  KTPL----FTP---IFHFQAH---ALSVKCLDVSKRYLVSGSNDEHIRIYDL-QKRKELG 75
           K PL    F P   I+ F+ H      +K L  +    +SG ND  I I+D+  +R  L 
Sbjct: 157 KAPLSFQCFLPKKIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLR 216

Query: 76  TLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
               H+ ++ ++ F+   TE            LS S D  + +W  +  +    LK H +
Sbjct: 217 DYRGHRKAVRDINFNSDGTE-----------FLSVSFDQTLKVWDTETGKVKSRLKWH-S 264

Query: 136 RINDVDIHPSNR----VAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQF-VRWIGNG 190
             N    HP+N     V +S SE   IR ++     K  +++  N+  +    +++  +G
Sbjct: 265 VPNCATYHPTNNNEYIVGLSNSE---IRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDG 321

Query: 191 DYFAVALLNKVLIYKTAAAKVHCEI----DMNKKTIMHLETETLDGKIYICVAMSDGNIH 246
             F  +  +K +  +    +V+  I    D ++ ++ +LE    +   +   +M +    
Sbjct: 322 SKFISSSEDKTV--RIWENQVNIPIKQISDTSQYSMPYLEIHP-EQHYFSAQSMDNAIYS 378

Query: 247 FYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKD 306
           F           KV        GH        F  +  G Y+VS  S G VVVWD +   
Sbjct: 379 FSMKPKYKKNLKKV------FRGHLCAGFGINFGFSPDGQYIVSGDSRGSVVVWDWKTTR 432

Query: 307 ELAVYDC--GERLNCLA 321
            L  ++   G+ +  LA
Sbjct: 433 TLKRFEVPDGKPVTTLA 449

>Scas_699.5
          Length = 494

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 70/152 (46%), Gaps = 11/152 (7%)

Query: 19  CLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           C+  DL     + T +    +    V+ L  S +   S   D  +R++DL  R    + +
Sbjct: 257 CIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDL--RSLAHSTI 314

Query: 79  AHQGSITNL-----KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN-FGTLKG 132
            ++  +++L     +F+  + E    +   N     A++ NKI+I  +++ E+    L+G
Sbjct: 315 IYEPPVSDLNPDTSQFALLRLEPSPHDP--NVMATFAADSNKILILDMRNPESPLMILEG 372

Query: 133 HIARINDVDIHPSNR-VAISVSEDHSIRLWNL 163
           H A +N +  HP  R V +S  +D  +  W+L
Sbjct: 373 HSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

 Score = 32.0 bits (71), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 69/168 (41%), Gaps = 23/168 (13%)

Query: 150 ISVSEDHSIRLWNLMT---------VKKAAVLKLRNYSQNGQ-FVRWIGNGD---YFAVA 196
           IS S D +  +W+L +            + V  +R  +Q+ Q F    G+G    +   +
Sbjct: 249 ISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRS 308

Query: 197 LLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTE 256
           L +  +IY+   + ++   D ++  ++ LE    D  +    A     I       L+ +
Sbjct: 309 LAHSTIIYEPPVSDLN--PDTSQFALLRLEPSPHDPNVMATFAADSNKI-------LILD 359

Query: 257 EPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
               E P   L GHS  V   K++       ++S G D +V+ WD+ K
Sbjct: 360 MRNPESPLMILEGHSASVNQIKWHPIKRNV-LLSGGDDCQVLYWDLNK 406

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGN 189
           L GH  RI   D  P  R  +S S D ++R W+L T      ++L + + N QF     N
Sbjct: 669 LWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGVRLESVATNVQFS---AN 725

Query: 190 GDYFAV 195
           GD  A 
Sbjct: 726 GDILAT 731

>Kwal_47.17465
          Length = 800

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 71  RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL--SASEDNKIIIWRVKD----W 124
           ++ L ++  H GS+T ++FS     N    GS+++ LL     ED K  I+  ++    W
Sbjct: 12  KRPLASMSRHTGSVTVVRFSPDG--NFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHW 69

Query: 125 ENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKK 168
                L  H   I D+   P + + ++V  D S+ +WN  T +K
Sbjct: 70  NVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEK 113

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 60/146 (41%), Gaps = 28/146 (19%)

Query: 33  PIFHFQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDL---QKRKELGT----------- 76
           P+     H  SV  +  S    +L SGS+D  + I++    QK+   G            
Sbjct: 14  PLASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRR 73

Query: 77  -LLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA 135
            L+AH   I ++ ++            ++  L++   D  +I+W    +E       H +
Sbjct: 74  RLVAHDNDIQDICWA-----------PDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQS 122

Query: 136 RINDVDIHPSNRVAISVSEDHSIRLW 161
            +  V   P+N+   + S+D ++R++
Sbjct: 123 LVKGVIFDPANKYFATASDDRTVRIF 148

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 61/146 (41%), Gaps = 39/146 (26%)

Query: 44  VKCLDVS--KRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEG 101
           V  LDV    ++++SGS D  +R +DL    +      H G I  +K+            
Sbjct: 106 VSSLDVGDGSKHIISGSYDGIVRTWDLSGNVQ-KQYSGHSGPIRAVKYI----------- 153

Query: 102 SNNKWLLSASEDNKIIIWRVK-----------------------DWENFGTLKGHIARIN 138
            +N  L+SA  D  + +W+ K                       D +    L+GH A + 
Sbjct: 154 -SNTRLVSAGNDRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVV 212

Query: 139 DVDIHPSNRVAISVSEDHSIRLWNLM 164
            +D+  ++R+ +S S D+SI  W+ +
Sbjct: 213 SIDVSDNSRI-LSASYDNSIGFWSTI 237

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/223 (19%), Positives = 77/223 (34%), Gaps = 82/223 (36%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLD-VSKRYLVSGSNDEHIRIY 66
           II GSY+  +    L  +++         +  H+  ++ +  +S   LVS  ND  +R++
Sbjct: 118 IISGSYDGIVRTWDLSGNVQK-------QYSGHSGPIRAVKYISNTRLVSAGNDRTLRLW 170

Query: 67  -----------------------DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSN 103
                                  +++  K L  L  H+  + ++  S            +
Sbjct: 171 KTKNDDLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVS------------D 218

Query: 104 NKWLLSASEDNKIIIWR--------------------------------------VKDWE 125
           N  +LSAS DN I  W                                       ++   
Sbjct: 219 NSRILSASYDNSIGFWSTIYKEMTVVDPLEDINNPNNKISTAARKRRKLTMKDGTIRRRA 278

Query: 126 NFGTLKGHIARINDVDIHPS-NRVAISVSEDHSIRLWNLMTVK 167
               L+ H A +  V    + N V  SVS+DH+I+ W+L+T +
Sbjct: 279 PLSLLESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTAR 321

>Scas_700.27*
          Length = 433

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 107 LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTV 166
           + +A  D+ + +W ++      TL GH   IN V   P +   +S S D +IRLW+++  
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAG 280

Query: 167 KKAAVL 172
           K   V+
Sbjct: 281 KSMKVI 286

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/110 (19%), Positives = 47/110 (42%), Gaps = 12/110 (10%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           + +   D  +R++D++ R  + TL+ H+  I  +       +           ++S S D
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQ-----------IVSCSTD 269

Query: 114 NKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
             I +W +   ++   +  H   + ++  HP+   ++S    + IR W L
Sbjct: 270 ATIRLWDIVAGKSMKVITHHKKSVRNIAFHPT-EFSMSSCSANDIRSWKL 318

>CAGL0H00781g complement(77292..78833) similar to tr|Q12523
           Saccharomyces cerevisiae YPL247c, hypothetical start
          Length = 513

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 66/165 (40%), Gaps = 27/165 (16%)

Query: 19  CLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           C+  DL     + T +    +    V+ L  S +   S   D  +R++DL+        L
Sbjct: 260 CIVWDLQSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLR-------CL 312

Query: 79  AHQGSITNLKFSKSKTEN----GDGEGSNNKWLLS--------------ASEDNKIIIWR 120
           AH   I     S+  T N     D    N+  LL               A   N+I+I  
Sbjct: 313 AHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILD 372

Query: 121 VKDWEN-FGTLKGHIARINDVDIHPSNR-VAISVSEDHSIRLWNL 163
           +++ ++    L GH A IN +  HP+ +   IS S+D  +  W++
Sbjct: 373 MRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

>Scas_719.52
          Length = 628

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 103 NNKWLLSASEDNKIIIWRV----------------KDWENFGTLKGHIARINDVDIHP-S 145
           N+  + S+S+D+KI IW++                K+ +    L GH  ++  V  HP +
Sbjct: 93  NDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVA 152

Query: 146 NRVAISVSEDHSIRLWNLMTVKKAAVLK 173
             V  S S D++++LWN+ T +    LK
Sbjct: 153 ENVLASSSLDYTVKLWNIETGEAVITLK 180

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 76/205 (37%), Gaps = 42/205 (20%)

Query: 4   NQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCL--DVSKRYLVSGSNDE 61
           N   +  GS +H IL    D+ +  P F  I   ++H   V  L  +V+   L SG ND 
Sbjct: 353 NNHVLTSGSRDHRIL--HRDVRMPDPFFETI---ESHTQEVCGLKWNVADNKLASGGNDN 407

Query: 62  HIRIYDLQKRKELGTLLAHQGSITNLKFSKSK-----TENGDGEGSNNKWLLSAS----- 111
            + +Y+   +  + T   H+ ++  + +S  K     T  G  +     W ++ S     
Sbjct: 408 VVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSD 467

Query: 112 --------------EDNKII-----------IWRVKDWENFGTLKGHIARINDVDIHPSN 146
                           N+++           +W     +    LKGH  R+  + +    
Sbjct: 468 IDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDG 527

Query: 147 RVAISVSEDHSIRLWNLMTVKKAAV 171
              +S + D ++R W L    KA V
Sbjct: 528 TTVVSGAGDETLRYWKLFDKPKAKV 552

>Scas_512.3
          Length = 534

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 11/70 (15%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           RY+VSGS D  IR++D++  K LGT   H   +  + +              N+++LS S
Sbjct: 159 RYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPL-----------NEFILSQS 207

Query: 112 EDNKIIIWRV 121
            D  + I+++
Sbjct: 208 ADRSVNIYQI 217

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 68/175 (38%), Gaps = 57/175 (32%)

Query: 39  AHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKE---------LGTLLAHQGSITNLKF 89
            ++L  +    +K+ L++   D  IR ++L   K+         L +L  H+ +I  +KF
Sbjct: 16  VYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQAINVVKF 75

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD-------------------------- 123
           +   T            L SA +D +I++W+ +D                          
Sbjct: 76  NSPGT-----------ILASAGDDGQILLWKQQDVNEQNGETAAPVDSSVPKPFGSTFED 124

Query: 124 -----------WENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167
                      W+       + + I D+D  P +R  +S S D+SIR++++ + K
Sbjct: 125 DEENNKESWFVWKRLRAPGSNSSEIYDLDWSPCDRYVVSGSMDNSIRVFDIESGK 179

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 104 NKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           +++++S S DN I ++ ++  +  GT   H   +  V   P N   +S S D S+ ++ +
Sbjct: 158 DRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQI 217

Query: 164 M------TVKKAAVLKLRNYSQNGQFVR 185
           +      T+ K   LKL+N    G+  +
Sbjct: 218 IWDSDSNTIDK---LKLKNRIMKGELPQ 242

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 266 SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCGERLNCLAVVDE 325
           SL  H   +   KF  N  GT + S G DG++++W  +  +E      GE     A VD 
Sbjct: 62  SLTQHEQAINVVKF--NSPGTILASAGDDGQILLWKQQDVNE----QNGE---TAAPVDS 112

Query: 326 TVEK 329
           +V K
Sbjct: 113 SVPK 116

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 16/75 (21%)

Query: 107 LLSASEDNKIIIW---------------RVKDWENFGTLKGHIARINDVDIHPSNR-VAI 150
           + S+S+D KI IW                +KD E    L GH  ++  +  HP+ + V  
Sbjct: 97  VASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLA 156

Query: 151 SVSEDHSIRLWNLMT 165
           S S D+++R+WN+ T
Sbjct: 157 SSSLDYTVRIWNVET 171

>Scas_605.18
          Length = 424

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 58/136 (42%), Gaps = 27/136 (19%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQG----------SITNLKFSKSKTENG------ 97
           +V+G +D  I ++DL+    + +    QG            +N+++S+   ++       
Sbjct: 285 IVTGGDDGVINMFDLRSDCAIASYSLQQGIQKEIRDPTYMSSNMEYSRGSPQSPISTAIS 344

Query: 98  ----DGEG-------SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSN 146
               D +G       ++ + + +   D   IIW V   E  G L+GH  R++ V   P  
Sbjct: 345 SSYLDNQGVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDG 404

Query: 147 RVAISVSEDHSIRLWN 162
               + S D ++R+W+
Sbjct: 405 LGVCTGSWDSTMRIWS 420

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           +   +L GH+N++ DF++ ++     ++S   DG +++WD
Sbjct: 82  QSTLTLKGHNNKISDFRWSRD--SKSILSASQDGFMLIWD 119

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 79/184 (42%), Gaps = 24/184 (13%)

Query: 48  DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWL 107
           D +   L  G  D  I + D++      +   H G+I++LKF         G+ ++  WL
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFY--------GQLNSKIWL 162

Query: 108 LSASEDNKII-IWRVKDWENFGTLKGHIARINDVDI-------HPSNRVAISVSEDHSIR 159
           L++ + N ++ +W +   +   TL+ H + +  +DI        PS  + +S   D  I 
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNL-LSGGRDDIIN 221

Query: 160 LWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNK 219
           LW+    KK  +LK    +Q  +   ++ +GD        K +IY      +   ID   
Sbjct: 222 LWDFNMKKKCKLLKTLPVNQQVESCGFLKDGD-------GKRIIYTAGGDAIFQLIDSES 274

Query: 220 KTIM 223
            +++
Sbjct: 275 GSVL 278

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 67/170 (39%), Gaps = 26/170 (15%)

Query: 8   IIVGSYEHNILCLSLDLSLK---TPLFTPIFHFQ----------AHALSVKCLDVSKR-- 52
           I+   Y   +L  S DL++K    P  T     Q          AH   +  L VS    
Sbjct: 445 IVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDS 504

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
              + S D+  +I++L+  +   TL  H+  + ++ F +            +K L ++S 
Sbjct: 505 IFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQY-----------DKLLATSSG 553

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           D  + IW +  +    TL+GH   +         +  IS   D  I++W+
Sbjct: 554 DKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWD 603

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 41/110 (37%), Gaps = 11/110 (10%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + L + S D+ ++I+ L     + TL  H  ++    F   +           K L+S  
Sbjct: 546 KLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQ-----------KQLISCG 594

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            D  I IW     E   TL GH  R+  +       + +S   D   + W
Sbjct: 595 ADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 94/230 (40%), Gaps = 40/230 (17%)

Query: 106 WLLSASEDNKIIIWRVKD----WENFGTLKGHIARINDVDI-------HPSNRVAISVSE 154
           W+ +AS+DN  I+WR  +    ++ +    GH A +  V +       +P     ++ S 
Sbjct: 402 WIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYP--EFLLTASN 459

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCE 214
           D +I+ W +     +  +++   S   ++ R     D  A+++     I+ TA+    C+
Sbjct: 460 DLTIKKWIIPKPTASMDVQIIKVS---EYTRHAHEKDINALSVSPNDSIFATASYDKTCK 516

Query: 215 IDMNKKTIMHLETETLDGKIYICVAMSDG--NIHFYPTEGLLTEEPKVEEPE------FS 266
                  I +LE   L+  +        G  ++ F   + LL      +  +      FS
Sbjct: 517 -------IWNLENGELEATL---ANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFS 566

Query: 267 LL----GHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYD 312
           ++    GH+N V+   F        ++S G+DG + +WD    + L   D
Sbjct: 567 VMKTLEGHTNAVQRCSFINKQ--KQLISCGADGLIKIWDCSSGECLKTLD 614

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 88/209 (42%), Gaps = 38/209 (18%)

Query: 16  NILCLS-LDLSLK---TPLFTPIFHFQAHALSVKCLDVSK---RYLVSGSNDEHIRIYDL 68
           NILC S +D S+K       T +    AH+ +V  +D+ K     L SGS D  IRI+D 
Sbjct: 123 NILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDT 182

Query: 69  QKRKELGTL------LAHQG--SITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIW- 119
           +    L TL      +A  G   I+ +KFS+           N K+LL  S DN + +W 
Sbjct: 183 ESGHCLKTLTYDKDWIAEDGVVPISTVKFSR-----------NGKFLLVKSLDNVVKLWE 231

Query: 120 -------RVKDWENFGTLKGHIARINDVDIHPSNR--VAISVSEDHSIRLWNLMTVKKAA 170
                  R   W +  T            I+P  +  + IS ++  S+ +WN+ +  K  
Sbjct: 232 YTRGTVVRTFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVWNVYS--KNL 289

Query: 171 VLKLRNYSQNGQFVRWIGNGDYFAVALLN 199
           V K+    +N   +    + D  A   LN
Sbjct: 290 VQKIDEKHRNSPLISISASYDKVATLSLN 318

>Scas_679.28
          Length = 815

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 95/235 (40%), Gaps = 48/235 (20%)

Query: 106 WLLSASEDNKIIIWR----VKDWENFGTLKGHIARINDVDI-------HPSNRVAISVSE 154
           W+ +AS+D+  I+W+    +  ++ +    GH A +  V +       +P     ++ S 
Sbjct: 400 WMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYP--EFLLTASN 457

Query: 155 DHSIRLWNL----MTVKK-AAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAA 209
           D +I+ W +     TV++   ++K+  Y++           D  A+A+     I+ TA+ 
Sbjct: 458 DLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAH------EKDINALAISPNDSIFATASY 511

Query: 210 KVHCEI-DM-----------NKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEE 257
              C+I D+           +K+ +  +     D  I  C    D  I  +  +     +
Sbjct: 512 DKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSG--DKTIKIWSLDTFSVMK 569

Query: 258 PKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELAVYD 312
                   +L GH+N V+   F        +VS G+DG + +WD    D L   D
Sbjct: 570 --------TLEGHTNAVQRCMFINKQL--QLVSSGADGLIKIWDCSTGDCLKTLD 614

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 53/130 (40%), Gaps = 13/130 (10%)

Query: 38  QAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTE 95
           +AH   +  L +S       + S D+  +I+DL+  +   TL  H+  + ++ F +    
Sbjct: 488 RAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQY--- 544

Query: 96  NGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSED 155
                   +K + + S D  I IW +  +    TL+GH   +            +S   D
Sbjct: 545 --------DKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGAD 596

Query: 156 HSIRLWNLMT 165
             I++W+  T
Sbjct: 597 GLIKIWDCST 606

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 11/67 (16%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKW-LLSASE 112
           L SG  +  ++++DL KRK L T+  H  ++  L       E GD      +W L+S   
Sbjct: 167 LCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVR----EVGD------EWQLISGGR 216

Query: 113 DNKIIIW 119
           DN   +W
Sbjct: 217 DNVCTLW 223

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 42/110 (38%), Gaps = 11/110 (10%)

Query: 52  RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + + + S D+ I+I+ L     + TL  H  ++    F   + +           L+S+ 
Sbjct: 546 KLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQ-----------LVSSG 594

Query: 112 EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            D  I IW     +   TL GH  RI  +       + +S   D   + W
Sbjct: 595 ADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 34/166 (20%)

Query: 28  TPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGT-LLAH--QGSI 84
           TP   P+F+ +     +  LD S  + +SGS++ +I ++ L K+K L    +AH  Q   
Sbjct: 407 TPAEPPVFYGEGSIDCITMLDDS--HFISGSDNGNISLWSLSKKKPLFVQRVAHGVQPQP 464

Query: 85  TNLKFSKS-----KTENGDGEG-SNNKWL------------LSASEDNKIIIWR----VK 122
            N K S       +T+   G   +   W+             S S +  + +W+    ++
Sbjct: 465 DNTKISGERDPAVRTQQAQGNRLAQPYWITALHAVPYSNVFFSGSWNGTMKVWKLHENMR 524

Query: 123 DWENFGTL---KGHIARINDVDIHPSN----RVAISVSEDHSIRLW 161
            +E  G L   KG + +I  V+   S     RV  SVS++H +  W
Sbjct: 525 SFEPLGELDGCKGLVTKIQTVEAGKSGRETLRVLASVSKEHRLGRW 570

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 13/102 (12%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D+ I+I++++    K + TL  H+G +  + ++  K           
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTI------- 69

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHP 144
             L S S D K++IW+ ++  W        H A +N V   P
Sbjct: 70  --LASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAP 109

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 266 SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDME--KKDELAVY 311
           +L GH   V    +    FGT + S   DG+V++W  E  +  ++AV+
Sbjct: 48  TLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVH 95

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 11/67 (16%)

Query: 54  LVSGSNDEHIRIYDLQKR-KELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           +++ S+ +H+ I+DL+K    L TL  H+GS+ N+ F+K+K             ++S+S 
Sbjct: 173 IMASSHSDHVCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETE----------IMSSSN 222

Query: 113 DNKIIIW 119
           D  +  W
Sbjct: 223 DGTVKFW 229

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L +GS D  I+ +++  R+E  +  AH G +T L  ++ +  +   +  +  ++LS S+D
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDD 142

Query: 114 NKIIIW--RVKDWEN 126
             + +W   V D+ N
Sbjct: 143 KTVKLWSINVDDYSN 157

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 33/132 (25%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL----SASEDNKI-- 116
           I ++D+ + K +  L     +IT+LKF++++T+     GS+N  +L    + S   KI  
Sbjct: 201 IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQ 260

Query: 117 ------IIWRVKDWENFGT---------------------LKGHIARINDVDIHPSNRVA 149
                 I W   +  NF T                      K H++ + DVD  P+    
Sbjct: 261 TMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEI 320

Query: 150 ISVSEDHSIRLW 161
           ++ S D SIR++
Sbjct: 321 VTGSYDKSIRIY 332

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 16/93 (17%)

Query: 37  FQAHALSVKCLDVSKR--YLVSGSNDEHIRIYDLQK--RKELGTLLAHQGSITNLKFSKS 92
           F+ H  +V  +D S     +V+GS D+ IRIY       +E+      Q  +  +K+S  
Sbjct: 301 FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQ-HVFQVKYS-- 357

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
                     ++K+++S S+D  + +WR K WE
Sbjct: 358 ---------MDSKYIISGSDDGNVRLWRSKAWE 381

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 260 VEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEK 304
           V  P +++ GH + V   +F  N+ G  + S GSD R +VWD+++
Sbjct: 302 VSNPLYAMTGHEDAVTAIEFDPNNDGI-LYSSGSDRRTIVWDLQE 345

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 26/128 (20%)

Query: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           S     +   D  + +YD++     L  +  H+ ++T ++F      N DG       L 
Sbjct: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP----NNDG------ILY 330

Query: 109 SASEDNKIIIWRVKDW--------------ENFGTLKGHIARINDVDIHPS-NRVAISVS 153
           S+  D + I+W +++               E      GH   IND+ ++P+ N +  S  
Sbjct: 331 SSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAE 390

Query: 154 EDHSIRLW 161
           ED+ +++W
Sbjct: 391 EDNIVQIW 398

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 18/105 (17%)

Query: 94  TENGDGEG--SNNKW-LLSASEDNKIIIWRVKDWE-----NFGTLKGHIARINDVDIHPS 145
           TENG G    +N K+ LLS S+D+ I +W + ++E            H   INDV  H S
Sbjct: 179 TENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSS 238

Query: 146 N-RVAISVSEDHSIRLW---------NLMTVKKAAVLKLRNYSQN 180
              +  SVSED +++L+         N+ T K    L    +S N
Sbjct: 239 EAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN 283

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 128/323 (39%), Gaps = 56/323 (17%)

Query: 9   IVGSYEHN-----ILCLSLDLSL---KTPL----FTP---IFHFQAH---ALSVKCLDVS 50
            VGS E +     IL   +D+ L   K PL    F P   I  +  H     S++ +  +
Sbjct: 88  FVGSTEKDYLGRCILHPPVDIPLEFKKEPLSFRCFLPKTKIAEYYGHKNGTTSLRFIPKT 147

Query: 51  KRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLS 109
              L+SG ND  I+++D    +E L T   H  +I +L F    T+NG           S
Sbjct: 148 GHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF----TDNGHS-------FAS 196

Query: 110 ASEDNKIIIWRVKDWENFGTLKGHI---ARINDVD----IHPSNRVAISVSEDHS-IRLW 161
           AS D  + IW         T KG I    R N V      HP ++  + V   +S IR +
Sbjct: 197 ASFDKWVKIWN--------TEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHY 248

Query: 162 NL-MTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNK-VLIYKTAAAKVHCEIDMNK 219
           +L ++     V K  ++  +   +++  +G     +  +K V I++        +I    
Sbjct: 249 DLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINIPIKQISGTA 308

Query: 220 KTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEE-PEFSLLGHSNRVKDFK 278
           +  M        G+ + C    D  I+ Y      +  PK +  P  +  GH+       
Sbjct: 309 QHSMPWIDINPQGQSF-CTQSMDNTIYTY------SMLPKYKRHPNKTFKGHNTTGYGIH 361

Query: 279 FYKNDFGTYMVSIGSDGRVVVWD 301
           F  +  G Y+ S  S G+  +WD
Sbjct: 362 FAFSPDGQYIASGDSKGQTFIWD 384

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 46  CLDVSKRY-----LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGE 100
           C  ++K Y     L SGS D  ++ +++  R+EL +  AH G +T L  + +        
Sbjct: 70  CYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHL----SP 125

Query: 101 GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140
              + ++LS  +D  I +W V   ++F ++K     ++D 
Sbjct: 126 TKKDSFMLSCGDDKTIKLWSVNS-DDFNSIKDDTKIVSDT 164

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 16/93 (17%)

Query: 37  FQAHALSVKCLDVSK--RYLVSGSNDEHIRIYDLQK--RKELGTLLAHQGSITNLKFSKS 92
           F+ H  +V  +D S     +V+GS D+ IRI++L+    +E+      Q  +  +KF+  
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQ-HVFQVKFT-- 354

Query: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWE 125
                     ++K+++S S+D  + +WR K WE
Sbjct: 355 ---------MDSKYIVSGSDDGNVRLWRAKAWE 378

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 58/135 (42%), Gaps = 33/135 (24%)

Query: 62  HIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL----SASEDNKII 117
            I+++D+ ++K L  L     +++ ++F++++ +     GS+N  +L    + S   K++
Sbjct: 197 QIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVV 256

Query: 118 --------IWRVKDWENFG---------------------TLKGHIARINDVDIHPSNRV 148
                    W   +  NF                        K H++ + DVD  P+   
Sbjct: 257 QRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEE 316

Query: 149 AISVSEDHSIRLWNL 163
            ++ S D +IR++NL
Sbjct: 317 IVTGSYDKTIRIFNL 331

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNL 163
           + TLKGH A +  V   P +   +S SEDH +++W  
Sbjct: 52  YATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKF 88

>Sklu_2133.4 YBR234C, Contig c2133 6409-7530
          Length = 373

 Score = 35.4 bits (80), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 6/105 (5%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWEN--FGTLKGHIARINDVDIHPSNRVAISVSEDHSIR 159
           S ++ LL+ + D   +++R+   +     TL  H   +  VDI    R+ ++ S+D +  
Sbjct: 21  SQDRTLLAITYDTDCLVYRISGGKPQLVATLPDHDKTVTAVDISIHGRI-VTCSQDRNAI 79

Query: 160 LWNLMT--VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVL 202
           +W  ++    K  ++ LR  ++    V+W GNG  FAV    +++
Sbjct: 80  VWEPLSDGTYKPTLVLLR-INRAATCVKWAGNGYKFAVGSSARII 123

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 35.4 bits (80), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 30/146 (20%)

Query: 60  DEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIW 119
           D H+RI+D++ +K       H+ +++ +K S +   N         +LL+  +DN    W
Sbjct: 354 DGHVRIWDIRSKK-------HKPALS-VKVSDTDV-NVMSWNQKISYLLATGDDNG--TW 402

Query: 120 RVKDWENFGTLKGHIARINDVDIHPSNRVAIS-----------VSEDHSIRLWNL----- 163
            V D   F   +G ++ +   D H     +IS            SED+++ LW+L     
Sbjct: 403 GVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 462

Query: 164 ---MTVKKAAVLKLRNYSQNGQFVRW 186
              +  + A V +L+       FV W
Sbjct: 463 DEEIKQQAAEVKELQQIPPQLLFVHW 488

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 35.4 bits (80), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 15/90 (16%)

Query: 34  IFHFQAH---ALSVKCLDVSKRYLVSGSNDEHIRIYDL-QKRKELGTLLAHQGSITNLKF 89
           I+ ++ H     S++ L  +   ++SG ND  ++++D    RK L   + H   I  L F
Sbjct: 141 IYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF 200

Query: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIW 119
           +           S++   LS S D ++ IW
Sbjct: 201 T-----------SDSSQFLSGSYDQQVKIW 219

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 107 LLSASEDNKIIIWRV-KDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165
           +LS   DN + +W    D +      GH   I  +D    +   +S S D  +++W+  T
Sbjct: 164 ILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTET 223

Query: 166 VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVAL 197
            K    L   +   + +F    GN   F V L
Sbjct: 224 GKVTKRLNTYSTPNSAEFRPTSGNE--FVVGL 253

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 12/113 (10%)

Query: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           I ++D   + +L +L  H   IT+LKF  S              LLS+S D ++ IW   
Sbjct: 124 ITLHDSSLKTKL-SLDGHDAEITDLKFFPSSQV-----------LLSSSLDMRLKIWSAL 171

Query: 123 DWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLR 175
           D  N  T+ GH + I   +I    R  +S S+D +++LW   + K       R
Sbjct: 172 DGSNPRTIMGHKSIITGTEIIERGRNILSCSKDGTVKLWECGSGKNIYTFTRR 224

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 35.0 bits (79), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 63/141 (44%), Gaps = 14/141 (9%)

Query: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLK--FSKS-- 92
             AH   V  L +    L++ S D+ IR +DL   K +     +  S++  K  F KS  
Sbjct: 495 LDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNE 554

Query: 93  -----KTENGDGEGSNNKW---LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHP 144
                KT N    GS   +   L + ++D  I +W ++  E    L+GH+  I  +    
Sbjct: 555 DSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDA 614

Query: 145 SNRVAISVSEDHSIRLWNLMT 165
           +    IS S D +IRLW+L +
Sbjct: 615 T--TIISGSLDGTIRLWDLRS 633

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 43  SVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           S++  D +   L +G+ D  IR++D++  + +  L  H  +IT+LKF  +   +G  +G+
Sbjct: 569 SIQSFDAA---LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGT 625

Query: 103 NNKWLLSASEDNKIIIW 119
              W L ++    II +
Sbjct: 626 IRLWDLRSNNLTDIISY 642

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 28/50 (56%)

Query: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           D+ + +W        G ++GH+A I+ + +  +  +  + S+D +++LWN
Sbjct: 426 DHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWN 475

>Kwal_26.8628
          Length = 422

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 12/93 (12%)

Query: 70  KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGT 129
            R    T L +QG I +L FS S            + + +   D   +IW     E  G 
Sbjct: 338 SRSANSTYLDNQG-IVSLDFSGS-----------GRLMHACYTDYGCVIWDTLRAEIVGK 385

Query: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWN 162
           L+GH +RI+ V   P      + S D +++LW+
Sbjct: 386 LEGHSSRISGVKTSPDGMAVCTGSWDATLKLWS 418

>Kwal_56.24332
          Length = 418

 Score = 35.0 bits (79), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 67/174 (38%), Gaps = 22/174 (12%)

Query: 19  CLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           C   DL     + T +    +    VK L  S +   S   D  +R++DL+      T++
Sbjct: 190 CTVWDLQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLRSLAH-STII 248

Query: 79  AHQGSITNLKFSKSKTENG------DGEGSNNKWL-LSASE-DNKIIIWRVKDWEN---- 126
                 +    S+S+   G      DG  S+N  L L  S  D  ++     D  N    
Sbjct: 249 YEPNGQSAATLSQSQDSGGASGTSRDGSNSDNALLRLEPSPFDPNVVATFAHDSSNVLIL 308

Query: 127 --------FGTLKGHIARINDVDIHPSNR-VAISVSEDHSIRLWNLMTVKKAAV 171
                     TL+GH   +N +  H S + V I+ ++D    LW+L T   AA 
Sbjct: 309 DMRYPGAAVLTLEGHSGAVNQIQWHQSRQNVLITCADDCQALLWDLNTQLTAAA 362

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 57/135 (42%), Gaps = 26/135 (19%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQG----------SITNLKFSKSKTENG------ 97
           +V+GS++  I +YDL+    + T    +G             N++++ +++         
Sbjct: 285 IVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSS 344

Query: 98  ---DGEG-------SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147
              D +G       ++ + + S   D   ++W V   E  G L+GH  R+  V   P   
Sbjct: 345 SYLDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGL 404

Query: 148 VAISVSEDHSIRLWN 162
              + S D ++++W+
Sbjct: 405 AVCTGSWDSTMKIWS 419

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           +P   L GH+N++ DF++ ++     ++S   DG +++WD
Sbjct: 83  KPNIVLKGHNNKISDFRWSRD--SKRILSASQDGFMLIWD 120

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 107/265 (40%), Gaps = 34/265 (12%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTL--LAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS 111
           + +GS D  I++ D++  + +  L   AH+ ++ ++ +             ++  L + S
Sbjct: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-----------HSNILAAGS 76

Query: 112 EDNKIIIWRVKD----------WENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            D+ + IW   D           E    ++GH   I  V       +  + S D S+ +W
Sbjct: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136

Query: 162 NL--MTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLN-KVLIYKTAAAKVHCEIDMN 218
               M  +   +  L+ +SQ+ + V W  +    A +  +  V I+K       C   +N
Sbjct: 137 EADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN 196

Query: 219 --KKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLL--GHSNRV 274
             + T+   + E  +  + +C    DG +  +  E     E + E  + S+L   H+  V
Sbjct: 197 GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD-NGEYEQEWIQESILPKAHTRAV 255

Query: 275 KDFKFYKNDFGTYMVSIGSDGRVVV 299
               +       Y+ S GSDGR+V+
Sbjct: 256 YSVNWSPK---GYIASTGSDGRLVI 277

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 49/268 (18%), Positives = 100/268 (37%), Gaps = 45/268 (16%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D  ++I++++    K + TL  H+G +  + ++  K           
Sbjct: 17  LDYYGKRLATCSSDHTVKIFEVEGETHKLVDTLQGHEGPVWQVDWAHPKF---------G 67

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHPS--NRVAISVSEDHSIRL 160
             L S S D K++IW+  +  W      + H A +N +   P     + ++ S D  + +
Sbjct: 68  VILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSV 127

Query: 161 WNLMTVKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKK 220
                    + + +  +S       W       A A L +     T+ +        + +
Sbjct: 128 VEFKENGTTSPIIIDAHSIGANTACW-------APATLQQQSNQGTSGS-------ASPQ 173

Query: 221 TIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFY 280
            +    T   D  + I    SD   +                 E +L GHS+ V+D  + 
Sbjct: 174 QVRRFVTGGADNLVKIWKYNSDAATYLL---------------EHTLEGHSDWVRDVAWS 218

Query: 281 KNDFG-TYMVSIGSDGRVVVWDMEKKDE 307
                 +Y+ S+  D   ++W  + K++
Sbjct: 219 PTVLSRSYLASVSQDRTCIIWTQDSKED 246

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 93  KTENGDGEGSNNKW------LLSASEDNKIIIWRV-KDWENFGTLKGHIARINDVDIHPS 145
           +T N     +  KW      +L+ S  N + +W V K       L+GH   +N +D +P 
Sbjct: 153 RTSNWRSGAAQVKWNHKNSNVLATSHSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPF 212

Query: 146 NRVAI-SVSEDHSIRLWNLMTVK 167
           N   I S   D +++ W+   V+
Sbjct: 213 NETEIMSSGNDGTVKFWDYNKVE 235

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 76/212 (35%), Gaps = 62/212 (29%)

Query: 106 WLLSASEDNKIIIWRVKDWENFGT---LKGHIARINDVDIHPSNRVAISVSEDHSIRL-W 161
           W++S S + K I+W +    +      L GH   I D++ HP     ++ S   +  L W
Sbjct: 84  WVISTS-NQKAIVWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAW 142

Query: 162 NLMTVKKAAVLKLRNYSQNGQFVRWI-GNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKK 220
           ++ + KK    +  N+      V+W   N +  A +  N V ++           D+ K 
Sbjct: 143 DMRSPKK-PYFRTSNWRSGAAQVKWNHKNSNVLATSHSNIVYVW-----------DVRKG 190

Query: 221 TIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFY 280
           T                                         P   L GHS  V    F 
Sbjct: 191 T----------------------------------------SPLSVLEGHSGSVNSIDF- 209

Query: 281 KNDFG-TYMVSIGSDGRVVVWDMEK-KDELAV 310
            N F  T ++S G+DG V  WD  K +DEL +
Sbjct: 210 -NPFNETEIMSSGNDGTVKFWDYNKVEDELQM 240

>Scas_670.21
          Length = 595

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 70/182 (38%), Gaps = 42/182 (23%)

Query: 8   IIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCL--DVSKRYLVSGSNDEHIRI 65
           +  GS +HNIL    D+ +  P F        H+  V  L  +  +  L SG ND  + +
Sbjct: 386 LTSGSRDHNIL--HRDVRMPDPFFE---RLNTHSQEVCGLQWNTEENKLASGGNDNVVCV 440

Query: 66  YDLQKRKELGTLLAHQGSITNLKFSKSKT---ENGDGEGSNNKWLLSASEDNKIIIWRVK 122
           YD   R  +   + H+ ++  L +S  K      G G           + D ++ IW V 
Sbjct: 441 YDGTSRNPMIKFIEHKAAVKALAWSPHKRGILATGGG-----------TVDRRLKIWNVN 489

Query: 123 DWENFGTLKGHIARINDVD--------IHPSNRVAISVSEDHS---IRLWNLMTVKKAAV 171
                        +++DVD        I   N   I  S  +S   + LW+  T+   A+
Sbjct: 490 T----------SMKLSDVDTGSQVCNMIWSKNTDEIVTSHGYSKYHLTLWDYPTMNPVAI 539

Query: 172 LK 173
           LK
Sbjct: 540 LK 541

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS-NRVAISVSEDHSIRL 160
           S N ++LSAS D  + +W      +  T   H   +  V+ HP+ +R  IS   DH  RL
Sbjct: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRL 345

Query: 161 WNLM 164
           W+++
Sbjct: 346 WSIL 349

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 12/83 (14%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLA-HQGSITNLKFSKSKTENGDGEGSNNK 105
           LD S R +V+ SND  IRI+DL++RK L  L   H GS      S+ K +     G    
Sbjct: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS------SQHKAQLSIWHG--QP 488

Query: 106 WLLSASEDNKIIIWRVK--DWEN 126
            ++++S+D+ +  WR+K  D EN
Sbjct: 489 IVVNSSDDHWVYGWRLKSSDREN 511

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 74/186 (39%), Gaps = 42/186 (22%)

Query: 4   NQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQA---HALSVKCL--DVSKRYLVSGS 58
           NQ  +  GS +H IL   + +        P  +F+    H+  V  L  +V +  L SG 
Sbjct: 338 NQHILSSGSKDHKILHRDVRM--------PEHYFETANTHSQEVCGLKWNVDENRLASGG 389

Query: 59  NDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIII 118
           ND  + +YD   +K +     H  ++  + +S  +       G         + D ++ I
Sbjct: 390 NDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGG--------GTADRRLKI 441

Query: 119 WRVKDWENFGTLKGHIARINDVD--------IHPSNRVAISVSEDHS---IRLWNLMTVK 167
           W V    N G       R+NDVD        +   N   I  S  +S   + LW+  T++
Sbjct: 442 WNV----NSG------VRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLE 491

Query: 168 KAAVLK 173
             AVLK
Sbjct: 492 PLAVLK 497

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 56/146 (38%), Gaps = 17/146 (11%)

Query: 29  PLFTPIFHFQAHALSVKCLDVSKRYLVS-----GSNDEHIRIYDLQKRKELGTLLAHQGS 83
           P   P+  F  H  +VK +  S     +     G+ D  ++I+++     L  +    GS
Sbjct: 400 PSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDV--DTGS 457

Query: 84  -ITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDI 142
            + N+ +SK+  E     G +            + +W     E    LKGH  R+  + +
Sbjct: 458 QVCNMVWSKNTDEIVTSHGYSKF---------NLTLWDCPTLEPLAVLKGHSFRVLHLTL 508

Query: 143 HPSNRVAISVSEDHSIRLWNLMTVKK 168
                  +S + D ++R W L    K
Sbjct: 509 STDGTTIVSGAGDETLRYWKLFGKSK 534

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 68/195 (34%), Gaps = 36/195 (18%)

Query: 9   IVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDL 68
           I+ S   +   L  D+ +  P F  I   +     +K  + +   L SG ND  + +YD 
Sbjct: 430 ILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLK-WNTNDNKLASGGNDNMVFVYDG 488

Query: 69  QKRKELGTLLAHQGSITNLKFSKSK-----TENGDGEGSNNKWLLSAS------------ 111
             R    ++  H+ ++  + +S  K     T  G  + +   W ++ S            
Sbjct: 489 TSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQV 548

Query: 112 ------------------EDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153
                                 + IW   + E    LKGH  R+  + +       +S +
Sbjct: 549 CNMVWSTNTDEIVTSHGYSKYNLTIWEASNLEPLAILKGHSFRVLHLTLSADGTTIVSGA 608

Query: 154 EDHSIRLWNLMTVKK 168
            D ++R W L   +K
Sbjct: 609 GDETLRYWKLFEKQK 623

>Scas_689.6
          Length = 2139

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 107  LLSASEDNKIIIWRVKDWEN------FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRL 160
             L+  E+  I IW++++  N       G+L  HI  I D+ ++P     +++     + L
Sbjct: 1919 FLTGDENGLIKIWKLQNLANGNILVQLGSLYCHICEIKDMQLYPDLNSLLTLDSSGKVML 1978

Query: 161  WNLMTVK 167
            W++M  +
Sbjct: 1979 WDMMNYQ 1985

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 23/192 (11%)

Query: 40  HALSVKCLDVSKR----YLVSGSNDEHIRIYDLQKRKELGTLL---AHQGSITNLKFS-- 90
           H+ SV C+  +       L+ GS D  I + +L+  +   T +   AH+  + ++ ++  
Sbjct: 103 HSASVNCVKWAPHEYGLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPL 162

Query: 91  -KSKTENGDGEGSNNKWLLSASEDNKIIIWRV-KDWENF---GTLKGHIARINDVDIHPS 145
            K+ + +   E +  K  +S   DN + IW+   D E +    TL+GH   +  VD  P+
Sbjct: 163 MKTDSSDDGDETTAVKQFISGGNDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVDWSPT 222

Query: 146 NRV---AISVSEDHSIRLWNL-MTVKKAAVLKLR----NYSQNGQFVRWIGNGDYFAVAL 197
             +     SVS D    +W    + KK    K+      + Q    V W  +G+  AV+ 
Sbjct: 223 TLLQSYVASVSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSD 282

Query: 198 LNK-VLIYKTAA 208
            +K V I+K + 
Sbjct: 283 DDKNVTIWKESG 294

>Kwal_27.12586
          Length = 509

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRW 186
            G L GH A I   D +  N + +S S+D ++R+W   ++  +             F  W
Sbjct: 328 LGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAF--W 385

Query: 187 IGNGDYFAVALLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIH 246
           I +    A +L   V ++      +   I M     +   + + D K+   +   DG + 
Sbjct: 386 IDDDKVIATSLDGSVRLWSHLTNTLQA-ISMVDGVPIFCGSLSPD-KLKFAIGKMDGEVT 443

Query: 247 FYPTEGLL 254
            Y  E LL
Sbjct: 444 VYNIEKLL 451

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           S+ + + +   D    +W +   E  G + GH  RIN V   P     +S S D ++++W
Sbjct: 372 SSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 40/197 (20%)

Query: 129 TLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT-VKKAAVLKLRNY------SQNG 181
           TLKGH  +I+DV     +   +S S+D  I +W+  T +KK+A+  L  +      S +G
Sbjct: 81  TLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISPSG 140

Query: 182 QFVRWIGNGDYFAVALL--------NKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGK 233
             V   G  ++ +V  +        N + I+K     +     ++++TI+    +     
Sbjct: 141 NLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERTILTASGD----- 195

Query: 234 IYICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTY---MVS 290
             +  AM D      P    +TE           + H   V        + G Y    ++
Sbjct: 196 --MTCAMWD-----IPKSKRVTE----------FIDHLGDVLTMDLPPANTGRYGHNFIT 238

Query: 291 IGSDGRVVVWDMEKKDE 307
            GSDG   +WD+ + + 
Sbjct: 239 GGSDGYAYLWDVRQPNS 255

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           +P  +L GH+N++ D K+ ++     ++S   DG +++WD
Sbjct: 77  QPVRTLKGHNNKISDVKWSQD--SASVLSSSQDGFIIIWD 114

>YBR234C (ARC40) [413] chr2 complement(685395..686549) Component of
           the ARP2/3 actin-organizing complex, involved in actin
           assembly and function [1155 bp, 384 aa]
          Length = 384

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 7/106 (6%)

Query: 102 SNNKWLLSASEDNKIIIWRVKDWEN---FGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158
           S +K +L+ + +   +++RV +      F TLK H   I  VDI    R+ ++ S+D + 
Sbjct: 28  SQDKSILAVTCETDCLVYRVSNNTPPVLFATLKDHDKTITAVDISIHGRI-VTCSQDRNA 86

Query: 159 RLWNLMT--VKKAAVLKLRNYSQNGQFVRWIGNGDYFAVALLNKVL 202
            +W  ++    K  ++ LR  ++    V W  NG  FAV    +++
Sbjct: 87  YVWEPLSDGTYKPTLVLLR-INRAATSVTWAPNGYKFAVGSSARII 131

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 57/136 (41%), Gaps = 20/136 (14%)

Query: 30  LFTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIR---IYDLQKRKELGTLLAHQGSITN 86
           L T ++  Q    SV C D  K  L+ G  D  I    ++       L TL+ HQG++ +
Sbjct: 46  LGTVVYTGQGFLNSV-CYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCS 104

Query: 87  LKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHP-S 145
           L F        DG       ++S S D    +W  K+      L+ H A + D  +   S
Sbjct: 105 LSFQ-------DGV------VISGSWDKTAKVW--KEGSLVYNLQAHNASVWDAKVVSFS 149

Query: 146 NRVAISVSEDHSIRLW 161
               ++ S D +I+LW
Sbjct: 150 ENKFLTASADKTIKLW 165

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 27/182 (14%)

Query: 31  FTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFS 90
           F P  H ++  +S  C     + + + S+D  I I  +   + L  L+ H   + +L ++
Sbjct: 50  FIPTSHVES--MSDICWSPDSQCIATASDDFTIEINHITYGR-LHRLVGHTAPVLSLVYT 106

Query: 91  KSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAI 150
                      S    L SAS D  I IW V       T+  H   +  +D+   +   +
Sbjct: 107 -----------SKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSIL 155

Query: 151 SV-SEDHSIRLWNLMTVKKAAVLKLRNY-----SQNGQF----VRWIGNGDYFAVALLNK 200
           S  S D  IR+++  T      LK   Y     S+NG      V++  NG Y  V  L+ 
Sbjct: 156 SSGSYDGLIRIFDTTT---GHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDG 212

Query: 201 VL 202
           VL
Sbjct: 213 VL 214

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 132 GHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQ----FVRWI 187
           GH  +I  + I P+     + S+D S+R+W ++T ++   ++L N   N +     V W 
Sbjct: 434 GHEGKIRTLSIDPTGIWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNPEDNIHSVEWN 493

Query: 188 GNGDY--FAVALLNKVLI 203
            +G     AVA+ N + +
Sbjct: 494 PDGSVGILAVAVGNNIFL 511

>Kwal_56.24596
          Length = 294

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 13/102 (12%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D+ I+I++++    K + TL  H+G +  + ++  K           
Sbjct: 17  LDYYGKRLATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDWAHPKF---------G 67

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHP 144
             L S S D K++IW+ ++  W        H A +N V   P
Sbjct: 68  VILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAP 109

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 236 ICVAMSDGNIHFYPTEGLLTEEPKVEEPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDG 295
           +    SD  I  +  EG   E  K+ E   +L GH   V    +    FG  + S   DG
Sbjct: 24  LATCSSDKTIKIFEVEG---ETHKLVE---TLHGHEGPVWQVDWAHPKFGVILASCSYDG 77

Query: 296 RVVVWDME--KKDELAVY 311
           +V++W  E  +  ++AV+
Sbjct: 78  KVLIWKEENGRWTQIAVH 95

>Scas_706.24
          Length = 460

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 85/220 (38%), Gaps = 31/220 (14%)

Query: 97  GDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS--NRVAISVSE 154
           G  +GS   W+L     NK     + D        G+   IND+  +PS  N  A +VS 
Sbjct: 74  GRMDGSLTVWVLQGHSFNKAKNCYIPD------ANGNDKVINDLSFNPSELNEFA-TVSN 126

Query: 155 DHSIRLWNLMTVKKAAVLKLRNYSQNGQFVR-----WIGNGDYFAVALLNKVL-IYK--- 205
            + I +WN+       V KLR  S     V+     +   G +F  A  +  L IY    
Sbjct: 127 SNEIFIWNIQNDSSPTVNKLRTLSLPSSKVKVNRCAYDPRGIWFFAATKSDCLYIYNVKE 186

Query: 206 ----TAAAKVHCEIDMNKKTIMHLETETLDGKIYICVAMSDGNIHFYPTEGLLTEEPKVE 261
                A+  VH   D N  TI  +  +   GK +I +    G +       LL       
Sbjct: 187 EHSMVASLPVHSISDEN-DTIYSISWDN-SGK-FIFIGFRSGKL------ALLEVSDDTG 237

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           E  F L+  ++R        +  G ++++  +DG   +WD
Sbjct: 238 EMTFKLIVQAHRSAISVIKMDPVGRFVITGSTDGSCALWD 277

>CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces
           cerevisiae YBR281c, hypothetical start
          Length = 870

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 14/76 (18%)

Query: 51  KRYLVSGSNDEHIRIYDLQKRK-----ELGTLLAHQGSITNLKFSKSKTENGDGEGSNNK 105
           K+ L++G+ D  I ++DL         +LG +  +    + L  +KSK         N K
Sbjct: 26  KKLLIAGTQDSKILVFDLPAYNLIETIKLGEISENNTRSSVLSLAKSK---------NEK 76

Query: 106 WLLSASEDNKIIIWRV 121
           +L SA  D+ + +WRV
Sbjct: 77  YLFSAGADSLVRVWRV 92

>Kwal_33.13148
          Length = 673

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 15/78 (19%)

Query: 101 GSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIA--------------RINDVDIHPSN 146
           G +NK + S SED KI IW        G + GHI                 N V  +P+N
Sbjct: 593 GYDNKLIASGSEDGKIYIWDRFHGNIIGVINGHITDRPLALNAVNTFGRNCNIVAWNPAN 652

Query: 147 R-VAISVSEDHSIRLWNL 163
           + +  S  +D SI++W++
Sbjct: 653 KDMFASGGDDGSIKIWSV 670

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 13/102 (12%)

Query: 47  LDVSKRYLVSGSNDEHIRIY--DLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNN 104
           LD   + L + S+D+ I+I+  D    K + +L  H+G +  + ++  K           
Sbjct: 17  LDYYGKRLATCSSDKTIQIFEVDGDSHKLVDSLHGHEGPVWQVDWAHPKF---------G 67

Query: 105 KWLLSASEDNKIIIWRVKD--WENFGTLKGHIARINDVDIHP 144
             L S S D K++IW+ ++  W      + H A +N V   P
Sbjct: 68  VILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAP 109

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 266 SLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWDME--KKDELAVYD 312
           SL GH   V    +    FG  + S   DG+V++W  E  +  ++A Y+
Sbjct: 48  SLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYE 96

>Scas_721.29
          Length = 414

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 59/112 (52%), Gaps = 15/112 (13%)

Query: 54  LVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           L+SG ++  I ++DL+K   E    L H  SI+ L+++ +              + SA +
Sbjct: 304 LISGDSEGRINLWDLRKLDGEPIKTLHHGSSISTLEWNPNLE----------TIVASAGQ 353

Query: 113 DNKII-IWRVKDWENFGTLKGHIARINDV--DIHPSNRVAISVSEDHSIRLW 161
           D+ ++ +W V   E   T  GH+  +ND+  ++H +  +  SVS D+S+++W
Sbjct: 354 DDGLVKLWDVSTDELVFTHGGHMLGVNDISWNLHDT-WLMCSVSNDNSVQVW 404

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 83/207 (40%), Gaps = 32/207 (15%)

Query: 128 GTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWI 187
           G LKGH  +I D      +++ +S S+D  + +W+ +T  K + + L     + Q+V   
Sbjct: 79  GILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPL-----DSQWVLTC 133

Query: 188 GNGDYFAVA----LLNKVLIYKTAAAKVHCEIDMNKKTIMHLETETLDGKIYIC---VAM 240
                 A+A    L N   IY+         +  N  +I    T  + G  ++    V  
Sbjct: 134 ALSPSGALAASAGLNNNCTIYRMPRGSA---VQQNVTSIFKGHTGYISGVEFVSESRVVT 190

Query: 241 SDGNIHFYPTEGLLTEEPKVEE-PEFS-----LLGHSNRVKDFKFYKNDFGTYMVSIGSD 294
           S G++        L + PK +   E+S     +L  S  V +    KN+      S GSD
Sbjct: 191 SSGDMTC-----ALWDIPKAKRVREYSDHLGDVLAISIPVTNLS--KNNM---FASCGSD 240

Query: 295 GRVVVWDMEKKDELAVYDCGE-RLNCL 320
           G   +WD+     +  +  G    NCL
Sbjct: 241 GYTFIWDVRSPSAVQQFSIGSCDSNCL 267

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 262 EPEFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
           +P   L GH+N++ DF++ ++     ++S   DG ++VWD
Sbjct: 76  KPVGILKGHTNKIADFRWSRDS--KLILSASQDGFMIVWD 113

>AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH]
           (425925..427226) [1302 bp, 433 aa]
          Length = 433

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 14/87 (16%)

Query: 41  ALSVKCLDVSK--RYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGD 98
            L   CL+ S    YL  G ++  + IYD+  +K +  L  H G       S + ++ G 
Sbjct: 27  PLQCDCLEFSPGGDYLAVGCSNGSLVIYDMDTKKPISVLGNHGGGHVRAVQSVAWSQCG- 85

Query: 99  GEGSNNKWLLSASEDNKIIIWRVKDWE 125
                 ++L S+S D     WRVK W+
Sbjct: 86  ------RYLWSSSRD-----WRVKMWD 101

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 21  SLDLSLKTPLFTPIFHFQAHALSVK--CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78
           S D +   P  T +   Q  A + K    DVS  +LVS SND  IRIY L + + +  + 
Sbjct: 406 SSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ-EFVSVMK 463

Query: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD 123
            H    + +    + T +G        +++S SED+ I  W++ D
Sbjct: 464 GHSNEHSQITAHSTVTRSGKA------YVVSGSEDHWIYCWKLSD 502

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 88/235 (37%), Gaps = 43/235 (18%)

Query: 48  DVSKRYLVSGSNDEHIRIYDLQKRK---ELG-TLLAHQGSITNLKFSKSKTENGDGEGSN 103
           D   R++ + S+D+HI+++ L K     EL  +  AH  SI  + ++  +          
Sbjct: 18  DFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEY--------- 68

Query: 104 NKWLLSASEDNKIIIWRV---------KDWENFGTL---KGHIARINDVDIHPSNRVAI- 150
            + + SAS D  + +W           + W    TL   KG +  +     H   ++A  
Sbjct: 69  GRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACL 128

Query: 151 ---------SVSEDHSIRLWNLMTVKKAAVLKLRNYSQNGQFVRWIG---NGDYFAVALL 198
                       E   +R W L +  K   +   N+ Q+   + W     + +  AV+ L
Sbjct: 129 GNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSAL 188

Query: 199 NKVLIY---KTAAAKVHCEIDMNKKTIMHLETETLDGKIY--ICVAMSDGNIHFY 248
            + +IY   K     V  ++  +K  I  +      G+ Y  I     DG I  +
Sbjct: 189 EQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIF 243

>Kwal_56.23035
          Length = 424

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 21/141 (14%)

Query: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQG----SITNLKFSKSKTENGDGEGS 102
           LDV    L   S D H R+ DL       TL   +      I   KF++S       EGS
Sbjct: 190 LDVQGDLLAVASEDSHPRLIDLASMSAAITLGVKRTDMRYGINTAKFARSD------EGS 243

Query: 103 NNKWLLSASEDNKIIIWRVK-------DWENFGTL-KGHIARINDVDIHPS--NRVAISV 152
             + L +  +D  + +W ++       D +   +L K H    ND+   PS  NR+ ++ 
Sbjct: 244 PQQLLATGDDDGNVRLWDLRMGNRALCDLQEPDSLAKPHARCCNDLCWDPSGANRI-VTT 302

Query: 153 SEDHSIRLWNLMTVKKAAVLK 173
             D   +LW +     + +L+
Sbjct: 303 GNDGKCKLWEISPDGSSQLLR 323

>Kwal_56.22345
          Length = 396

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 26/128 (20%)

Query: 50  SKRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108
           S     +   D  + ++D +K  E L ++  HQ ++T+L+F+  K    DG       L 
Sbjct: 258 SSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK----DG------ILC 307

Query: 109 SASEDNKIIIWRV---------KDWENFGT-----LKGHIARINDVDIHPS-NRVAISVS 153
           S   D ++++W +         +D ++ G        GH + IND    P+   +  SV 
Sbjct: 308 SGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVE 367

Query: 154 EDHSIRLW 161
           E++ +++W
Sbjct: 368 EENIVQIW 375

>AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH]
           complement(1476148..1476150,1476201..1477442) [1245 bp,
           414 aa]
          Length = 414

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 218 NKKTIMHLETETLDGKIYICV-AMSDGNIHFYPTE-----GLLTEEPKVEEPEFSLLGHS 271
           N  T+  L+   L G + +   + S G +  Y TE     G LT      +     + HS
Sbjct: 249 NSNTVRALKFSPLGGLLAVANDSGSFGCVTLYETEYGEPVGSLTVPMHSNQQSIVSVAHS 308

Query: 272 NRVKDFKFYKNDFGTYMVSIGSDGRVVVWDMEKKDELA 309
             V    F  N  G Y+ S G D +V VWD++ ++ ++
Sbjct: 309 GWVFGLSF--NSSGEYLASCGYDAKVRVWDVKLREHVS 344

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 117 IIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
           I+W     E  G L+GH +RI+ V   P      + S D +++LW
Sbjct: 377 IVWDTLRGEIVGRLEGHSSRISGVRTSPDGMCVCTGSWDSTMKLW 421

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 264 EFSLLGHSNRVKDFKFYKNDFGTYMVSIGSDGRVVVWD 301
             +L GH+N++ DF++ ++     ++S   DG +++WD
Sbjct: 81  SMTLKGHNNKISDFRWSRD--SKSILSASQDGFMLIWD 116

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 18/119 (15%)

Query: 46  CLDVSKRYLVSGSNDEHIR-IYDLQKRKE--LGTLLAHQGSITNLKFSKSKTENGDGEGS 102
           C D S + L  G  D  +  I  L    E  +  L+ H+G++ +L              S
Sbjct: 61  CYDKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLS-------------S 107

Query: 103 NNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLW 161
            N +++S+S D    +W   +      L GH A + D    P     ++ S D +I+LW
Sbjct: 108 KNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLW 164

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 69/203 (33%), Gaps = 42/203 (20%)

Query: 4   NQFRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCL--DVSKRYLVSGSNDE 61
           N   +  GS +  IL    D+ +  P F      + H   V  L  +  +  L SG ND 
Sbjct: 342 NNHILTSGSRDRKIL--HRDVRMPEPYFE---QVETHTQEVCGLKWNTDENRLASGGNDN 396

Query: 62  HIRIYDLQKRKELGTLLAHQGSITNLKFSKSK-----TENGDGEGSNNKWLLSAS----- 111
            + +YD   RK    L  H  ++  + +S  K     T  G  +     W ++ S     
Sbjct: 397 VVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRD 456

Query: 112 --------------EDNKII-----------IWRVKDWENFGTLKGHIARINDVDIHPSN 146
                           N+++           +W     E    LKGH  R+  + +    
Sbjct: 457 IDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADG 516

Query: 147 RVAISVSEDHSIRLWNLMTVKKA 169
              +S + D ++R W L    K 
Sbjct: 517 TTVVSGAGDETLRYWKLFDRPKP 539

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 13/65 (20%)

Query: 53  YLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASE 112
           +L  G  +  + IYD+ KRK + TL  H   +  L +             NN  L S S 
Sbjct: 305 HLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSW-------------NNHILTSGSR 351

Query: 113 DNKII 117
           D KI+
Sbjct: 352 DRKIL 356

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 38  QAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENG 97
           Q H +   C     + ++SGS D  I I+D  +   +  L  H   ++N      K  N 
Sbjct: 658 QQHFIIRSCFAYGNKLVMSGSEDGKIYIWDRIRGNLVSVLSGHSTVMSNSTKPMGKNCNV 717

Query: 98  DGEGSNNKWLL-SASEDNKIIIWRV 121
                 +K +  S  +D KI IW++
Sbjct: 718 VASNPADKEMFASGGDDGKIKIWKI 742

>Scas_705.46
          Length = 490

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 11/55 (20%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 263 PEFSLLGHSNRVKDFKFY---KNDFGTYMVSIGSDGRVVVWDMEKKDELAVYDCG 314
           P+++L  H++ +     Y   ++    Y++S  + G++V+WD+  +  +  +  G
Sbjct: 8   PKYTLRNHTDPISALALYYPARDTVVPYLISADASGKIVIWDLITRRPVHTFASG 62

>Scas_652.16
          Length = 345

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 119/317 (37%), Gaps = 74/317 (23%)

Query: 48  DVSKRYLVSGSNDEHIRIYDLQKRK---ELG-TLLAHQGSITNLKFSKSKTENGDGEGSN 103
           D   R++ + S+D+HI+++ L K     EL  +  AH  SI ++ ++  +          
Sbjct: 21  DFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASPEY--------- 71

Query: 104 NKWLLSASEDNKIIIWRV---------KDWENFGTL---KGHIARINDVDIHPSNRVAIS 151
            + ++SAS D  + +W           + W    TL   KG +  +     H   ++A  
Sbjct: 72  GRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLAC- 130

Query: 152 VSEDHSIRL-----------WNLMTVKKAAVLKLRNYSQNGQFVRWIG---NGDYFAVAL 197
           +  D ++R+           W L +  K   +   N+ Q+   + W     + +   V+ 
Sbjct: 131 IGNDATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLVVST 190

Query: 198 LNKVLIY---KTAAAKVHCEIDMNKKTIMHLETETLDGKIY--ICVAMSDGNIHFYPTEG 252
           L++  IY   K     +  +++ +K  I  +      G+ Y  I     DG +  +    
Sbjct: 191 LDQASIYQRGKDGKLYIVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVE 250

Query: 253 LLTE------------------EPKVEEPEFSLLGHSNRVKDFKFYK-----------ND 283
            L++                  E   E  E SLLG S  V+    +            N 
Sbjct: 251 KLSDNSSKDAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNL 310

Query: 284 FGTYMVSIGSDGRVVVW 300
            GT + S G DG+V +W
Sbjct: 311 TGTILSSAGDDGKVRLW 327

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 21/124 (16%)

Query: 6   FRIIVGSYEHNILCLSLDLSLKTPLFTPIFHFQAHALSVKCLDVSKR--YLVSGSNDEHI 63
           F  ++ + +HN     +    K      +  F+ H  +V  +D S     +V+GS D+ I
Sbjct: 268 FNFVIANEDHNAYYYDMRNMSKA-----LHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTI 322

Query: 64  RIYDLQK--RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRV 121
           RIY ++    +E+      Q  I  +K++            ++K+++S S+D  + +WR 
Sbjct: 323 RIYQVKHGHSREIYHTKRMQ-HIFQVKYT-----------MDSKYIVSGSDDGNVRLWRA 370

Query: 122 KDWE 125
           K WE
Sbjct: 371 KAWE 374

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSASED 113
           L + S D  I+ +++  R+EL +  AH G +T L  + S             ++LS  +D
Sbjct: 83  LATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYL-----SPQRENFMLSCGDD 137

Query: 114 NKIIIWRVKDWENFGTLK 131
             + +W V   ++F  +K
Sbjct: 138 KTVKLWSVNS-DDFSNVK 154

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,538,918
Number of extensions: 567539
Number of successful extensions: 3736
Number of sequences better than 10.0: 354
Number of HSP's gapped: 3261
Number of HSP's successfully gapped: 764
Length of query: 384
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 281
Effective length of database: 13,030,455
Effective search space: 3661557855
Effective search space used: 3661557855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)