Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_681.2184684637520.0
YER167W (BCK2)8518145851e-63
Kwal_56.234626955103052e-28
CAGL0L11836g8475832384e-20
KLLA0C17666g7902361831e-13
AGR119C801921276e-07
Scas_636.16d620281008e-04
CAGL0M07766g23869810.094
YBR223C (TDP1)54460820.13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_681.21
         (846 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_681.21                                                          1449   0.0  
YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in ...   229   1e-63
Kwal_56.23462                                                         122   2e-28
CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306 Saccha...    96   4e-20
KLLA0C17666g 1562996..1565368 some similarities with sp|P33306 S...    75   1e-13
AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH] (969101..97...    54   6e-07
Scas_636.16d                                                           43   8e-04
CAGL0M07766g 781830..782546 no similarity, hypothetical start          36   0.094
YBR223C (TDP1) [404] chr2 complement(668620..670254) Tyrosyl-DNA...    36   0.13 

>Scas_681.21
          Length = 846

 Score = 1449 bits (3752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/846 (86%), Positives = 736/846 (86%)

Query: 1   MSSLNQEAQQVPISXXXXXXXXXXXXXXXXRSSPTETLNKWKIPHYYRRSNIGLSTPQTE 60
           MSSLNQEAQQVPIS                RSSPTETLNKWKIPHYYRRSNIGLSTPQTE
Sbjct: 1   MSSLNQEAQQVPISATTTTTAAGTTTNATTRSSPTETLNKWKIPHYYRRSNIGLSTPQTE 60

Query: 61  SSMSFANPSANLSPNINVMTXXXXXXXXXXXXXXXXXXXXXXXXXXMVFVNYTVQDTEPA 120
           SSMSFANPSANLSPNINVMT                          MVFVNYTVQDTEPA
Sbjct: 61  SSMSFANPSANLSPNINVMTSPKKLLLEEPKKSKNGSKKSQKKKGGMVFVNYTVQDTEPA 120

Query: 121 LAAMDPIQDQGQQSIRKTXXXXXXXXXXXXXRQRMLKIFKSSQNNSKQIQMNNNDQNTGM 180
           LAAMDPIQDQGQQSIRKT             RQRMLKIFKSSQNNSKQIQMNNNDQNTGM
Sbjct: 121 LAAMDPIQDQGQQSIRKTSSSNKKEEKKKSSRQRMLKIFKSSQNNSKQIQMNNNDQNTGM 180

Query: 181 SNLPDLNLLKNDTSINNHEITNSDEKIGCTKRSYGSFLKHNKSNSSLPNEVVPKSVPNSI 240
           SNLPDLNLLKNDTSINNHEITNSDEKIGCTKRSYGSFLKHNKSNSSLPNEVVPKSVPNSI
Sbjct: 181 SNLPDLNLLKNDTSINNHEITNSDEKIGCTKRSYGSFLKHNKSNSSLPNEVVPKSVPNSI 240

Query: 241 LAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYRNTMTKNDSKLLKDEPMNDLEIDHHYL 300
           LAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYRNTMTKNDSKLLKDEPMNDLEIDHHYL
Sbjct: 241 LAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYRNTMTKNDSKLLKDEPMNDLEIDHHYL 300

Query: 301 DGSYYMDNNNIIPESNSTPNLNYNLTQSGNTLHKVNSTSATTKKFTKMEENDASIAFSKM 360
           DGSYYMDNNNIIPESNSTPNLNYNLTQSGNTLHKVNSTSATTKKFTKMEENDASIAFSKM
Sbjct: 301 DGSYYMDNNNIIPESNSTPNLNYNLTQSGNTLHKVNSTSATTKKFTKMEENDASIAFSKM 360

Query: 361 FTRKRANTAGSMNSLRYTXXXXXXXXXXXXXXXXXXXXQAQLQNIYQSVQHPSNQSQPNL 420
           FTRKRANTAGSMNSLRYT                    QAQLQNIYQSVQHPSNQSQPNL
Sbjct: 361 FTRKRANTAGSMNSLRYTSNSNSNSNANANANANANANQAQLQNIYQSVQHPSNQSQPNL 420

Query: 421 KINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPRSAKSTSNYRLSRELNSLYTN 480
           KINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPRSAKSTSNYRLSRELNSLYTN
Sbjct: 421 KINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPRSAKSTSNYRLSRELNSLYTN 480

Query: 481 VLEIPELTGPESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHRXXXXXXXXXXXXX 540
           VLEIPELTGPESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHR             
Sbjct: 481 VLEIPELTGPESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHRVHTTTTVATTPTS 540

Query: 541 XXXXPPYXXXXXXXXXXXXXXXXXXCGEVTQINNITNSNPSLKITSRQTGNFSSFLERDT 600
               PPY                  CGEVTQINNITNSNPSLKITSRQTGNFSSFLERDT
Sbjct: 541 FLVTPPYFTTNFTIPTSTSNISTPSCGEVTQINNITNSNPSLKITSRQTGNFSSFLERDT 600

Query: 601 SAENDMLMELSALSTPQESSFSRRNTTDSKLENHQNQLDNGSSSFNISNEVNSSTAMRNN 660
           SAENDMLMELSALSTPQESSFSRRNTTDSKLENHQNQLDNGSSSFNISNEVNSSTAMRNN
Sbjct: 601 SAENDMLMELSALSTPQESSFSRRNTTDSKLENHQNQLDNGSSSFNISNEVNSSTAMRNN 660

Query: 661 SMQNNEKYQLINTGLGLDDIDLQNFGDLRSAGINTVNSQVNLDELVAKSEPSTNFDPLSQ 720
           SMQNNEKYQLINTGLGLDDIDLQNFGDLRSAGINTVNSQVNLDELVAKSEPSTNFDPLSQ
Sbjct: 661 SMQNNEKYQLINTGLGLDDIDLQNFGDLRSAGINTVNSQVNLDELVAKSEPSTNFDPLSQ 720

Query: 721 LYMEFDFENPNSFFHEQSRIVSNTSNSNTITHGYASGANSSLSGRSPIISNAVPTAGTLS 780
           LYMEFDFENPNSFFHEQSRIVSNTSNSNTITHGYASGANSSLSGRSPIISNAVPTAGTLS
Sbjct: 721 LYMEFDFENPNSFFHEQSRIVSNTSNSNTITHGYASGANSSLSGRSPIISNAVPTAGTLS 780

Query: 781 SQDIFASSKGGFDLGIAPNNNNSSTRTAFNERSSEFRGNINDPNNDKTTRHFNVDNDINK 840
           SQDIFASSKGGFDLGIAPNNNNSSTRTAFNERSSEFRGNINDPNNDKTTRHFNVDNDINK
Sbjct: 781 SQDIFASSKGGFDLGIAPNNNNSSTRTAFNERSSEFRGNINDPNNDKTTRHFNVDNDINK 840

Query: 841 HTYIQH 846
           HTYIQH
Sbjct: 841 HTYIQH 846

>YER167W (BCK2) [1595] chr5 (518211..520766) Protein involved in the
           SIT4 pathway for CLN activation and in suppression of
           lethality due to mutations in the protein kinase C
           pathway [2556 bp, 851 aa]
          Length = 851

 Score =  229 bits (585), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 255/814 (31%), Positives = 352/814 (43%), Gaps = 182/814 (22%)

Query: 31  RSSPTETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTXXXXXXXXX- 89
           +S  TE+ NKWKIPHYYRRS  G +    + + S  + S  + P +NVM+          
Sbjct: 17  KSRSTESTNKWKIPHYYRRSASGSTQASPDRNSSTGSCSTPVLPTMNVMSSPKKVLLEDP 76

Query: 90  XXXXXXXXXXXXXXXXXMVFVNYTVQDTEPALAAMDPIQDQGQQSIRKTXXXXXXXXXXX 149
                            MVFVNYTVQDT           D   Q+   +           
Sbjct: 77  RDNHTKAKKSSRKKSGEMVFVNYTVQDTANE-------NDTDLQTQPVSVPAPKAKLKKK 129

Query: 150 XXRQRMLKIFKSSQNNSKQ---------IQMNNNDQNTGMSNLPDLNLLKNDTSINNHEI 200
             ++RMLKIF SS+N   +         +QM++  ++  +S  P      +++ I+   +
Sbjct: 130 SSKRRMLKIFGSSKNEHIEDIVEEQPMVLQMDS--ESKPLSGTP-----ISESGIDASSL 182

Query: 201 TNSDEKIGCTKRSYGSFLKHNKSNSSLP-----------------------------NEV 231
           T        TKRSY SFLKHN+ N   P                              EV
Sbjct: 183 T--------TKRSYNSFLKHNRLNGKTPFSGNLSFPSLNMMGNTTDLPIDNNDFCSEKEV 234

Query: 232 VPKSVPNSILAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNYR---NTMTKNDSKLLKDE 288
           VPKS  +  LAKPPS  T S   S   T  +++IPL NT+N R   N +    S   K +
Sbjct: 235 VPKSTHDPSLAKPPSRFTESETNS---TPNLSSIPLMNTKNTRLKYNKVAPQSSDRQKSQ 291

Query: 289 PMNDLEIDHHYLDGSYYMDNN-------NIIPESNSTPNLNYNLTQSGNTLHKVNSTSAT 341
                   +H  +   + D N         +    STP+   +   S  T    N   + 
Sbjct: 292 ESGL----YHSTESFNFKDQNYSNNKSSLSLNSDLSTPHFAKHSPDSPRTSRSFNCGDSQ 347

Query: 342 TKKFTKM-EENDASIAFSKMFTRKRANTAGSMNSLRYTXXXXXXXXXXXXXXXXXXXXQA 400
           +K   K+ EENDASIAFSKMFTRKRANT GS  SL                         
Sbjct: 348 SK--VKLPEENDASIAFSKMFTRKRANTGGSTCSLASPT--------------------- 384

Query: 401 QLQNIYQSVQHPSNQSQPNLKINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPR 460
               I Q++Q      Q N+K+N+  +     QRT SV SLSS+SNRYSP R+ SP R R
Sbjct: 385 ----IAQTIQ------QSNIKVNKLPT-----QRTTSVGSLSSMSNRYSPIRVASPGRAR 429

Query: 461 SA-KSTSNYRLSRELNSLYTNVLEIPEL--TGP--ESYLDVQYMQKSNSVSSDKATVLGH 515
           SA + +S YRLSR+LNSL  +V ++PE+  T P  E +LD Q   KS SV        GH
Sbjct: 430 SATRGSSLYRLSRDLNSL-PSVTDLPEMDSTTPVNEIFLDGQPQHKSGSVKG------GH 482

Query: 516 RKKQESISDLHRXXXXXXXXXXXXXXXXXPPYXXXXXXXXXXXXXXXXXXCGEVTQINNI 575
           RKKQESISD  R                 PPY                    E   +N +
Sbjct: 483 RKKQESISDAQRIQHSNSYITTPSSSLVTPPYYMTGYTLPSSASASSTPNVLETHNMNFV 542

Query: 576 TNSNPSLKITSRQTGNFSSFLERDTSAENDMLMELSALSTPQE----------------- 618
            ++  S   + R + NFSSF +++ S END   E SA +TP E                 
Sbjct: 543 PST--STVTSYRPSSNFSSF-DKEYSNENDASGEFSAFNTPMENIPALKGIPRSTLEENE 599

Query: 619 ------------SSFSRRNTTDSKLENHQNQLD------NGSSSFN------ISNEVNSS 654
                       + F RR+          + LD      +GS++ +      ++N ++++
Sbjct: 600 EEDVLVQDIPNTAHFQRRDIMGMDTHRKDDSLDFNSLMPHGSTTSSSIVDSVMTNSISTT 659

Query: 655 TA-MRNNSMQNNEKYQLINTGLGLDDIDLQNFGDLRSAGINTVNSQVN---LDELVAKSE 710
           T+    N  Q+ +KY L+NTGLGL D +L +F  +RS   +   S+ N    + +     
Sbjct: 660 TSNATGNYFQDQDKYTLVNTGLGLSDANLDHF--IRSQWKHASRSESNNNTGNRVSYSGS 717

Query: 711 PSTNFDPLS---QLYMEFDFENPNSFFHEQSRIV 741
              N D      Q+Y EFDFENP SFFHEQS+++
Sbjct: 718 TPNNVDTTKTNLQVYTEFDFENPESFFHEQSKLL 751

>Kwal_56.23462
          Length = 695

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 210/510 (41%), Gaps = 122/510 (23%)

Query: 33  SPTETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTXXXXXXXXXXXX 92
           +P E+++KWKIPHYYR+S       +  S+ S  + S   + NIN+MT            
Sbjct: 19  TPAESVSKWKIPHYYRKSTGAPVRQELGSNTSLKSESNRANGNINIMTTPKHVQLDESGG 78

Query: 93  XXXXXXXXXXXXXXMVFVNYTVQDTEPALAAMDPIQDQGQQSIRKTXXXXXXXXXXXXXR 152
                         MVFVNYTV+D + A A +                           +
Sbjct: 79  GSKRGSKSKAKKGEMVFVNYTVKDAKSADAPL---------------------PKKKSSK 117

Query: 153 QRMLKIFKSSQNNSKQIQMNNNDQNTGMSNLPDLNLLKNDTSINNHEITNSDEKIGCTKR 212
            RMLK+F S  N+      +N       S L       +  ++     + S      TKR
Sbjct: 118 SRMLKLFSSGHNSGMDESFDN------FSQLDVSTPQDSSDAVQKSRSSGSTPSSQATKR 171

Query: 213 SYGSFLKHNKSNSSL---------PNE-VVPKSVP-NSILAKPPSNPTGSNGRSKSFTSK 261
           SY SFLK+  + SS          P + V   S+P  S + +P   P+ S+  S    + 
Sbjct: 172 SYSSFLKYGHAGSSSTITSPAITPPGDGVSSTSLPLRSTVQRPSLGPSLSSNVSLVNNNG 231

Query: 262 VANIPLFN---TRNYRNTMTKNDSKLLKDEPMNDLEIDHHYLDGSYYMDNNNIIPESNST 318
            A++ L       N+ ++ +K  S L  + P +DL  +  Y D   ++        +   
Sbjct: 232 KASLALGTNDPASNFYHSPSKEKSNL-NEAPRSDLHYNDQYNDRQGHL--------ATFR 282

Query: 319 PNLNYNLTQSGNTLHKVNSTSATTKKFTKMEENDASIAFSKMFTRKRANTAGSMNSLRYT 378
           P LN+        +H    TSA  K     +ENDASIAFSKMFTRKRANT GSM+SL   
Sbjct: 283 PQLNH--------MH----TSAYPKSG---DENDASIAFSKMFTRKRANTGGSMSSL--- 324

Query: 379 XXXXXXXXXXXXXXXXXXXXQAQLQNIYQSVQHPSNQSQPNLKINRSSSSTTLAQRTMSV 438
                                         V   ++ + P L             R MS 
Sbjct: 325 ------------------------------VSSTASNNLPTL------------HRNMST 342

Query: 439 ASLSSLSNRYSPNRMISPARPRSAKSTSNYRLSRELNSLYTNVLEIPELTGP-ESYLDVQ 497
            S+SS+SNRYSP R  SPAR  S   +++ R SR+  +L        +LTG  E YLD Q
Sbjct: 343 HSISSMSNRYSPIRAGSPARNNSILRSNSNRYSRDC-TLLQGSSNYADLTGGMEIYLDSQ 401

Query: 498 YMQKSNSVSSDKATVLGHRKKQESISDLHR 527
             Q+  +          H+KKQ+SISD +R
Sbjct: 402 TKQRHTT----------HKKKQDSISDSYR 421

>CAGL0L11836g 1267563..1270106 weakly similar to sp|P33306
           Saccharomyces cerevisiae YER167w suppressor of mutations
           in protein kinase C pathway components, hypothetical
           start
          Length = 847

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 161/583 (27%), Positives = 226/583 (38%), Gaps = 142/583 (24%)

Query: 31  RSSPTETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPSANLSPNINVMTXXXXXXXXXX 90
           ++   +++NKW+IPHYY+R     STP +E   S      N  P+++             
Sbjct: 10  KAKSADSVNKWRIPHYYKRGKSVGSTPVSEVVNSPLRAVQN-EPSVS----SPKKILLEE 64

Query: 91  XXXXXXXXXXXXXXXXMVFVNYTVQDT-EPALAAMDPIQDQGQQSIRKTXXXXXXX---- 145
                           MVFVNYTVQD  E      D   D     + KT           
Sbjct: 65  RNRATPRSRKSSKKGQMVFVNYTVQDDDETGDKVDDDKADDVADVVPKTSAVTQAAILDN 124

Query: 146 -----XXXXXXRQRMLKIFKSSQNNSKQIQMNNNDQNTGMSNLPDLNLLKN--DTSINNH 198
                      R+RMLKIF SS+   + I +          +L    L++N  ++S N  
Sbjct: 125 KHVLTSKRKSSRRRMLKIFGSSK--EQVIPLEPESHQDAQKDLA-ARLIENSAESSSNTS 181

Query: 199 EITNSDEKIGCTKRSYGSFLKHNKSNSS-------------------------------- 226
             ++S        RSYGSFLK+NK  S                                 
Sbjct: 182 NTSSSSSTPNSQGRSYGSFLKYNKFCSGSDRSKNNNASTDFNAMLINNQNKMSNHLALNY 241

Query: 227 -------------LPNEVVPKSVPNSILAKPPSNPTGSNGRSKSFTSKVANIPLFNTRNY 273
                          +E+VPKS+P+  LAKP     G   R +S +S    +   ++ + 
Sbjct: 242 SAAKSAEGLLNHFAEDEMVPKSLPDPNLAKPAIR-VGPTDRKRSVSSSAIPMKAASSTSL 300

Query: 274 RNTMTKNDSKLL----------KDEPMNDLE----IDHHYLDGSYYMDNNNIIPESNSTP 319
            + +TK   K+            + P  + E     D +     Y   N+N+   S ++ 
Sbjct: 301 TSKVTKPARKMSTTTTLSNPSSHNTPFTEFENSNLTDSYQYSDPYISRNSNMSNASITSF 360

Query: 320 NLNYNLTQSGNTLHKVNSTSATTKK-FTKM---------EENDASIAFSKMFTRKRANTA 369
             + N+  S N      ST   T   F  +         EENDAS+AF+K+F RKRANT 
Sbjct: 361 ISSMNVGNSTNITPLTESTKVDTNDNFNALMKGHISEPGEENDASVAFTKLFHRKRANTG 420

Query: 370 GSMNSLRYTXXXXXXXXXXXXXXXXXXXXQAQLQNIYQSVQHPSNQSQPNLKINRSSSST 429
           GS +S                            QN  Q+             I +S  S 
Sbjct: 421 GSTSS---------------------SNSNTTFQNSTQN-------------ITKSGVSK 446

Query: 430 TLAQRTMSVASLSSLSNRYSPNRMISPARPRS-AKSTSNYRLSRELNSLYTNVLEIPELT 488
             A RT S+ SL+S++NR+SP R  SP RPRS  +S+S  R SR+L+ L    L  PE  
Sbjct: 447 ISAHRTTSLNSLASIANRFSPIRTASPVRPRSNTRSSSTCRHSRDLSGLVP--LTTPEYL 504

Query: 489 GP----ESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHR 527
           GP    E YLD Q           K TV  H+KKQESIS+L +
Sbjct: 505 GPSTGTEVYLDTQ----------SKRTV-NHKKKQESISELSK 536

>KLLA0C17666g 1562996..1565368 some similarities with sp|P33306
           Saccharomyces cerevisiae YER167w BCK2 suppressor of
           mutations in protein kinase C pathway components
           singleton, hypothetical start
          Length = 790

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 106/236 (44%), Gaps = 79/236 (33%)

Query: 297 HHYLDGSYYMDNNNIIPESNSTPNLNYNLTQSGNTLHKVNSTSATTKKFTKMEENDASIA 356
           HHY++   Y D   I    +S P           +LH+ + +S T   +   +ENDAS+A
Sbjct: 381 HHYMEP--YQDTERI----SSVP-----------SLHQSDVSSDTLSTYFT-DENDASVA 422

Query: 357 FSKMFTRKRANTAGSMNSLRYTXXXXXXXXXXXXXXXXXXXXQAQLQNIYQSVQHPSNQS 416
           FSK+FTRKR NT GS++SL                                        +
Sbjct: 423 FSKLFTRKRTNTGGSISSLLSLSA-----------------------------------T 447

Query: 417 QPNL-KINRSSSSTTLAQRTMSVASLSSLSNRYSPNRMISPARPRSAKSTSNYRLSRELN 475
           QP++  ++R  SST++             S RYSP R  S  R RS   TSN+RLSR+L 
Sbjct: 448 QPSIPALDRHQSSTSVTS-----------SMRYSPIRSGSQNRTRSNTRTSNHRLSRDLT 496

Query: 476 SLYTNV----LEIPELTGPESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHR 527
           SL T++     +  EL G ESYLD            +K     HRKKQESISD+ R
Sbjct: 497 SLQTSMKISNTDSSELPGMESYLDTH----------NKGNKPTHRKKQESISDMAR 542

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 76/190 (40%), Gaps = 41/190 (21%)

Query: 107 MVFVNYTVQDTEPALAAMDPIQDQGQQSIRKTXXXXXXXXXXXXXRQRMLKIFKSSQNNS 166
           MVFVNY+VQDT                                  R RML+IF  + N+ 
Sbjct: 148 MVFVNYSVQDT----------------------IETQKKKKKQSKRDRMLRIFTGNNNSG 185

Query: 167 KQIQMNNNDQNTGMSNLPDLNLLKNDTSINNHEITNSDEKIGCTKRSYGSFLKHNKSNSS 226
                + +   +            + T I +  +T         KR+YGSFLK ++ N S
Sbjct: 186 NNDGRSASSPGS------------SSTIIASKTLTVQSAPASAAKRTYGSFLKCHRYNPS 233

Query: 227 LPNEVVPKSVPNSILAKPPSNPTGSNGRSKSFT-SKVANIPLFNTRNYRNTMTKNDSKLL 285
             N VV     + I+  P S P   NG+  + T S  +N+ L    N R ++ ++  K +
Sbjct: 234 --NAVVESEQMDEIV--PRSEPI-PNGQKPALTRSASSNVALVR-NNGRCSLAQSAQKFV 287

Query: 286 KDEPMNDLEI 295
           K E +  +++
Sbjct: 288 KSEQLEKMDL 297

>AGR119C [4430] [Homologous to ScYER167W (BCK2) - SH]
           (969101..971506) [2406 bp, 801 aa]
          Length = 801

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 21/92 (22%)

Query: 290 MNDLEIDHHYL----DGSYYMD--NNNIIPESNSTPNLNYNLTQSGNTLHKVNSTSATTK 343
           + + + D HYL    DG Y M   +N     +   PNL+ + T SG+             
Sbjct: 342 IGEADFDPHYLGTSEDG-YKMQLSDNGQDGAATLKPNLHTSDTFSGS------------- 387

Query: 344 KFTKMEENDASIAFSKMFTRKRANTAGSMNSL 375
            + +++ENDASIAFSKMFTRKRANT GS++S 
Sbjct: 388 -YYQVDENDASIAFSKMFTRKRANTGGSLSSF 418

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 80/209 (38%), Gaps = 60/209 (28%)

Query: 36  ETLNKWKIPHYYRRSNIGLSTPQTESSMSFANPS------ANLSPN---------INVMT 80
           E+ +KWKIPHYY++     ++  T++ +S  NP+      A  SP          IN+M 
Sbjct: 20  ESTSKWKIPHYYKK-----ASSVTQTVISDLNPATSSQQCATYSPTMALNGGNNRINIMN 74

Query: 81  XXXXXXXX--XXXXXXXXXXXXXXXXXXMVFVNYTVQDTEPALAAMDPIQDQGQQSIRKT 138
                                       MVFVN+TVQDT               +S +K 
Sbjct: 75  TPVAVQLEDPDQPKTRKGQKAKAKKNGEMVFVNFTVQDT--------------TESPKKP 120

Query: 139 XXXXXXXXXXXXXRQRMLKIFKSSQNNSKQIQMNNNDQNTGMSNLPDLNLLKNDTSINNH 198
                        R++ML+IFKSS+    Q+++  +          DL  L    S    
Sbjct: 121 ---------KSSRREKMLRIFKSSE----QLKLRPH----------DLGELAPSLSKEPR 157

Query: 199 EITNSDEKIGCTKRSYGSFLKHNKSNSSL 227
               S      +KR+Y SFLK  K  SS+
Sbjct: 158 SAPAS-TPASASKRNYSSFLKCGKIGSSI 185

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 27/99 (27%)

Query: 445 SNRYSPNRMISPARPRS-AKSTSNYRLSRELNSLYTNVLEIPELT--------------- 488
           S RYSP R  SP RPRS  + +  +R +R+L+S Y +   +  L+               
Sbjct: 441 SQRYSPIRSHSPGRPRSNTRGSLTHRNTRDLSSAYLSANNVSGLSSQSGAALFNPSEPVV 500

Query: 489 GPESYLDVQYMQKSNSVSSDKATVLGHRKKQESISDLHR 527
           G ++++D QY  +            G +KK + + D  +
Sbjct: 501 GMDTFIDSQYKSR-----------YGQKKKHDGVCDTRK 528

>Scas_636.16d
          Length = 620

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 22/28 (78%)

Query: 718 LSQLYMEFDFENPNSFFHEQSRIVSNTS 745
           L   Y EFDF+NPNSFFHEQ R++++ S
Sbjct: 563 LPGAYSEFDFDNPNSFFHEQCRLINDGS 590

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 85/187 (45%), Gaps = 52/187 (27%)

Query: 349 EENDASIAFSKMFTRKRANTAGSMNSLRYTXXXXXXXXXXXXXXXXXXXXQAQLQNIYQS 408
           EENDA+IAF+++ + +       M+++R                             +  
Sbjct: 234 EENDAAIAFNRIHSAEPFPIEERMDAIR----------------------------AFSK 265

Query: 409 VQHPSNQS---QPNLKINRSSSSTTLAQRTMSVASLSS-LSN--RYSPNRMISPARPRSA 462
           + +  +QS    P +K      S     R MSV S+SS +SN  +YSP   ++P R RS+
Sbjct: 266 ITNKRSQSLSQVPTMK------SNIQKNRNMSVTSVSSNMSNLSKYSPLGTVTPGRRRSS 319

Query: 463 -KSTSNYRLSRELNSLYTNVLEIPELTGPESYLDVQYMQKSNSVSSDKATVLGHRKKQE- 520
            +  S YR S+E  SLY N+ +  E    E++LD          S  + T +  RKKQ  
Sbjct: 320 VQRHSFYRSSKEWLSLY-NIHDHVETQQDETFLD---------TSLPRDTKICIRKKQPG 369

Query: 521 SISDLHR 527
           SIS+L++
Sbjct: 370 SISELNK 376

>CAGL0M07766g 781830..782546 no similarity, hypothetical start
          Length = 238

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 686 GDLRSAGINTVNSQVNLD-ELVAKSEPS----TNFDPLSQLYMEFDFENPNSFFHEQSRI 740
           G L+    NTV+ +VN+D E   +S  S    T+FD L  L +E+D+ N   +F E    
Sbjct: 88  GALKKLISNTVSERVNIDYEDFLQSHLSNCKITSFDLLEILKIEYDWVNAEKYFRENFEW 147

Query: 741 VSNTSNSNT 749
           + N  N NT
Sbjct: 148 LQNMDNFNT 156

>YBR223C (TDP1) [404] chr2 complement(668620..670254) Tyrosyl-DNA
           phosphodiesterase, involved in DNA repair [1635 bp, 544
           aa]
          Length = 544

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 10/60 (16%)

Query: 701 NLDELVAKSEPSTNFDPLSQLYMEFDFENPN--------SFFHEQSRIVSNTSNSNTITH 752
           ++DEL+ KS    NF PLS+L  EF +  P+        SF+++  ++ + TS S+T  H
Sbjct: 248 DIDELITKSVEEVNFAPLSEL--EFVYSTPSKFQSSGLLSFYNKLEKLSAGTSASDTAKH 305

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.122    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,669,331
Number of extensions: 1154540
Number of successful extensions: 7800
Number of sequences better than 10.0: 326
Number of HSP's gapped: 7447
Number of HSP's successfully gapped: 451
Length of query: 846
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 736
Effective length of database: 12,788,129
Effective search space: 9412062944
Effective search space used: 9412062944
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)