Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_685.1076076039280.0
YKL022C (CDC16)84079220520.0
Kwal_14.87472276220090.0
Sklu_2380.677475720120.0
ACR168W70776218420.0
KLLA0E07986g72176317710.0
CAGL0L09823g74359417370.0
YBR112C (SSN6)9662501526e-10
Scas_599.58092511445e-09
Scas_705.559072501392e-08
AGL294W6562541312e-07
CAGL0D01364g11482111303e-07
CAGL0I02288g6394461203e-06
ADL344W9102211186e-06
KLLA0B09262g9412211161e-05
Kwal_23.36708022211106e-05
Scas_680.356313741052e-04
KLLA0A05258g6322821042e-04
Kwal_27.107406282661042e-04
CAGL0C01903g7692271034e-04
YBL084C (CDC27)7582211016e-04
YHR166C (CDC23)6263871007e-04
KLLA0C15455g56665930.006
CAGL0J09570g54959900.010
CAGL0K11209g59070850.043
YDR244W (PEX5)61271840.063
Kwal_56.24750619344830.088
KLLA0E20933g710235820.11
AEL281C139071790.30
ACR005W32766770.30
ABR131W59478780.34
ABR206W682257780.37
CAGL0A03630g1062133770.48
YPR189W (SKI3)143253770.49
Kwal_23.5408141052750.93
AFL103C61490731.2
KLLA0B03520g140159731.3
Scas_718.37d60148731.3
Kwal_27.1173757571721.4
YOL145C (CTR9)107728721.6
CAGL0L04048g58778721.6
KLLA0B09966g370111702.7
AER007W49595693.2
Scas_666.23596125693.3
AEL224W58099694.1
YLR127C (APC2)853138694.2
Scas_589.5108792685.4
Sklu_1876.2109052685.5
KLLA0F08459g83768676.1
Scas_437.1105346676.6
AFR112W29746667.3
Kwal_33.1528128767658.4
Kwal_55.22152110166669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_685.10
         (760 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_685.10                                                          1517   0.0  
YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...   795   0.0  
Kwal_14.874                                                           778   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement      779   0.0  
ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...   714   0.0  
KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...   686   0.0  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...   673   0.0  
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    63   6e-10
Scas_599.5                                                             60   5e-09
Scas_705.55                                                            58   2e-08
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    55   2e-07
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    55   3e-07
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    51   3e-06
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    50   6e-06
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    49   1e-05
Kwal_23.3670                                                           47   6e-05
Scas_680.35                                                            45   2e-04
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    45   2e-04
Kwal_27.10740                                                          45   2e-04
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    44   4e-04
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    44   6e-04
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    43   7e-04
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...    40   0.006
CAGL0J09570g complement(939447..941096) some similarities with s...    39   0.010
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    37   0.043
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    37   0.063
Kwal_56.24750                                                          37   0.088
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    36   0.11 
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    35   0.30 
ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH] complement(...    34   0.30 
ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W (...    35   0.34 
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    35   0.37 
CAGL0A03630g complement(364712..367900) similar to sp|P33339 Sac...    34   0.48 
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    34   0.49 
Kwal_23.5408                                                           33   0.93 
AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH] (245331..2...    33   1.2  
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    33   1.3  
Scas_718.37d                                                           33   1.3  
Kwal_27.11737                                                          32   1.4  
YOL145C (CTR9) [4679] chr15 complement(49553..52786) Protein req...    32   1.6  
CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces c...    32   1.6  
KLLA0B09966g complement(872760..873872) similar to sp|P33313 Sac...    32   2.7  
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...    31   3.2  
Scas_666.23                                                            31   3.3  
AEL224W [2282] [Homologous to ScYOR027W (STI1) - SH] complement(...    31   4.1  
YLR127C (APC2) [3537] chr12 complement(395759..398320) Component...    31   4.2  
Scas_589.5                                                             31   5.4  
Sklu_1876.2 YOL145C, Contig c1876 732-4004                             31   5.5  
KLLA0F08459g complement(787966..790479) similar to sp|P12945 Sac...    30   6.1  
Scas_437.1                                                             30   6.6  
AFR112W [3304] [Homologous to ScYLL022C (HIF1) - SH] complement(...    30   7.3  
Kwal_33.15281                                                          30   8.4  
Kwal_55.22152                                                          30   9.6  

>Scas_685.10
          Length = 760

 Score = 1517 bits (3928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/760 (96%), Positives = 735/760 (96%)

Query: 1   MRNPTSPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRT 60
           MRNPTSPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRT
Sbjct: 1   MRNPTSPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRT 60

Query: 61  VSGQSPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTXXXXXXXXXXXXXXXKGNV 120
           VSGQSPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPT               KGNV
Sbjct: 61  VSGQSPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTNLNANPNSSLLASLSKGNV 120

Query: 121 FGSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKAXXXXXXXXXXIVSPEIDLSELTS 180
           FGSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKA          IVSPEIDLSELTS
Sbjct: 121 FGSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKATTTTLTTNTTIVSPEIDLSELTS 180

Query: 181 IERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKD 240
           IERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKD
Sbjct: 181 IERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKD 240

Query: 241 NLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLC 300
           NLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLC
Sbjct: 241 NLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLC 300

Query: 301 YLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTL 360
           YLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTL
Sbjct: 301 YLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTL 360

Query: 361 GDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSEC 420
           GDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSEC
Sbjct: 361 GDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSEC 420

Query: 421 LEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYM 480
           LEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYM
Sbjct: 421 LEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYM 480

Query: 481 AIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPN 540
           AIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPN
Sbjct: 481 AIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPN 540

Query: 541 LFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEA 600
           LFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEA
Sbjct: 541 LFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEA 600

Query: 601 VRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTK 660
           VRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTK
Sbjct: 601 VRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTK 660

Query: 661 RLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQ 720
           RLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQ
Sbjct: 661 RLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQ 720

Query: 721 KKRGNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760
           KKRGNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE
Sbjct: 721 KKRGNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/792 (52%), Positives = 562/792 (70%), Gaps = 81/792 (10%)

Query: 1   MRNPTSPNQTPSQHNSTIAISPFVGN----RTRSRLPTHRIHPATNAQRENPLSNQLNQS 56
           MRNP SP++  SQHNST+A SPFV N    RT+  LPT       +AQ     +++L Q 
Sbjct: 39  MRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPT-------DAQ-----NDRLQQP 86

Query: 57  WNRTVSGQSPYRSLANSPLVQKTNPSIITASLTTPHQKN----------TGTIPTXXXXX 106
           WNRT +  SPY+SLANSPL+QK     + A++ TPHQ +          TG +       
Sbjct: 87  WNRTNTATSPYQSLANSPLIQK-----LQANIMTPHQPSANSNSNSNSITGNV------V 135

Query: 107 XXXXXXXXXXKGNVFGSTISSSLRKVSIQPN-SNIPETNTKDENMSNEINKAXXXXXXXX 165
                     K ++FGSTI S+LRKVS+Q    +  +   +DE+   +++          
Sbjct: 136 NDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANAN 195

Query: 166 XXIVSP-------------------EIDLSELTSIERLRLWRHDALMQHMYRTAEYIGNK 206
               S                    ++D+SEL++IERLRLWR DALMQHMYRTAEYI +K
Sbjct: 196 NDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADK 255

Query: 207 IYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLESLNIICRYLMGLCLFKLQRYDDA 266
           +Y I+ DP+DAFWL QVYYNNN+++RA++L+T++NL+ +NI+CRYL+GL   KLQR+DDA
Sbjct: 256 VYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDA 315

Query: 267 LDVVDELNPFSDSKQDSDPTIA----------------PDGGIKVESSLCYLRGLIFAAQ 310
           LDV+ E NPFS   +D   T A                 DGGIK+ESSLC+LRG I+ AQ
Sbjct: 316 LDVIGEYNPFS---EDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQ 372

Query: 311 NNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNEEMIRYL 370
           NN  KA+ AF+EA+LVD+KN+EAFE L+SKNL++P+EEWDL  SLDF   G+++E+++ L
Sbjct: 373 NNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNL 432

Query: 371 YTLNVSKYIH-QDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEACEKALD 429
           Y +N+SKYI+ +D++K+  + L+ +Y L++N+D++R +++  Y+QCKF+ECLE CE  L+
Sbjct: 433 YKINLSKYINTEDITKS-NEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLE 491

Query: 430 GDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKAR 489
            DE+N  ILP YI CLYE + KNKLFLLSH LAE FPKSAITWFSVATYYM+++ + +A+
Sbjct: 492 NDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQ 551

Query: 490 KYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMA 549
           KY+SK+SILDPSF+AAWLGFAHTY LEGE DQAL+AY+TA+RFFPG+H+P LFLGM++MA
Sbjct: 552 KYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMA 611

Query: 550 TNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTST 609
            N+L+LAE YF LAYD C  DPL+LNEMGVMYFKKNE  K+K+YLKKALE V++   +S 
Sbjct: 612 MNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSR 671

Query: 610 IVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYL 669
             ISIQ+NL HTYRKL E E AIKCF+ VLE+  K++E++C+LG+LYLKTK+L KAID+L
Sbjct: 672 TTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHL 731

Query: 670 HESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSN-NEDKL-IQKKRGNIS 727
           H+SL LKP+N+SA  LL +ALELN ++ LD +HPL+  + L S  ++DK  + KKR ++ 
Sbjct: 732 HKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSL- 790

Query: 728 STEAASMSKKMK 739
           + +  +M+K+++
Sbjct: 791 TYDPVNMAKRLR 802

>Kwal_14.874
          Length = 722

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/762 (51%), Positives = 520/762 (68%), Gaps = 48/762 (6%)

Query: 6   SPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRTVSG-- 63
           S   TPSQHNST+AISP VG+RT  + P HR              NQ N S  R  SG  
Sbjct: 2   SRGNTPSQHNSTLAISPLVGSRTL-QGPQHR--------------NQTNASSTRQWSGEH 46

Query: 64  ---QSPYRSLANSPLVQK--TNPSIITASLTTPHQKNTGTIPTXXXXXXXXXXXXXXXKG 118
              Q+P+ S+  SPLVQK   N S+ T +    H    G + +               K 
Sbjct: 47  RTAQTPHHSVTYSPLVQKIQNNASLATPAPVQDHGSTAGLLASMT-------------KN 93

Query: 119 NVFGSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKAXXXXXXXXXXIVSPEIDLSEL 178
            +FG  I S+LRKVSI     + ++     + S                 V   ID+++L
Sbjct: 94  GLFGPQIPSTLRKVSI-----VGDSRRHPGSSSGAGGDITDPNAQLDSDHVISAIDIAQL 148

Query: 179 TSIERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLT 238
            + E+LRLWRHD+LMQH YRTAE++G+K+Y +T DPNDAFWLAQVYYN+  +IRA++LL+
Sbjct: 149 PAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLS 208

Query: 239 KDNLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESS 298
           ++NL++ +++CRYL  LCL +L++Y+DALD+V E NPF D           DGGIK+ESS
Sbjct: 209 RNNLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPFRDPL--GSHVKNQDGGIKLESS 266

Query: 299 LCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFS 358
           +CYLRG IF+A N+  KAK + KEAVLVDVKN+EAF+ LISKNL++P EEW  + SLDF+
Sbjct: 267 MCYLRGKIFSALNDFDKAKDSLKEAVLVDVKNFEAFDELISKNLLTPSEEWAFIASLDFT 326

Query: 359 TLGDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFS 418
            L DNE++IR LY   +SKY++ D    A   L++EY LS+N D++  + +TL++QCKFS
Sbjct: 327 DLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFS 386

Query: 419 ECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATY 478
           +CL+ CE+AL+ DE+N +ILP +ISCLYE  GKNKLFL+SH +AE FPK  ITWF V  Y
Sbjct: 387 DCLKLCEEALEKDEFNFSILPIFISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAY 446

Query: 479 YMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHV 538
           YM    V +ARKYFSKASILDPSFS AW+GFAHTY +EGEH+QA+SAY+TA+RFFPG H+
Sbjct: 447 YMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHL 506

Query: 539 PNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKAL 598
           PNLFLGM+Y+   TL LAEEYF LAYD C YDPLLLNEMGV+YFKK +  K+K+YLKKA 
Sbjct: 507 PNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAW 566

Query: 599 EAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLK 658
           EA++     S   +SI  NLAHTYRKLGE E+A+ CFKLVLE AGKD +  CALG++YL+
Sbjct: 567 EAIKALDSESKSWVSIHTNLAHTYRKLGENEKAVTCFKLVLETAGKDTDTLCALGYVYLR 626

Query: 659 TKRLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKL 718
             R+ KAID LH +LAL+PSN +AQ+LL  AL++N S +LD++HPLV++++L   N D +
Sbjct: 627 MNRIEKAIDALHGALALRPSNQAAQDLLKQALDVNMSTILDDSHPLVISSKLQDQNSDVV 686

Query: 719 IQKKRGNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760
            +K+  N    +   ++K++K     +  S DE+GD  MD+E
Sbjct: 687 SRKRAAN--RVDVRDIAKRLKHG---QESSEDEEGD-IMDLE 722

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/757 (51%), Positives = 524/757 (69%), Gaps = 39/757 (5%)

Query: 6   SPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSW-NRTVSGQ 64
           S   TPSQHNST+AISP V  RT           + + Q+ +   +Q  + W   T + Q
Sbjct: 55  STGNTPSQHNSTLAISPLVTKRT-----------SLHGQKNSQQQHQQLRRWCGATSTAQ 103

Query: 65  SPYRSLANSPLVQKT-NPSIITASLTTPHQKNTGTIPTXXXXXXXXXXXXXXXKGNVFGS 123
           +P+  + NSPL+QK  NP+    SL TP                         K  +FG 
Sbjct: 104 TPHHPVTNSPLIQKIQNPT----SLATP--------APPAGDGSTAGLLASMSKSGLFGP 151

Query: 124 TISSSLRKVSIQPNSNIPETNTKDENMSNEINKAXXXXXXXXXXIVSPEIDLSELTSIER 183
            + S+LRK+S+   S   +T+ KD++ S E++            I    ID+S L+  E+
Sbjct: 152 AVPSTLRKISVT-RSFDGQTSAKDDSNS-ELDD-------NLEVISGATIDISTLSPAEK 202

Query: 184 LRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLE 243
           LRLWRHDALMQH YRTAEYIG+K+Y+IT DPNDAFWLAQVYYNN  +IRA++LL++D L+
Sbjct: 203 LRLWRHDALMQHHYRTAEYIGDKVYSITRDPNDAFWLAQVYYNNGSYIRAVELLSRDGLD 262

Query: 244 SLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLR 303
           + +++CRYL  LCL K+++YDDALD+V E NPF D    +      DGGIK+ESSLCYLR
Sbjct: 263 TSSVMCRYLTALCLIKMEKYDDALDIVGESNPFKDVS--AQHVKNQDGGIKLESSLCYLR 320

Query: 304 GLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDN 363
           G I++AQNN +KAK +FKEAV VDVKN+EAF+ LIS NL++P +EW+ L +LDFS L DN
Sbjct: 321 GKIYSAQNNFEKAKQSFKEAVQVDVKNFEAFDELISNNLLTPNQEWEFLSTLDFSDLDDN 380

Query: 364 EEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEA 423
           EE+I+ LYT  +SKY++ D    A++ L +EY L +N D++R +I+T ++QCKFS+CL  
Sbjct: 381 EELIKSLYTTKLSKYLNLDQISEAREYLINEYNLEDNTDLIRSEIDTFFTQCKFSKCLCL 440

Query: 424 CEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIE 483
           CE+ L+ DE+N  +LPTYI+CLYE  GKNKLFL+SH LAE FPKS +TW  V TYY++I 
Sbjct: 441 CEQVLERDEFNFYVLPTYIACLYELGGKNKLFLVSHKLAENFPKSPVTWLGVGTYYLSIN 500

Query: 484 DVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFL 543
            V +ARKYFSKASILDP+F  AW+GFAHTY  EGEH+QA+SAY+TA+RFFPG H+PNLFL
Sbjct: 501 KVAEARKYFSKASILDPNFGQAWIGFAHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFL 560

Query: 544 GMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRN 603
           GM+Y+  NTLSLAEEY TLAYD C +DPLLLNEMGV+YFKK++  K+K+Y KKA EA + 
Sbjct: 561 GMQYIVMNTLSLAEEYLTLAYDICPHDPLLLNEMGVIYFKKSDYPKAKKYFKKAWEASKR 620

Query: 604 SSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLG 663
            +  S   +SI  NL HTYRK+G+YERA+ CFK+VLE + +D  VYCA+G +YLK +++ 
Sbjct: 621 LNSDSKAWLSIHTNLGHTYRKMGDYERAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIE 680

Query: 664 KAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQKKR 723
           KAID LH +LAL+PSN  AQ+LL  ALE+N   VLDE HPLV+++++  +  +     K+
Sbjct: 681 KAIDSLHNALALQPSNQIAQDLLKQALEVNMCTVLDETHPLVVSSKINESASNYFPNSKK 740

Query: 724 GNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760
            ++ +  AA ++K++    D    S DE  D+ MDIE
Sbjct: 741 RDLVNQSAAKIAKRLIQGQDS---SDDEAQDDVMDIE 774

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/762 (49%), Positives = 500/762 (65%), Gaps = 63/762 (8%)

Query: 6   SPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIH-PATNAQRENPLSNQLNQSWNRTVSGQ 64
           S   TPSQH ST+AISPFV NR RS+    R+  P+T         + L  S        
Sbjct: 2   STGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTG-------EDSLGPSGMADSGTH 54

Query: 65  SPYRSLANSPLVQKTNPSIITASLTTPHQKN---TGTIPTXXXXXXXXXXXXXXXKGNVF 121
           +P  S+ +SPLVQKT        L TP+      TG +                 K  +F
Sbjct: 55  TPRNSVVHSPLVQKTQ-------LGTPYMAEGAATGGL------------LGSMSKTALF 95

Query: 122 GSTISSSLRKVSIQPNSNIPETNTKDENMSNEINKAXXXXXXXXXXIVSPEIDLSELTSI 181
           G  + S+LRKVS     N+ E     ++                       +DL+EL++ 
Sbjct: 96  GPAVPSTLRKVS-----NVREYRRPGDSDGEGGEGYG--------------VDLAELSAA 136

Query: 182 ERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDN 241
           E+LRLWRHDALMQH YRTAEYIG+K+Y++T DPNDAFWLAQVYYN  ++IRA++LL++D 
Sbjct: 137 EKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQYIRAVELLSRDG 196

Query: 242 LESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCY 301
           L++ +++CRYL  LCL K+++YDDALD+V E+NPF D   +    +  DGGIK+ESSLCY
Sbjct: 197 LDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVRNL--DGGIKLESSLCY 254

Query: 302 LRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLG 361
           LRG I++AQNNL  AK  FKEAV VDVKN+EAF+ LIS N+++P+EE + +  LDF+ L 
Sbjct: 255 LRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDEETEFIARLDFTDLD 314

Query: 362 DNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECL 421
           DN+E+IR LY+  +SKY      K A + L DEY L +N D+   +IE L  Q K+ ECL
Sbjct: 315 DNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTEIELLIFQGKYLECL 374

Query: 422 EACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMA 481
           E CEK L+ DE+N  +LPTY+ CLYE  GKNKLFL+SH LAE FPKS++TWF+V TYY +
Sbjct: 375 ELCEKVLEQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFS 434

Query: 482 IEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNL 541
           I ++ +ARKYFSKAS+LDP+F  AWLGFAHTY +EGEH+QALSAY+TAARFFPG H+P+L
Sbjct: 435 INNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHL 494

Query: 542 FLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAV 601
           +LGM+Y   +TL+LAEEYF +AYD C  DPLLLNE+GV+YFKK +  ++K++ K+A EA+
Sbjct: 495 YLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAI 554

Query: 602 R-NSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTK 660
               S  S++ IS  +NL HTYRKL E ERA+ CFK VLE     A V+CAL  +YLK K
Sbjct: 555 NMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMK 614

Query: 661 RLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQ 720
           +L KAID LH  LA++P++ + Q+LL  AL++N  + LD  HPL+++A++  N +     
Sbjct: 615 KLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKISENMKMSSND 674

Query: 721 KKR--GNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760
           KKR  GNI   +   ++K++K        S   D  + MDIE
Sbjct: 675 KKRSLGNI---DPVVIAKRLKQG------STSSDEGDSMDIE 707

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/763 (47%), Positives = 504/763 (66%), Gaps = 51/763 (6%)

Query: 5   TSPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRTVSGQ 64
           +S + TPS   ST+AISP V     +R   +R  P  N+Q  N    + N         Q
Sbjct: 2   SSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQ----IAQ 57

Query: 65  SPYRSLANSPLVQKTNPSIITASLTTPH-QKNTGTIPTXXXXXXXXXXXXXXXKGNVFGS 123
           +P++    SPLVQK       + L TP   ++ GT  +               K  +FG 
Sbjct: 58  TPHQD--RSPLVQKIRD---VSHLATPAVMRHNGTAGSSLLASMT--------KNGLFGP 104

Query: 124 TISSSLRKVSIQPNSNIPETNTKDENMSNEINKAXXXXXXXXXXIVSPEIDLSELTSIER 183
            + S+LRK S   ++     +T DE++ +  +                  D+S+L+S+E+
Sbjct: 105 ALPSTLRKTSTSTDTVELNNSTNDEDIDHASDNV---------------FDVSDLSSVEK 149

Query: 184 LRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLE 243
           LRLWRHDALMQH Y+TAE+IG+ IY++T+DPNDAFWLAQVYYN   ++RA++L+  D L+
Sbjct: 150 LRLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLD 209

Query: 244 SLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLR 303
           S +I+CRYL  LCLFKL + ++ALD++ + NPF    + S P  A DGG+K+ESS+C LR
Sbjct: 210 SESIMCRYLAALCLFKLNKLEEALDIIGDTNPFQ--SEPSSPGNA-DGGVKLESSMCLLR 266

Query: 304 GLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDN 363
           G I+ + +N+++AK  FKEAV VDVKNYEAF+ L+SK++++  E+WDL+ SL F  L DN
Sbjct: 267 GRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDN 326

Query: 364 EEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEA 423
           EEM+R LY   +SKY HQ   + A++ LSD+Y L +N  +L  +IE L +Q KF++C++ 
Sbjct: 327 EEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKL 386

Query: 424 CEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIE 483
           CE+ L+ DEYN  +LP YI CL+    KNKLFLLSH LAE FPKS +TWF+VATYY+ + 
Sbjct: 387 CEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMG 446

Query: 484 DVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFL 543
            V +ARKYFS++SI+DPSF  +WLGFAHTY  EGEH+QALSAY+TAARFFPG H+P+L+L
Sbjct: 447 KVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYL 506

Query: 544 GMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRN 603
           GM+Y   + LSLAEEYF +AYD C  DPLLLNE+GV+YFK+    K+K+Y+K+A +A++N
Sbjct: 507 GMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKN 566

Query: 604 SSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLG 663
               S   ISI +NL HTYRKLGE ERAIKCFK VLE +   A ++C+LGFLYL+ K++ 
Sbjct: 567 MKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIE 626

Query: 664 KAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAEL------YSNNEDK 717
           KAID  H++LAL   N ++ +LL  ALE+NA +++DENHP+V+++ +      + +  DK
Sbjct: 627 KAIDSFHKALALDQGNQASNKLLKTALEINAHMIIDENHPMVISSNIQNIPTSHVSKNDK 686

Query: 718 LIQKKRGNISSTEAASMSKKMKMNGDMRRLSPDEDGDEEMDIE 760
             ++    I+S +  + +K++K          D +GD  MDIE
Sbjct: 687 --KRTSLGITSFDPVTEAKRLKQG------ISDHEGD-SMDIE 720

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/594 (54%), Positives = 441/594 (74%), Gaps = 10/594 (1%)

Query: 170 SPEIDLSELTSIERLRLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNE 229
           S EID++++  IERL+LWRHDA +QH+Y TAE++  KIYT+T D NDAFWLA +YY+   
Sbjct: 157 SNEIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGS 216

Query: 230 FIRAIDLLTKDNLESLNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAP 289
             R I+LLTKD++ S++I+CRYL+  C   ++ YDDALD+V E NPF+D+ + S   I  
Sbjct: 217 HNRCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEAS-ARIES 275

Query: 290 DGGIKVESSLCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEW 349
           DGGIK+ESS+C+LRG I+ AQN+  +AK AFKEAVLVD KN+EA+  L+  +L++  EEW
Sbjct: 276 DGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEW 335

Query: 350 DLLLSLDFSTLGDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIE 409
           +LL SLDF +LGD+  +++ LYTL +SK  +QD    A+  L  +Y L+++IDI+   I+
Sbjct: 336 ELLDSLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLADDIDIVTSDID 395

Query: 410 TLYSQCKFSECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSA 469
            L++QCKFS+CL  CE  L  D++N  ILPTYISCLYE    NKLFLL+H LAEK P++ 
Sbjct: 396 ILFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNC 455

Query: 470 ITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATA 529
           ITW+ VATYYM ++ +P+ARKYFSK+SI+DP+F+ AWLGFAHT+ LEGE DQA+SAY+TA
Sbjct: 456 ITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTA 515

Query: 530 ARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEK 589
           ARFFPG+ +PNLFLGM+YMA+NTL+LAEEYF+LAY++   DP++LNE+GV+ FKK EL K
Sbjct: 516 ARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHK 575

Query: 590 SKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVY 649
           +KRYLKKA E  ++   +S  V+S+Q+NL+HTYR+LGE E+AIK    +LE+    +E+Y
Sbjct: 576 AKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIY 635

Query: 650 CALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAE 709
           C+LGFLYLKT +L KAID LH  LA+ P N+SAQ+LL +ALELN ++ LDENHPLV+N+ 
Sbjct: 636 CSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENHPLVVNSN 695

Query: 710 LYSNNED-KLIQKKRGNISSTEAASMSKKMKMNGDM--RRLSPDEDGDEEMDIE 760
           +         I K+R      E+ ++ KK    G +  + LSP     E MDIE
Sbjct: 696 ILDEEHSASKIGKRR---QPFESINVDKKRNKAGQLTEQSLSP---AGEAMDIE 743

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 59  RTVSGQSPYRS-LANSPLVQKTNPSIITASLTTPHQKNTGTIPTXXXXXXXXXXXXXXXK 117
           R VS     RS L  SPLVQK       ASL TP +       +               K
Sbjct: 15  RVVSPVGAARSPLLTSPLVQK----YAGASLATPRKH---LGASNSNNGNNGSLLASMSK 67

Query: 118 GNVFGSTISSSLRKVSIQ 135
            ++ GSTI S+LRKVS+Q
Sbjct: 68  NSMLGSTIPSTLRKVSLQ 85

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 109/250 (43%), Gaps = 14/250 (5%)

Query: 442 ISCLYEQNGKNKLFLLSHNLAEKF-PKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500
           I+ L E  G      ++++   +F P SA    S+A  Y + +   +A + + +A +++P
Sbjct: 52  IASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNP 111

Query: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF--LGMEYMATNTLSLAEE 558
             S  W    H Y +  +  +A +AY  A       +VP L+  +G+ Y    +L  AEE
Sbjct: 112 ELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEE 171

Query: 559 YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVIS---IQ 615
            F         DP    +   +YF+   + K +    +ALE  R         +    I 
Sbjct: 172 AFA---KVLELDP-HFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIW 227

Query: 616 MNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLY----LKTKRLGKAIDYLHE 671
             L      +GE++ A + ++ VL +    A+V   LG LY    ++     KA+DYL +
Sbjct: 228 FQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLK 287

Query: 672 SLALKPSNTS 681
           SL   PS+ +
Sbjct: 288 SLEADPSDAT 297

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 86/220 (39%), Gaps = 25/220 (11%)

Query: 472 WFSVATYYMAIEDVPKARKYFSKASILDPSFSAA---WLGFAHTYGLEGEHDQALSAYAT 528
           W  +   Y     +  A + F+K   LDP F  A   +      Y  +G+  QAL  +  
Sbjct: 153 WHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECF-- 210

Query: 529 AARF-FPGIHVP----NLF--LGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMY 581
             R+  P    P    +++  LG    +      A+E +       ++   +L ++G +Y
Sbjct: 211 --RYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLY 268

Query: 582 FKKN----ELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKL 637
              N    + +K+  YL K+LEA       S       +   H  R   +Y  A   F+ 
Sbjct: 269 GMSNVQFYDPQKALDYLLKSLEA-----DPSDATTWYHLGRVHMIRT--DYTAAYDAFQQ 321

Query: 638 VLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
            +    ++   +C++G LY +  +   A+D    ++ L P
Sbjct: 322 AVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 361

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 29/143 (20%)

Query: 213 DPNDA---FWLAQVYYNNNEFIRAIDLLTKD-NLESLNIICRYLMGLCLFKLQRYDDALD 268
           DP+DA   + L +V+    ++  A D   +  N +S N I    +G+  +++ +Y DALD
Sbjct: 292 DPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 351

Query: 269 VVDE---LNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNN-LKKAKTAFKEAV 324
                  LNP+                    S + Y  G ++   NN L  A  A+K+A 
Sbjct: 352 AYTRAIRLNPYI-------------------SEVWYDLGTLYETCNNQLSDALDAYKQAA 392

Query: 325 LVDVKNYEAFESL--ISKNLISP 345
            +DV N    E L  ++K L +P
Sbjct: 393 RLDVNNVHIRERLEALTKQLENP 415

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 75/195 (38%), Gaps = 27/195 (13%)

Query: 498 LDP---SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLS 554
           LDP   S +  WL  A      G+ D+A  AY    +F P        L   Y + +   
Sbjct: 38  LDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQ 97

Query: 555 LAEEYFTLAYDTCRYDPLLLNE--------MGVMYFKKNELEKSKRYLKKALEAVRNSSG 606
            A E +  A        LL+N         +G  Y   ++L+++    ++AL  + N + 
Sbjct: 98  RAAELYERA--------LLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPN- 148

Query: 607 TSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLE---EAGKDAEVYCALGFLYLKTKRLG 663
               V  +   +   Y + G  + A + F  VLE      K  E+Y  LG +Y    +  
Sbjct: 149 ----VPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWS 204

Query: 664 KAIDYLHESLALKPS 678
           +A++     L   P+
Sbjct: 205 QALECFRYILPQPPA 219

>Scas_599.5
          Length = 809

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 109/251 (43%), Gaps = 23/251 (9%)

Query: 438 LPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASI 497
           L T+ + L+  + K  L  LS+ L ++F     TW +V   +   +D  +A + F KA+ 
Sbjct: 559 LETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATK 618

Query: 498 LDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFP-----GIHVPNLFLGMEYMATNT 552
           LDP+       F + Y L+G    ++ +Y TA  F+       +H  N + GM  M +  
Sbjct: 619 LDPN-------FVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMG-MCSMK 670

Query: 553 LSLAEE---YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTST 609
           L   E+   YF  A      + +L+   GV   K    EK+  Y + A +    SS    
Sbjct: 671 LGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLA-- 728

Query: 610 IVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYL 669
                +   AH    + +Y +A+  F+ +++ A ++A V   LG LY    R   AI   
Sbjct: 729 -----KFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAIKRY 783

Query: 670 HESLALKPSNT 680
             ++ L P  +
Sbjct: 784 TIAMNLDPKGS 794

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 68/185 (36%), Gaps = 41/185 (22%)

Query: 506 WLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYD 565
           W    + + L+ +HD+A+ A+  A +  P         G EY++ ++   A+ ++  A  
Sbjct: 593 WCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAIS 652

Query: 566 TCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKL 625
                              N+L     Y    + ++                      KL
Sbjct: 653 -------------------NDLHHYNAYYGMGMCSM----------------------KL 671

Query: 626 GEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQEL 685
           GEYE+A+  F+        +A + C  G    K     KA++Y   +  ++P+++ A+  
Sbjct: 672 GEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFK 731

Query: 686 LLHAL 690
             H L
Sbjct: 732 RAHLL 736

>Scas_705.55
          Length = 907

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 442 ISCLYEQNGKNKLFLLSHNLAEKF-PKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500
           I+ L E  G      ++++   +F P+S     S+A  Y + +   +A + + +A  ++P
Sbjct: 62  IASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERALSINP 121

Query: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF--LGMEYMATNTLSLAEE 558
             S  W    H Y +  +  +A ++Y  A       +VP L+  +G+ Y    +L  AEE
Sbjct: 122 ELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEE 181

Query: 559 YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVR---NSSGTSTIVISIQ 615
            F         DP    +   +YF+   + K +    +ALE  R   N          I 
Sbjct: 182 AFA---KVLELDP-QFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPAPLQEWDIW 237

Query: 616 MNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLY----LKTKRLGKAIDYLHE 671
             L      + E++ A + ++ VL +    A+V   LG LY    +      KA++YL +
Sbjct: 238 FQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLK 297

Query: 672 SLALKPSNTS 681
           SL + P++++
Sbjct: 298 SLEVDPNDST 307

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 83/216 (38%), Gaps = 17/216 (7%)

Query: 472 WFSVATYYMAIEDVPKARKYFSKASILDPSFSAA---WLGFAHTYGLEGEHDQALSAYAT 528
           W  +   Y     +  A + F+K   LDP F  A   +      Y  +G+  QAL  +  
Sbjct: 163 WHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRY 222

Query: 529 AARFFPG-IHVPNLF--LGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKN 585
                P  +   +++  LG    + N    A E +            +L ++G +Y   N
Sbjct: 223 ILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNN 282

Query: 586 ----ELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEE 641
               + +K+  YL K+LE   N S T         +L   +    +Y  A   F+  +  
Sbjct: 283 VSFYDPQKALNYLLKSLEVDPNDSTT-------WYHLGRVHMIRNDYTAAYDAFQQAVNR 335

Query: 642 AGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
             ++   +C++G LY +  +   A+D    ++ L P
Sbjct: 336 DSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 371

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 27/126 (21%)

Query: 213 DPNDA---FWLAQVYYNNNEFIRAIDLLTKD-NLESLNIICRYLMGLCLFKLQRYDDALD 268
           DPND+   + L +V+   N++  A D   +  N +S N I    +G+  +++ +Y DALD
Sbjct: 302 DPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 361

Query: 269 VVD---ELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNN-LKKAKTAFKEAV 324
                  LNP+                    S + Y  G ++   NN L  A  A+K+A 
Sbjct: 362 AYTRAIRLNPYI-------------------SEVWYDLGTLYETCNNQLNDALDAYKQAA 402

Query: 325 LVDVKN 330
            +D +N
Sbjct: 403 RLDPEN 408

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 2/74 (2%)

Query: 467 KSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTY-GLEGEHDQALSA 525
           ++ I W S+   Y  I     A   +++A  L+P  S  W      Y     + + AL A
Sbjct: 338 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDA 397

Query: 526 YATAARFFP-GIHV 538
           Y  AAR  P  +H+
Sbjct: 398 YKQAARLDPENVHI 411

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 102/254 (40%), Gaps = 10/254 (3%)

Query: 438 LPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASI 497
           +  Y + L+  + K +L  L H L  +  K+ ITW  +   +    D  +A K   KA+ 
Sbjct: 407 MDVYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKATS 466

Query: 498 LDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLSLAE 557
           L+P F+ A+    H Y      D A   Y  A    P  +  +  LGM  +       A 
Sbjct: 467 LNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEAL 526

Query: 558 EYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMN 617
            +F  A      + +L    GV   +    EK+  + + A E   NSS        +  N
Sbjct: 527 LHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFN 586

Query: 618 LAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
                  LG+Y  A++ F+ + +    +A V+  LG LY    R   AI     ++ L P
Sbjct: 587 -------LGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDP 639

Query: 678 SNTSAQELLLHALE 691
           +     +L+  ALE
Sbjct: 640 NGI---QLVKEALE 650

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 90/211 (42%), Gaps = 20/211 (9%)

Query: 487 KARKYFSKASIL-------DPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVP 539
           ++R  F KA+ L       +P  S  W    H Y +  +  +A +AY  A       +VP
Sbjct: 93  RSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVP 152

Query: 540 NLF--LGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKA 597
            L+  +G+ Y    +L  AEE F         DP    +   +YF+   + K +    +A
Sbjct: 153 KLWHGIGILYDRYGSLDYAEEAFA---KVLELDP-HFEKANEIYFRLGIIYKHQGKWSQA 208

Query: 598 LEAVR---NSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGF 654
           LE  R       T      I   L      +GE++ A + ++ VL +    A+V+  LG 
Sbjct: 209 LECFRYILAQPPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGC 268

Query: 655 LY----LKTKRLGKAIDYLHESLALKPSNTS 681
           LY    ++     KA+ YL +SL + PS+ +
Sbjct: 269 LYGMNNVQFYDPQKALSYLLKSLEVDPSDAT 299

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 96/258 (37%), Gaps = 53/258 (20%)

Query: 466 PKSAITWFSVATYYMAIEDVPKARKYFSKA--SILDPSFSAAWLGFAHTYGLEGEHDQAL 523
           P+ +  W ++   Y+ ++D+ +A   + +A   + +P+    W G    Y   G  D A 
Sbjct: 113 PELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAE 172

Query: 524 SAYATAARFFPGIHVPN---LFLGMEYMATNTLSLAEE------------------YFTL 562
            A+A      P     N     LG+ Y      S A E                  +F L
Sbjct: 173 EAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILAQPPTPLQEWDIWFQL 232

Query: 563 A--------YDTCR--YDPLLLN---------EMGVMYFKKN----ELEKSKRYLKKALE 599
                    +   R  Y+ +LL          ++G +Y   N    + +K+  YL K+LE
Sbjct: 233 GSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGCLYGMNNVQFYDPQKALSYLLKSLE 292

Query: 600 AVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKT 659
            V  S  T+       +   H  R   +Y  A   F+  +    ++   +C++G LY + 
Sbjct: 293 -VDPSDATTWY----HLGRVHMIR--SDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 345

Query: 660 KRLGKAIDYLHESLALKP 677
            +   A+D    ++ L P
Sbjct: 346 SQYRDALDAYTRAIRLNP 363

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 27/126 (21%)

Query: 213 DPNDA---FWLAQVYYNNNEFIRAIDLLTKD-NLESLNIICRYLMGLCLFKLQRYDDALD 268
           DP+DA   + L +V+   +++  A D   +  N +S N I    +G+  +++ +Y DALD
Sbjct: 294 DPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 353

Query: 269 VVD---ELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNN-LKKAKTAFKEAV 324
                  LNP+                    S + Y  G ++   NN L  A  A+K+A 
Sbjct: 354 AYTRAIRLNPYI-------------------SEVWYDLGTLYETCNNQLSDALDAYKQAA 394

Query: 325 LVDVKN 330
            +D +N
Sbjct: 395 RLDPEN 400

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 2/74 (2%)

Query: 467 KSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTY-GLEGEHDQALSA 525
           ++ I W S+   Y  I     A   +++A  L+P  S  W      Y     +   AL A
Sbjct: 330 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 389

Query: 526 YATAARFFP-GIHV 538
           Y  AAR  P  IH+
Sbjct: 390 YKQAARLDPENIHI 403

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 107/446 (23%), Positives = 173/446 (38%), Gaps = 40/446 (8%)

Query: 264 DDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNNLKKAKTAFKEA 323
           +D   V + LN      +D      P   +   + L YLRG++    N+   A  A+  +
Sbjct: 196 NDQSGVTEILNELDQYLEDVQSHKVPKNSLGY-ALLFYLRGILLKESNSKSMAIRAYLRS 254

Query: 324 VLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLG-DNEEMIRYLYTL--NVSKYIH 380
           + +   NY  +  L+    I+  EE  +LLS   S    +N E I     L  N+   I 
Sbjct: 255 LRIYSFNYSCWSDLLE--CITTVEESQMLLSHFMSNFQFENLENINSQSKLESNIPFKIF 312

Query: 381 QDVSKTAKQSLSDEY--------GLSNNIDILRYQIE-TLYSQCKFSECLEACEKALDGD 431
           Q +     Q   DEY         L  N   L+ Q   T Y    +    +  EK ++ D
Sbjct: 313 QLLLFKEFQGNVDEYLTTFEDLLTLFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDD 372

Query: 432 EYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKY 491
            Y    + T+ + LY      KL  L+  +++       T   +A YY A ++  K+  Y
Sbjct: 373 PYRLDDMDTFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYYSARQEHEKSIMY 432

Query: 492 FSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATN 551
           F +A  LD   ++AW    H +      + A+ +Y  A    P        LG  Y   +
Sbjct: 433 FRRALTLDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLD 492

Query: 552 TLSLAEEYFTLAYDTCRYDPL---LLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTS 608
               +  YF  A   C   PL   +   +G  Y K     ++ +  ++AL+    S   +
Sbjct: 493 MHLYSLYYFQRA---CILKPLDKRMWQALGSCYAKVGNHAEAIKCYERALQLTTQSEQDT 549

Query: 609 TIVISIQMNLAHT---------YRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKT 659
            ++  + +    T           K  E ER  +   LV +E+ K A ++  L    LKT
Sbjct: 550 ALLYKLALLFEQTNGIDKCKLLMEKCVEIERITE--GLVTDESVK-ARLW--LAKFELKT 604

Query: 660 KRLGKAIDYLHESLALKPSNTSAQEL 685
               KA D     LA+  SN ++QE+
Sbjct: 605 NNYVKAYD-----LAVGVSNGTSQEM 625

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 93/221 (42%), Gaps = 10/221 (4%)

Query: 442 ISCLYEQNGKNKLFLLSHNLAEKF-PKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500
           I+ L E  G      ++++   ++ P S     S+A  Y + +   +A + + +A  ++P
Sbjct: 68  IASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNP 127

Query: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF--LGMEYMATNTLSLAEE 558
                W    H Y +  +  +A +AY  A       +VP L+  +G+ Y    +L  AEE
Sbjct: 128 ELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEE 187

Query: 559 YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVIS---IQ 615
            F         DP    ++  +YF+   + K +    +ALE  R         +    + 
Sbjct: 188 AFA---KVLELDP-HFEKVNEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVW 243

Query: 616 MNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLY 656
             L      +GE++ A + ++ VL +  + A+V   LG LY
Sbjct: 244 FQLGSVLESMGEWQGAREAYEHVLSQNDRHAKVLQQLGCLY 284

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 82/220 (37%), Gaps = 25/220 (11%)

Query: 472 WFSVATYYMAIEDVPKARKYFSKASILDPSFSAA---WLGFAHTYGLEGEHDQALSAYAT 528
           W  +   Y     +  A + F+K   LDP F      +      Y  +G+ +QAL  +  
Sbjct: 169 WHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECF-- 226

Query: 529 AARF-FPGIHVP------NLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMY 581
             R+  P    P         LG    +      A E +            +L ++G +Y
Sbjct: 227 --RYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRHAKVLQQLGCLY 284

Query: 582 FKKN----ELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKL 637
              N    + + +   L K+LEA  +S+  +T       +L   +    +Y  A   F+ 
Sbjct: 285 GMNNVQFYDPQTALNLLLKSLEA--DSTDATTW-----YHLGRIHMVRNDYTAAYDAFQQ 337

Query: 638 VLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
            +    ++   +C++G LY +  +   A+D    ++ L P
Sbjct: 338 AVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNP 377

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 10/221 (4%)

Query: 442 ISCLYEQNGKNKLFLLSHNLA-EKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500
           I+ L E  G   L  ++++   +  P S     S+A  Y + +   +A + + +A   +P
Sbjct: 114 IASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRDMFQRAAELYQRALSANP 173

Query: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF--LGMEYMATNTLSLAEE 558
                W    H Y +  E   A +AY  A       ++P L+  +G+ Y    +L  AEE
Sbjct: 174 ELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEE 233

Query: 559 YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVIS---IQ 615
            F         DP    +   +YF+   + K +    +ALE  R         +    + 
Sbjct: 234 AFA---KVLELDP-QFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVW 289

Query: 616 MNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLY 656
             L      +GE++ A   ++ ++ +  + A+V   LG LY
Sbjct: 290 FQLGSVLESMGEWQGARDAYEHIISQNDRHAKVLQQLGCLY 330

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 83/220 (37%), Gaps = 25/220 (11%)

Query: 472 WFSVATYYMAIEDVPKARKYFSKASILDPSFSAA---WLGFAHTYGLEGEHDQALSAYAT 528
           W  +   Y     +  A + F+K   LDP F  A   +      Y  +G+ +QAL  +  
Sbjct: 215 WHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECF-- 272

Query: 529 AARF-FPGIHVP------NLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMY 581
             R+  P    P         LG    +      A + +            +L ++G +Y
Sbjct: 273 --RYILPQPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHIISQNDRHAKVLQQLGCLY 330

Query: 582 FKKN----ELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKL 637
              N    + +K+   L K+LE + ++  TS        +L   +    +Y  A   F+ 
Sbjct: 331 GMNNVSFYDPQKALNLLLKSLE-IDSTDATSW------YHLGRIHMIRNDYTSAYDAFQQ 383

Query: 638 VLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
            +    ++   +C++G LY +  +   A+D    ++ L P
Sbjct: 384 AVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNP 423

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%)

Query: 472 WFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTY-GLEGEHDQALSAYATAA 530
           W S+   Y  I     A   +++A  L+P  S  W      Y     + + AL AY  AA
Sbjct: 395 WCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAA 454

Query: 531 RFFP-GIHV 538
           R  P  +H+
Sbjct: 455 RLDPNNVHI 463

>Kwal_23.3670
          Length = 802

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 90/221 (40%), Gaps = 10/221 (4%)

Query: 442 ISCLYEQNGKNKLFLLSHNLAEKF-PKSAITWFSVATYYMAIEDVPKARKYFSKASILDP 500
           I+ L E  G      ++++   ++ P S     S+A  Y + +   +A + + +A  ++P
Sbjct: 72  IASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNP 131

Query: 501 SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF--LGMEYMATNTLSLAEE 558
                W    H Y +  +  +A +AY  A       +VP L+  +G+ Y    +L  AEE
Sbjct: 132 ELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEE 191

Query: 559 YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVR---NSSGTSTIVISIQ 615
            F         DP    +   +YF+   + K +    +ALE  R              + 
Sbjct: 192 AFA---KVLELDP-QFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPAPLQEWDVW 247

Query: 616 MNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLY 656
             L      + E++ A + ++ VL +  + A+V   LG LY
Sbjct: 248 FQLGSVLESMSEWQGAREAYEHVLLQNERHAKVLQQLGCLY 288

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 78/195 (40%), Gaps = 17/195 (8%)

Query: 468 SAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYA 527
           +A TW S+A+    + D  +A   +      +PS + A    AH Y       +A   Y 
Sbjct: 65  TAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQ 124

Query: 528 TAARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYD------PLLLNEMGVMY 581
            A    P +      LG  Y+  + L  A      AY    Y       P L + +G++Y
Sbjct: 125 RALTVNPELGDIWATLGHCYLMLDDLQRA----YAAYQQALYHLSNPNVPKLWHGIGILY 180

Query: 582 FKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEE 641
            +   L+ ++    K LE        + I       L   Y+  G++ +A++CF+ +L +
Sbjct: 181 DRYGSLDYAEEAFAKVLELDPQFEKANEIYF----RLGIIYKHQGKWNQALECFRYILTQ 236

Query: 642 AG---KDAEVYCALG 653
                ++ +V+  LG
Sbjct: 237 PPAPLQEWDVWFQLG 251

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 73/187 (39%), Gaps = 11/187 (5%)

Query: 498 LDP---SFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLS 554
           +DP   S +  WL  A      G+ D+A  AY    ++ P        L   Y + +   
Sbjct: 58  VDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQ 117

Query: 555 LAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISI 614
            A E +  A         +   +G  Y   ++L+++    ++AL  + N +     V  +
Sbjct: 118 RAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPN-----VPKL 172

Query: 615 QMNLAHTYRKLGEYERAIKCFKLVLE---EAGKDAEVYCALGFLYLKTKRLGKAIDYLHE 671
              +   Y + G  + A + F  VLE   +  K  E+Y  LG +Y    +  +A++    
Sbjct: 173 WHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRY 232

Query: 672 SLALKPS 678
            L   P+
Sbjct: 233 ILTQPPA 239

>Scas_680.35
          Length = 631

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 84/374 (22%), Positives = 154/374 (41%), Gaps = 44/374 (11%)

Query: 303 RGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSL---DFST 359
           +G++    NN  +A  AF +++     N+  +  L+  + ++  +E  LLL+     F+ 
Sbjct: 222 KGILLQNDNNKSQAMGAFLKSLSYYSFNWSCWVELL--DCVTRADESMLLLTHINDKFTL 279

Query: 360 LGDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETL-------- 411
           + D++E   Y  T N+ +Y    ++K  K ++S +  L+ NID L   IE L        
Sbjct: 280 ISDHKEDYDY-DTQNIVQY--NVMTKFFKLAISQD--LNGNIDELMEIIEALLVIFPNFA 334

Query: 412 ----------YSQCKFSECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNL 461
                     Y    +       E+ +  D Y    L TY + LY     +KL  L+  +
Sbjct: 335 YIKAQNALVNYHYMDYVNSENLFEQVVKMDPYRLDDLDTYSNILYVMQKHSKLAYLAQFV 394

Query: 462 AEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTY-GLEGEHD 520
           A+     + T   +A YY A ++  K+  YF +A  L+   ++AW    H +  L+  H 
Sbjct: 395 AQIDKFRSETCCIMANYYSARQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSH- 453

Query: 521 QALSAYATAARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPL---LLNEM 577
            A+  Y  A             LG  Y   +    +  YF  A   C   PL   +   +
Sbjct: 454 AAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYFQKA---CTLKPLDRRMWQAL 510

Query: 578 GVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEY----ERAIK 633
           G  Y K     ++ +  ++A++   N+   +T++     NLA  Y +L +     +  I+
Sbjct: 511 GTCYTKIGNKTEAIKCFERAIQLSGNADQDTTLMY----NLAKLYDQLNDAANCKQYMIR 566

Query: 634 CFKLVLEEAGKDAE 647
           C  +  +  G+  +
Sbjct: 567 CVNMEAQMDGQQTD 580

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 113/282 (40%), Gaps = 14/282 (4%)

Query: 299 LCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSL--- 355
           L YL G+I   Q     A + F +++ +   N+  +  L+S   IS  +E  LLL     
Sbjct: 228 LMYLLGIIQKKQGVPSGAMSYFLKSLKLYPYNWTCWCELLS--CISRTDESILLLKYLND 285

Query: 356 DFSTLGDN----EEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETL 411
           +FS + +N    E ++   + L V K    D  K  ++ L +   +  N   LR Q   +
Sbjct: 286 NFSIVKENGIIHEHLMLRFFKLAVFKEFGGDFDKYIEE-LGEIMKVFPNFSFLRAQHALI 344

Query: 412 -YSQCKFSECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAI 470
            Y    ++      ++ +  D Y    L TY + LY      KL  L+   A        
Sbjct: 345 NYKYMDYANAEIVFDELVTMDPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPE 404

Query: 471 TWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAA 530
           T   +A Y+ + +   K+  YF +A +LD S++ AW+   H +        A+  Y  A+
Sbjct: 405 TCCIIANYFSSKQQHEKSILYFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRAS 464

Query: 531 RFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPL 572
              P        LG  Y   +  S A  YF  A   C   PL
Sbjct: 465 DVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKA---CALKPL 503

>Kwal_27.10740
          Length = 628

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 113/266 (42%), Gaps = 19/266 (7%)

Query: 432 EYNPTILP---TYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKA 488
           E  P  LP    + + L+  N    L  L H L E    +  TW  +   +   +D  ++
Sbjct: 370 EAQPFRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEES 429

Query: 489 RKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYM 548
            K F +++ LDPSF+ A+    H Y      D A++ Y  A          N + G+  M
Sbjct: 430 IKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA--LASNSQHYNAYYGLG-M 486

Query: 549 ATNTLSLAEE---YFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSS 605
            +  L   EE   +F  A      + +L+   GV   K +  E++ +    A E    SS
Sbjct: 487 CSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPMSS 546

Query: 606 GTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKA 665
               +    Q+ LA     +G+Y  A++ F+ +++ A  +A ++  LG LY    R   A
Sbjct: 547 --LALFKRAQLLLA-----MGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDA 599

Query: 666 IDYLHESLALKPSNTSAQELLLHALE 691
           +  L  ++ L P  +   +L+  ALE
Sbjct: 600 VKELTIAMNLDPKGS---QLIKSALE 622

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 88/227 (38%), Gaps = 10/227 (4%)

Query: 465 FPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALS 524
           +P    TW  V  Y    +D   A + F KA+ +DP F+ A+    H        D A  
Sbjct: 547 YPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKK 606

Query: 525 AYATAARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKK 584
            +  A    P  +     +G+  M       A  YF  A      + +L+   GV   K 
Sbjct: 607 CFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKL 666

Query: 585 NELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGK 644
              +K+  Y + A     NS+         +   A+    +G Y  A++ F+ + +   +
Sbjct: 667 EYQDKALEYYELACTLQPNSNLA-------RFKRANLLYAMGRYNLALQSFEELSKLTPE 719

Query: 645 DAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQELLLHALE 691
           +  V+  LG LY    R  +AI     ++ L P      +L+L ALE
Sbjct: 720 EPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDP---KGNQLILDALE 763

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 83/221 (37%), Gaps = 7/221 (3%)

Query: 457 LSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLE 516
           L++ L +  P    TW  +       +D   A K F KA+ LDP+F+ A+    H +   
Sbjct: 528 LANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSN 587

Query: 517 GEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNE 576
              D A + Y  A    P  +     LG   M       A  YF  A      + +L+  
Sbjct: 588 DSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICC 647

Query: 577 MGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFK 636
            G    K    EK+ +Y + A      SS +       +  +      +  Y  A++ F+
Sbjct: 648 CGGSLEKLGYKEKALQYYELACHLQPTSSLS-------KYKMGQLLYSMTRYNVALQTFE 700

Query: 637 LVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
            +++    DA  +  LG  Y    R   AI  L  ++ L P
Sbjct: 701 ELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDP 741

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 80/180 (44%), Gaps = 15/180 (8%)

Query: 171 PEIDLSELTSIERLRLWRHDALMQHMYRTAEYIGNKIYTITE--DPNDAFWLAQVY---- 224
           P  D   L++I +L+     A+ Q  Y TAE++   +Y      D +  +W   VY    
Sbjct: 17  PSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSILDKSSVYWSDAVYLYAL 76

Query: 225 --YNNNEFIRAIDLLTKDNLESLNIICRYLMGLCLFKL-QRYDDA-LDVVDELNPFSDSK 280
             + N  +  A  +      +  ++   Y+ G C  +L Q  ++A L ++  +N FS + 
Sbjct: 77  SLFLNKSYHTAFQI--SKEFKEYHLGIAYIFGRCALQLSQGVNEAILTLLSIINVFSSNS 134

Query: 281 QDSDPTIAPDGG---IKVESSLCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESL 337
            ++   +  +     I   ++L  L G ++   ++ K+      EA+ ++   +E++E++
Sbjct: 135 SNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEALAINPYLWESYEAI 194

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 149/387 (38%), Gaps = 41/387 (10%)

Query: 269 VVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRGLIFAAQNNLKKAKTAFKEAVLVDV 328
           ++ E+N F +S +        D G+ +   L YLRG+I   + N+ KA ++F +++    
Sbjct: 190 ILKEINTFLESYEIKIDDDEADLGLAL---LYYLRGVILKQEKNISKAMSSFLKSLSCYS 246

Query: 329 KNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNE--EMIRYLYTLNVS---------- 376
            N+  +  L+           D L  +D + L +N   +  ++ ++ N+           
Sbjct: 247 FNWSCWLELM-----------DCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIM 295

Query: 377 -KYIHQDVSKTAKQSLSDEY-------GLSNNIDILR-YQIETLYSQCKFSECLEACEKA 427
            K+    V +     L D +        +  N   L+ Y     Y+   +       +  
Sbjct: 296 IKFFKLKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDI 355

Query: 428 LDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPK 487
           +  D Y    L TY + LY     +KL  L+  +++       T   +A YY A ++  K
Sbjct: 356 VKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEK 415

Query: 488 ARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEY 547
           +  YF +A  LD   + AW    H +        A+  Y  A    P        LG  Y
Sbjct: 416 SIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAY 475

Query: 548 MATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKK-NELEKSKRYLKKALEAVRNSSG 606
              +    +  YF  A     +D  +   +G  Y K  N++E  K Y K++++A    S 
Sbjct: 476 ALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCY-KRSIKA----SQ 530

Query: 607 TSTIVISIQMNLAHTYRKLGEYERAIK 633
           T     SI   LA  Y +L + +   K
Sbjct: 531 TVDQNTSIYYRLAQLYEELEDLQECKK 557

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query: 614 IQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESL 673
           +Q+ L   +    E+ + I CF+  LE    D  ++  LG     + R  +AI   H++L
Sbjct: 418 VQLGLGTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKAL 477

Query: 674 ALKPS 678
           ALKPS
Sbjct: 478 ALKPS 482

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%)

Query: 625 LGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQ 683
           LG  + AIKCF+ +LE+  KD   +  LG     +KR   AI     ++ LKPS   A+
Sbjct: 404 LGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRAR 462

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%)

Query: 614 IQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESL 673
           IQ+ L   +    E++R I CF+  L+    D  ++  LG     + R  +AI   H +L
Sbjct: 426 IQLCLGLLFYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRAL 485

Query: 674 ALKPSNTSAQ 683
            LKPS   A+
Sbjct: 486 QLKPSFVRAR 495

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%)

Query: 608 STIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAID 667
           STI   IQ+ L   +    ++++ I CF+  L     D  ++  LG     + R  +AI 
Sbjct: 453 STIDPEIQLCLGLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQ 512

Query: 668 YLHESLALKPS 678
             H +L LKPS
Sbjct: 513 AYHRALQLKPS 523

>Kwal_56.24750
          Length = 619

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 77/344 (22%), Positives = 139/344 (40%), Gaps = 17/344 (4%)

Query: 299 LCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFS 358
           L YLRG+++  Q+    A  +F  ++ +   N+  +  L+S   IS  +E  LLL +   
Sbjct: 220 LHYLRGVLYKIQDISSNAINSFLSSLSIFPYNWACWTELLS--CISRSDESILLLKILNE 277

Query: 359 TLGDNE-EMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETL-YSQCK 416
              D + +++   + L++ +  + ++     Q L     +  N   L+ Q   + Y    
Sbjct: 278 KFTDEKSQLMLKFFKLSLFQEFNGNIDDFI-QELDYLLSIFPNFAFLKTQHALINYHYMD 336

Query: 417 FSECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVA 476
           +       E  +  D Y    + TY + LY     +KL  L+   +      A T   +A
Sbjct: 337 YVSAGLIFENIIKIDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIA 396

Query: 477 TYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTY-GLEGEHDQALSAYATAARFFPG 535
            YY A ++  K+  YF +A  L+   ++AW    H +  L+  H  A+  Y  A    P 
Sbjct: 397 NYYSAKQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSH-AAIECYRRAVDINPR 455

Query: 536 IHVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPL---LLNEMGVMYFKKNELEKSKR 592
                  LG  Y   +    +  YF     +C   PL   +   +   Y K     +S +
Sbjct: 456 DFKAWYGLGQAYEVLDMHLYSLYYFQ---KSCALKPLDKRMWQALASCYEKVGNAAESIK 512

Query: 593 YLKKALEAVRNSSGTSTIVISIQMNLAHTYRK--LGEYERAIKC 634
              +AL+   +S   +TI+   ++ L H  ++  +   E  IKC
Sbjct: 513 CYTRALQLSFDSDLDTTIL--YRLALLHEKQRDIISCKEYMIKC 554

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 93/235 (39%), Gaps = 12/235 (5%)

Query: 438 LPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFSKASI 497
           + T+ + L+    K  L  L   L      + I W S+   +   +D  +A   F KA  
Sbjct: 461 MDTFSTVLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQ 520

Query: 498 LDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLF-LGMEYMATNTLSLA 556
           LDP F+ A+    H Y      D A S +  A       H   L+ LGM  +       A
Sbjct: 521 LDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALT-IEKTHYNALYGLGMCCVKLGKFEEA 579

Query: 557 EEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQM 616
             +F  A      + +L    GV   +  + E++  + + A E   NSS        + +
Sbjct: 580 LLFFEKARALNPVNVILNCCCGVALERLQQPERALNFYELATELQPNSSLALFKKSQLLL 639

Query: 617 NLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHE 671
           N       +G+Y  A+  F+ +      +A V+  LG LY   + +GK  D +++
Sbjct: 640 N-------MGQYSSALHNFERLESLTPDEAHVHFLLGNLY---QIVGKKQDAMNQ 684

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 31/71 (43%)

Query: 475 VATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFP 534
           +  YY+ ++   ++ ++F  A  +D S   AW+G    Y   G  + ++  +  A    P
Sbjct: 666 LGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSP 725

Query: 535 GIHVPNLFLGM 545
                 LFL +
Sbjct: 726 EHKYAGLFLAI 736

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 32/74 (43%)

Query: 466  PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSA 525
            PK    WF+++   +   DV  A+   ++   L P    +W   A T   EG+ +++   
Sbjct: 974  PKEPTIWFNMSLLALKCHDVEFAKLVLNQLHGLAPQMPHSWFAKALTLEKEGDINESTRM 1033

Query: 526  YATAARFFPGIHVP 539
            +A A     G + P
Sbjct: 1034 FAYAFLISNGRYKP 1047

>ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH]
           complement(363355..364338) [984 bp, 327 aa]
          Length = 327

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 463 EKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAW--LGFAHTYGLEGEHD 520
           E  P  A+ + + A  Y +++   KA +   KA+ +D S+S  +  LG+A  Y L G H+
Sbjct: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175

Query: 521 QALSAY 526
           +AL AY
Sbjct: 176 EALEAY 181

>ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W
           (TOM71) - SH] complement(641630..643414) [1785 bp, 594
           aa]
          Length = 594

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 466 PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSA 525
           PKS+  ++  A     I+   +A K F KA   DPS    ++  A     E + D   + 
Sbjct: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429

Query: 526 YATAARFFP-GIHVPNLF 542
           ++ A R FP    VPN +
Sbjct: 430 FSEARRRFPTAPEVPNFY 447

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 99/257 (38%), Gaps = 13/257 (5%)

Query: 299 LCYLRGLIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFS 358
           L YLRG++   Q    +A  +F  ++ +   N+  +  L +   I+  +E  LLL     
Sbjct: 279 LYYLRGILEKKQGLASEAIKSFVRSLELYPYNWTCWCELAT--CITRTDE-SLLLVKHLR 335

Query: 359 TL-------GDNEEMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETL 411
            L       GDN  M+R+ + +++ K    D      + L    GL  N   L+ ++  L
Sbjct: 336 DLFPANGERGDNAVMLRF-FKISIFKDFGGDFDHFMDE-LDYLMGLFPNFSFLKSELALL 393

Query: 412 -YSQCKFSECLEACEKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAI 470
            Y    +       ++ +  D Y    L  Y + LY     +KL  LS   A+       
Sbjct: 394 NYHYMDYVNAELIFDEIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPE 453

Query: 471 TWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAA 530
           T   +A Y+ A +   KA  YF +A  L+ + + AW    H +        A+  Y  A 
Sbjct: 454 TCCIIANYFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAV 513

Query: 531 RFFPGIHVPNLFLGMEY 547
              P        LG  Y
Sbjct: 514 DINPCDFKAWYGLGQAY 530

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 8/98 (8%)

Query: 581 YFK-KNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVL 639
           YF  K + EK+  Y ++AL   +  +   T+       + H + ++     AI+C++  +
Sbjct: 461 YFSAKQQHEKAIMYFRRALTLNKTCTNAWTL-------MGHEFVEMKNSHAAIECYRRAV 513

Query: 640 EEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKP 677
           +    D + +  LG  Y    R   A+ YL ++ +LKP
Sbjct: 514 DINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKP 551

>CAGL0A03630g complement(364712..367900) similar to sp|P33339
           Saccharomyces cerevisiae YGR047c TFC4, hypothetical
           start
          Length = 1062

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 625 LGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQE 684
           LG   +AI CF  V+    ++ E       LY +T ++ +A+D   +     PS+ +   
Sbjct: 214 LGHIRQAIYCFSRVIHLNKEEWECIYRRALLYKQTGQIARALDGFQKMYTKSPSDAN--- 270

Query: 685 LLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQKKRGNISSTEAASMSKKMKMNGDM 744
            +L  L   A + +D N  +    ELY  + +K I++++  I ++EA   S     + D 
Sbjct: 271 -ILREL---AILYVDYN-KVEKAIELYLESFEKNIKRRQAIIRASEAVFESSDDDDDDDP 325

Query: 745 RRLSPDED-GDEE 756
              + DED GDE+
Sbjct: 326 NSKNSDEDQGDED 338

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
            tetratricopeptide (TPR) repeats, part of a system to
            protect cells from double-stranded RNA (dsRNA) viruses
            [4299 bp, 1432 aa]
          Length = 1432

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 466  PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGE 518
            PK+  TWF++A   +  +D   A++  +K   L P  S+ WLG A     +G+
Sbjct: 1016 PKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGD 1068

>Kwal_23.5408
          Length = 1410

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 23/52 (44%)

Query: 466  PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEG 517
            P+    W+ +A   +   D+  AR    K+  + P  S+ WLG A     EG
Sbjct: 994  PRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEG 1045

>AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH]
           (245331..247175) [1845 bp, 614 aa]
          Length = 614

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 12/90 (13%)

Query: 537 HVPNLFLGMEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKK 596
            VP  FL  E +A  +  L E+    +YD      +LLNE  ++   K +LE+++  LK+
Sbjct: 163 RVPLAFLPAEAVAEVSGKLVED----SYD------MLLNE-SMVCSSKGQLEQAESLLKR 211

Query: 597 ALEAVRNSSGTSTIVISIQMNLAHTYRKLG 626
           ALE  R +      V +IQ+ LA+  + LG
Sbjct: 212 ALELAR-AEEVEDDVHTIQLQLAYVTQLLG 240

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
            cerevisiae YPR189w SKI3 antiviral protein singleton,
            start by similarity
          Length = 1401

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 471  TWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATA 529
            +W+ +A   ++  D   AR    KA  + P  S +WLG A  Y  EG    +   +A A
Sbjct: 988  SWYCMAMLALSNNDTDLARDILMKAQSIAPEDSQSWLGLALIYEKEGLATDSARMFAHA 1046

>Scas_718.37d
          Length = 601

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 482 IEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATA 529
           I ++P +  Y+ +A   DP+ S  W+  A  Y   G+ + A+++Y  A
Sbjct: 308 INNIPLSYDYYQRAISSDPALSFIWVSIASLYLRLGQIEDAIASYWEA 355

>Kwal_27.11737
          Length = 575

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%)

Query: 613 SIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHES 672
           S+Q+ L   +    +Y++ + CF+  L     D  ++  LG     + R  +AI    ++
Sbjct: 427 SLQLGLGILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKA 486

Query: 673 LALKPSNTSAQ 683
           L LKP+   A+
Sbjct: 487 LQLKPTFVRAR 497

>YOL145C (CTR9) [4679] chr15 complement(49553..52786) Protein
           required for normal expression of G1 cyclins CLN1 and
           CLN2, has tetratricopeptide (TPR) repeats and binds
           triplex DNA, may be involved in transcription elongation
           [3234 bp, 1077 aa]
          Length = 1077

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 23/28 (82%)

Query: 614 IQMNLAHTYRKLGEYERAIKCFKLVLEE 641
           +Q+NLAH Y ++ EY +AI+ ++LVL++
Sbjct: 733 VQLNLAHCYLEMREYGKAIENYELVLKK 760

>CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 587

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 1/78 (1%)

Query: 466 PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSA 525
           P  A  ++        I+   KA + F KA   DP+    ++  A     EG  D   + 
Sbjct: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421

Query: 526 YATAARFFPGI-HVPNLF 542
           ++ A R FP    VPN F
Sbjct: 422 FSEARRKFPDAPEVPNFF 439

>KLLA0B09966g complement(872760..873872) similar to sp|P33313
           Saccharomyces cerevisiae YBR155w CNS1 singleton,
           hypothetical start
          Length = 370

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 5/111 (4%)

Query: 585 NELEKSKRYLKKA----LEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLE 640
           N+L K KR+ K A    L+A+       +I  S+ +NLA    ++  Y   I   +  L+
Sbjct: 78  NDLYKGKRF-KDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALK 136

Query: 641 EAGKDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQELLLHALE 691
              K+ + +  +G  YL+  R   +++ +   LA+ P N + + +   A E
Sbjct: 137 LNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATE 187

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 38/95 (40%), Gaps = 2/95 (2%)

Query: 64  QSPYRSLANSPLVQKTN--PSIITASLTTPHQKNTGTIPTXXXXXXXXXXXXXXXKGNVF 121
           Q+P  SLA + L +K    P +I    T+ + K+ G +                  G + 
Sbjct: 190 QTPLSSLALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTGSTAVGKIL 249

Query: 122 GSTISSSLRKVSIQPNSNIPETNTKDENMSNEINK 156
               +S+++KVS +   N P     D +M   + +
Sbjct: 250 MQQAASTVKKVSFELGGNAPVIIMGDADMEKTVEE 284

>Scas_666.23
          Length = 596

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 51/125 (40%), Gaps = 3/125 (2%)

Query: 421 LEACEKALDGDEYNPTILP-TYISCLYEQNGKNKLFLLSHNLAEKFP-KSAITWFSVATY 478
           LEA E      E +P I    Y++ +    G    +  ++  A K   K+A  ++     
Sbjct: 324 LEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMKLDDKNAALYYHRGQM 383

Query: 479 YMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFP-GIH 537
           Y   +   KA + F KA  LDP     ++  A     E + D   + ++ A R FP    
Sbjct: 384 YFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLFSEARRKFPNSSE 443

Query: 538 VPNLF 542
           VPN +
Sbjct: 444 VPNFY 448

>AEL224W [2282] [Homologous to ScYOR027W (STI1) - SH]
           complement(207712..209454) [1743 bp, 580 aa]
          Length = 580

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 11/99 (11%)

Query: 583 KKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEA 642
           K NEL K KR   +A+     +      +  +    A  Y K G+YE AIK  +  +EE 
Sbjct: 260 KGNELYK-KRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEK-GDYESAIKTLEKAVEE- 316

Query: 643 GKD--------AEVYCALGFLYLKTKRLGKAIDYLHESL 673
           G++        A+ +  LG  + K   L KAI+Y  +SL
Sbjct: 317 GRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>YLR127C (APC2) [3537] chr12 complement(395759..398320) Component of
           the anaphase-promoting complex, required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2562 bp, 853 aa]
          Length = 853

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 67/138 (48%), Gaps = 33/138 (23%)

Query: 324 VLVDVKNYEAFESLIS--KNLISPEEEWDLLLSLDFSTLGDN---------EEMIRYLYT 372
           VL+D+  +E+ E  IS  +NL++     D L +L F TL +          E+++++  T
Sbjct: 494 VLLDL--FESREFFISEFRNLLT-----DRLFTLKFYTLDEKWTRCLKLIREKIVKFTET 546

Query: 373 LNVSKYIHQDV----SKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEACEKAL 428
            + S YI   +      TA  + +D+  L N+ID++ + I       K SE  E C K  
Sbjct: 547 SH-SNYITNGILGLLETTAPAADADQSNL-NSIDVMLWDI-------KCSE--ELCRKMH 595

Query: 429 DGDEYNPTILPTYISCLY 446
           +    +P I P +IS LY
Sbjct: 596 EVAGLDPIIFPKFISLLY 613

>Scas_589.5
          Length = 1087

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 538 VPNLFLGME--YMATNTLSLAEEYFTLAYDTCRY-----DPL-LLNEMGVMYFKKNELEK 589
           +P  +L +   Y  TN    + +Y T A +  ++      PL LLN +G  YF   + +K
Sbjct: 477 IPRAYLTISQLYEKTNQYKQSLDYLTKALEEIQFINKDNVPLELLNNIGSFYFINGDADK 536

Query: 590 SKRYLKKALEAVRNSSGTSTIVISIQMNLAHT 621
           +K Y   A   + N S + T   +I  N+A T
Sbjct: 537 AKEYFDLAKSKLSNDSSSLT---TINYNIART 565

>Sklu_1876.2 YOL145C, Contig c1876 732-4004
          Length = 1090

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 571 PL-LLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHT 621
           PL +LN +G  +F   +L+ +  + +KAL+A   +  TS + I+++ N+A T
Sbjct: 501 PLEILNNLGCFHFITGDLKNADNFFEKALQA---TPDTSDVSITVKYNVART 549

>KLLA0F08459g complement(787966..790479) similar to sp|P12945
           Saccharomyces cerevisiae YDL040c NAT1 protein
           N-acetyltransferase subunit singleton, start by
           similarity
          Length = 837

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 588 EKSKRYLKKALEAVRNSSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAE 647
           E++  Y+ KAL  ++   GT    I   + L   YR++  Y  A+K FK  LE    + +
Sbjct: 72  EEAASYIDKALSKIK---GTLVSPIGGHL-LGIYYRQVKNYSDAVKWFKAALENGSTNTQ 127

Query: 648 VYCALGFL 655
           +Y  L  L
Sbjct: 128 IYRDLATL 135

>Scas_437.1
          Length = 1053

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 622 YRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAID 667
           Y+K+G+  RA++ F+ + +    D  +   L  LY+   RL  AID
Sbjct: 247 YKKIGQIGRALEGFQKLYQYNPFDGNILRELAVLYVDYNRLDDAID 292

>AFR112W [3304] [Homologous to ScYLL022C (HIF1) - SH]
           complement(638813..639706) [894 bp, 297 aa]
          Length = 297

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 644 KDAEVYCALGFLYLKTKRLGKAIDYLHESLALKPSNTSAQELLLHA 689
           K AE Y  LG + L+ +  G+A + L   LAL+  + +A+ LL+ A
Sbjct: 152 KLAETYDVLGEVSLEAENFGQAAEDLRSCLALRERSGAAERLLVEA 197

>Kwal_33.15281
          Length = 287

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 576 EMGVMYFKKNELEKSKRYLK-KALEAVRN-----SSGTSTIVISIQ-MNLAHTYRKLGEY 628
           E+  +YFKK++   ++RY K + L+ +++     S     IV+S   + +A  +R LG  
Sbjct: 107 ELEELYFKKSDFLSTERYAKDRVLDNLQDFVNSFSKSPRAIVLSTSNIRVADVFRGLGGS 166

Query: 629 ERAIKCF 635
           + A+K F
Sbjct: 167 KHAVKLF 173

>Kwal_55.22152
          Length = 1101

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 571 PLLLNEMGVMYFKKNELEKSKRYLKKALE------AVRNSSGTSTIVISIQMNLAHTYRK 624
           PLLLN +G  ++ +   E+S    +K+LE      A       S +V SI+ N+A  + +
Sbjct: 785 PLLLNLLGRAWYSRGVKERSLECFEKSLEYAQDALAAEMERSNSKMVQSIKFNVALLHSQ 844

Query: 625 LGEYER 630
           + E  R
Sbjct: 845 IAETLR 850

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,017,478
Number of extensions: 1094997
Number of successful extensions: 4280
Number of sequences better than 10.0: 95
Number of HSP's gapped: 4329
Number of HSP's successfully gapped: 132
Length of query: 760
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 651
Effective length of database: 12,822,747
Effective search space: 8347608297
Effective search space used: 8347608297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)