Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_681.2054354328190.0
YER168C (CCA1)54651817220.0
CAGL0L11858g53151917180.0
Sklu_1964.251951715240.0
Kwal_56.2346151951613590.0
KLLA0C17688g48951810151e-133
AGR118W53351310081e-131
Kwal_33.1396829578701.7
Scas_612.670176692.5
KLLA0A05885g29751647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_681.20
         (543 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_681.20                                                          1090   0.0  
YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA nucle...   667   0.0  
CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5 S...   666   0.0  
Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement        591   0.0  
Kwal_56.23461                                                         528   0.0  
KLLA0C17688g complement(1565906..1567375) gi|9836828|gb|AAG00316...   395   e-133
AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH] complement(...   392   e-131
Kwal_33.13968                                                          32   1.7  
Scas_612.6                                                             31   2.5  
KLLA0A05885g complement(547338..548231) similar to sp|P47008 Sac...    29   7.8  

>Scas_681.20
          Length = 543

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/543 (97%), Positives = 531/543 (97%)

Query: 1   MRAFPAYLRXXXXXXXXXXXXLPPIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLR 60
           MRAFPAYLR            LPPIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLR
Sbjct: 1   MRAFPAYLRSMTTAMASSSATLPPIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLR 60

Query: 61  ITGGWVRDKLLGQGSHDLDIAINIMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPE 120
           ITGGWVRDKLLGQGSHDLDIAINIMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPE
Sbjct: 61  ITGGWVRDKLLGQGSHDLDIAINIMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPE 120

Query: 121 KSKHLETATTKLFDIEVDFVNLRAEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQ 180
           KSKHLETATTKLFDIEVDFVNLRAEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQ
Sbjct: 121 KSKHLETATTKLFDIEVDFVNLRAEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQ 180

Query: 181 ENQIEDFTRKGLTDLKNGILRTPLPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMS 240
           ENQIEDFTRKGLTDLKNGILRTPLPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMS
Sbjct: 181 ENQIEDFTRKGLTDLKNGILRTPLPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMS 240

Query: 241 NPEINAAFITKISRERVGNEMEKILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNE 300
           NPEINAAFITKISRERVGNEMEKILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNE
Sbjct: 241 NPEINAAFITKISRERVGNEMEKILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNE 300

Query: 301 TSNKEQMQTIQKIYQEGILNKHLLKVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSL 360
           TSNKEQMQTIQKIYQEGILNKHLLKVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSL
Sbjct: 301 TSNKEQMQTIQKIYQEGILNKHLLKVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSL 360

Query: 361 LPFATLRIIALPKKKLNNTCYVSESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQ 420
           LPFATLRIIALPKKKLNNTCYVSESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQ
Sbjct: 361 LPFATLRIIALPKKKLNNTCYVSESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQ 420

Query: 421 NSNSLQRSKLGTYLRSYSGHWEIVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILD 480
           NSNSLQRSKLGTYLRSYSGHWEIVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILD
Sbjct: 421 NSNSLQRSKLGTYLRSYSGHWEIVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILD 480

Query: 481 QGLKNCHEMKPLIDGKKMLKVLNMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVL 540
           QGLKNCHEMKPLIDGKKMLKVLNMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVL
Sbjct: 481 QGLKNCHEMKPLIDGKKMLKVLNMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVL 540

Query: 541 PVT 543
           PVT
Sbjct: 541 PVT 543

>YER168C (CCA1) [1596] chr5 complement(521024..522664) tRNA
           nucleotidyltransferase (tRNA CCA-pyrophosphorylase),
           carries out addition of CCA to 3' end without a
           template, involved in Los1p-independent tRNA nuclear
           export [1641 bp, 546 aa]
          Length = 546

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/518 (60%), Positives = 405/518 (78%), Gaps = 2/518 (0%)

Query: 24  PIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAIN 83
           P I LT +E++IC LLNDYT  YNQ + +  EPLTLRITGGWVRDKLLGQGSHDLDIAIN
Sbjct: 28  PKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAIN 87

Query: 84  IMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLR 143
           +MSGE FA GLNEYL +HYA+YG KPH+IHKIDKNPEKSKHLETATTKLF +EVDFVNLR
Sbjct: 88  VMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLR 147

Query: 144 AEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTP 203
           +E+YTELSRIP   FGTPEEDALRRDATLNALFYNI + ++EDFT++GL DLK+G+LRTP
Sbjct: 148 SEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTP 207

Query: 204 LPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEK 263
           LPA++TFLDDPLRVLRLIRFASRFNFTI+  V+ EM +P+IN AF +KISRERVG EMEK
Sbjct: 208 LPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEK 267

Query: 264 ILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHL 323
           IL+G  P+L L LIQ+AHLEN IFFWHND S+++ NE  N + M  I  +Y + ILN HL
Sbjct: 268 ILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNE-ENCQDMDKINHVYNDNILNSHL 326

Query: 324 LKVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYVS 383
              I+ Y + L + PIL+  I  +  F+QNFIL++ L P A L+II  PKKK+NN   V+
Sbjct: 327 KSFIELYPMFLEKLPILREKIGRSPGFQQNFILSAILSPMANLQIIGNPKKKINNLVSVT 386

Query: 384 ESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWEI 443
           ESI+KEGLK++K DA ++++TV+++  ++ ++ +F   S  L++S++G +LR+++G WE 
Sbjct: 387 ESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAKFADRS-QLKKSEIGIFLRNFNGEWET 445

Query: 444 VHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVLN 503
            HF +L + F+ +   +      LF++YN FYS+I D  L NCHE+KP++DGK+M K+L 
Sbjct: 446 AHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYIFDNNLNNCHELKPIVDGKQMAKLLQ 505

Query: 504 MKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVLP 541
           MK GPW+ ++NN  I WQFDNP GT+ +L+ ++K +LP
Sbjct: 506 MKPGPWLGKINNEAIRWQFDNPTGTDQELITHLKAILP 543

>CAGL0L11858g complement(1270455..1272050) similar to tr|Q9P4S5
           Saccharomyces cerevisiae YER168c tRNA
           nucleotidyltransferase, hypothetical start
          Length = 531

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/519 (61%), Positives = 411/519 (79%), Gaps = 5/519 (0%)

Query: 24  PIIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAIN 83
           P I+LT  E  IC LL DYT HYN  H   +EPLTLRITGGWVRDKLLGQGSHDLDIAIN
Sbjct: 13  PRIQLTEKETRICNLLKDYTAHYNSLHYG-QEPLTLRITGGWVRDKLLGQGSHDLDIAIN 71

Query: 84  IMSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLR 143
           IMSGE FA GLN YL +H+ +YG+KPHSIHKIDKNPEKSKHLETATTKLFD+EVDFVNLR
Sbjct: 72  IMSGEEFATGLNGYLLEHFDKYGVKPHSIHKIDKNPEKSKHLETATTKLFDVEVDFVNLR 131

Query: 144 AEEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTP 203
           +EEYTE SRIP T+FGTPEEDALRRDATLNALFYNIQ++ +EDFT++G  DL++G+LRTP
Sbjct: 132 SEEYTEDSRIPTTQFGTPEEDALRRDATLNALFYNIQQDAVEDFTKRGWQDLQDGVLRTP 191

Query: 204 LPARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEK 263
           LPAR+TFLDDPLRVLRLIRFASRFNF IE  VLKEM +PEIN AF  KISRER+G EMEK
Sbjct: 192 LPARQTFLDDPLRVLRLIRFASRFNFNIEAGVLKEMHDPEINEAFNNKISRERIGVEMEK 251

Query: 264 ILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHL 323
           IL+G NPILGL LIQ+ HLEN IF WH D S+IE N   N  Q + ++ IY++GI N HL
Sbjct: 252 ILVGPNPILGLKLIQRTHLENVIFLWHGDQSVIEYNR-KNWPQTKDVEDIYKKGIFNHHL 310

Query: 324 LKVIDNYQLLLSRSPILQSHI-LNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYV 382
              I +Y+  LSR   L+  I   + +F+QNF+LAS L+P A L+IIALPKKKLNNT  V
Sbjct: 311 KNFIHHYKDFLSRYLKLRQAIETKDKSFQQNFLLASILIPMADLKIIALPKKKLNNTLPV 370

Query: 383 SESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWE 442
           SESI++EGLK NK  + +V++ VEN++ + +++++++Q S  L+RS++GT+LR   G WE
Sbjct: 371 SESIVREGLKFNKASSIVVARCVENIAAYNSMVEKYLQ-SGDLKRSEVGTFLRELRGDWE 429

Query: 443 IVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVL 502
           IVH+V+L+++++   S  D+  + +   Y+ F+++I +Q L++  +M P+IDGK+M+K+L
Sbjct: 430 IVHYVSLMDQYLKYISRKDN-VVNIIDKYDRFWNYIQEQNLQDSDKMVPIIDGKRMVKIL 488

Query: 503 NMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVLP 541
             K GPW+ ++N+ +I+WQFD+P GTE +L+ +IK++LP
Sbjct: 489 ETKPGPWLGKINDEVILWQFDHPQGTEQELISFIKSILP 527

>Sklu_1964.2 YER168C, Contig c1964 2064-3623 reverse complement
          Length = 519

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/517 (56%), Positives = 379/517 (73%), Gaps = 17/517 (3%)

Query: 25  IIKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAINI 84
           +++LT IE+D+C LL DY  HYN T     EPLTLRITGGWVRDKLLG  SHDLDIA+N 
Sbjct: 17  VLQLTKIEQDVCGLLKDYVAHYNATATKSSEPLTLRITGGWVRDKLLGHLSHDLDIAVNN 76

Query: 85  MSGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLRA 144
           M+GE FA GLN YLT+HY++YGIKPHSIHKIDKNP KSKHLETATTKLF +EVDFVNLR+
Sbjct: 77  MTGEQFATGLNTYLTEHYSKYGIKPHSIHKIDKNPAKSKHLETATTKLFGVEVDFVNLRS 136

Query: 145 EEYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTPL 204
           EEYT  SRIPI   GTP +DA+RRDATLNALFYNIQ+ QIED+T +GL DL +G+LRTPL
Sbjct: 137 EEYTTESRIPIVACGTPAQDAMRRDATLNALFYNIQQEQIEDYTGRGLKDLHDGVLRTPL 196

Query: 205 PARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEKI 264
           P ++TFLDDPLRVLRLIRFASRFNF+I++   + M + EIN AF  KISRERVG E++KI
Sbjct: 197 PPKQTFLDDPLRVLRLIRFASRFNFSIDEETYEAMKDQEINQAFEVKISRERVGVELQKI 256

Query: 265 LIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHLL 324
           L G NP+ GL LIQ A LEN IF+WHND ++I+ N  +    M  ++ +Y++  L+ H+ 
Sbjct: 257 LTGPNPLRGLHLIQGASLENVIFYWHNDLAVIDYN--NKHTDMSDVELVYKQ--LSSHID 312

Query: 325 KVIDNYQLLLSRSPILQSHILNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYVSE 384
            V+ N   LL   P L+    ++  FKQNFIL  +L PF+TL II+ P KK++N   V+E
Sbjct: 313 VVLHNIPKLLQALPHLKEKYDSDAVFKQNFILGVTLAPFSTLSIISNP-KKMHNRLSVTE 371

Query: 385 SIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWEIV 444
           SIIKEGLK  K DA++V++ V+     K   +E V+N + ++RS++GT LRSY G W++ 
Sbjct: 372 SIIKEGLKFGKNDAEVVAKCVDT----KDQFQEIVKNIDHVKRSQVGTLLRSYYGDWQLA 427

Query: 445 HFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVLNM 504
           H++ L  E+    SN       +   Y  FY++++ Q L+NCH +KPL+DGKK+ K+L M
Sbjct: 428 HYINLSLEYF-YDSN-------VLGRYERFYTYVVKQDLENCHILKPLVDGKKLSKLLQM 479

Query: 505 KAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVLP 541
           K GPWM ++NN +++WQ DNP   E +LLE++K +LP
Sbjct: 480 KPGPWMGKVNNQLLLWQLDNPGKGEEELLEFVKRILP 516

>Kwal_56.23461
          Length = 519

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/516 (52%), Positives = 358/516 (69%), Gaps = 17/516 (3%)

Query: 26  IKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAINIM 85
           + LT  E+DIC LL DY+  YN  +   KEPL LRITGGWVRDK+LG  SHDLDIA+N M
Sbjct: 18  LTLTKTEQDICGLLRDYSREYNAANAG-KEPLMLRITGGWVRDKILGFDSHDLDIAVNTM 76

Query: 86  SGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLRAE 145
           +GE  A GL+++LT+++  YGI PHSIHKIDKNPEKSKHLETATTKLF IEVDFVNLR+E
Sbjct: 77  TGEQLALGLSDFLTRNHQLYGITPHSIHKIDKNPEKSKHLETATTKLFGIEVDFVNLRSE 136

Query: 146 EYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTPLP 205
           EYT  SRIP+  FGTP++DALRRDATLNALFYNIQ ++IEDFT  G+ DLK G+LRTPLP
Sbjct: 137 EYTNDSRIPVVAFGTPKQDALRRDATLNALFYNIQCDKIEDFTGTGIEDLKRGVLRTPLP 196

Query: 206 ARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEKIL 265
            R+TFLDDPLRVLRLIRFASRF F I+    + M +PEIN AF  KISRERVG EM+KIL
Sbjct: 197 PRQTFLDDPLRVLRLIRFASRFGFIIDPETYQAMQDPEINKAFEIKISRERVGAEMQKIL 256

Query: 266 IGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHLLK 325
            G NP+LGL LIQ A+L+N IF WH+DP II      N+E +   + +      +KH+  
Sbjct: 257 QGPNPLLGLKLIQGANLQNVIFHWHSDPVII----AYNRENVDMTEALEAYQKFSKHIAL 312

Query: 326 VIDNYQLLLSRSPILQSHILNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYVSES 385
           V++   +LL+  P +Q+      TFKQNF+L+  L PF  ++I+  P+K LN    ++ES
Sbjct: 313 VLEKLPVLLNSFPKIQNDWDTQPTFKQNFLLSIILAPFRGIKIVWNPQKLLNREAPITES 372

Query: 386 IIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWEIVH 445
           I+K+GLK+ K D++++S+ VE+   +  ++ +F     SL RS++G  +R + G WE+ H
Sbjct: 373 IVKDGLKLGKNDSELISKCVESHLAYNKMVLKF----ESLSRSEIGLVIRDFKGDWELAH 428

Query: 446 FVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVLNMK 505
              L   +       D T++     Y +FY F+ ++ L+N H +KPLIDGK + K L +K
Sbjct: 429 LANLALAYCF-----DETSL---GQYQNFYKFVFNENLENSHLLKPLIDGKSLSKRLKIK 480

Query: 506 AGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVLP 541
            G WM  + + +I WQ DNP  TE ++LE++  +LP
Sbjct: 481 PGRWMGGVVSEMIKWQLDNPTATEEEVLEFVLKILP 516

>KLLA0C17688g complement(1565906..1567375)
           gi|9836828|gb|AAG00316.1|AF207744_1 Kluyveromyces lactis
           tRNA nucleotidyltransferase, start by similarity
          Length = 489

 Score =  395 bits (1015), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/518 (44%), Positives = 313/518 (60%), Gaps = 43/518 (8%)

Query: 26  IKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAINIM 85
           I+L  +E +IC L+ ++  HYN+ + +  EPL  RITGGWVRDKLLG  S+DLDIAIN M
Sbjct: 9   IQLNKVESEICTLVKEFCSHYNKANAET-EPLVARITGGWVRDKLLGNDSNDLDIAINNM 67

Query: 86  SGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLRAE 145
           +GE FA  L  +L       G++ HS+H IDKNP KSKHLET TTKLFD+ VDFVNLR+E
Sbjct: 68  TGEQFAEKLCAFLQDR----GLETHSLHTIDKNPSKSKHLETCTTKLFDVPVDFVNLRSE 123

Query: 146 EYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTPLP 205
           EYT  SRIP  +FGTP +DA+RRDATLNA+FYNI E++IEDFT+KG  DL +GILRTPLP
Sbjct: 124 EYTMESRIPKVEFGTPYDDAMRRDATLNAMFYNITEDKIEDFTKKGFQDLNDGILRTPLP 183

Query: 206 ARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEKIL 265
            R+TF+DDPLRVLRLIRFASRFNF I+    + M +P I+ +F  KIS+ RV  EM K L
Sbjct: 184 PRQTFIDDPLRVLRLIRFASRFNFQIDPQTYQAMRDPGIHQSFNHKISKGRVYTEMHKTL 243

Query: 266 IGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHLLK 325
              NP   L LIQ AHL   IF             T+N E    I+ IY+   L++HL  
Sbjct: 244 TSANPFYALDLIQGAHLSRVIF-------------TTN-ESSPEIESIYEN--LDQHLKS 287

Query: 326 VIDNYQLLLSRSPILQSHILNNNTF---KQNFILASSLLPFATLRIIALPKKKLNNTCYV 382
           +++    L      L+SH    + F   ++  IL+  L  F  L+     K K  N+  +
Sbjct: 288 LVETIPKL------LKSHTTFASVFPGMQEPLILSLVLSGFKGLKGPDPAKPK--NSIPL 339

Query: 383 SESIIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWE 442
           +  I KEGL         V   VE+   +  L+K    N  S++RS+LG  LR    +W+
Sbjct: 340 AGVITKEGLNFPNTQVDNVIACVESEDSYHNLVK----NGKSMKRSELGFALRKLGKNWQ 395

Query: 443 IVHFVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVL 502
           +VHF  L  ++  L+  D     E    Y+ FY  + D  L + + +K +I+GK++ K+L
Sbjct: 396 MVHFYNLCLDY--LRHGD-----EPIPHYDEFYKHVHDCKLDDVYTLKHIINGKELAKLL 448

Query: 503 NMKAGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKTVL 540
           + K G WM E  + I++WQ DNP+ ++   +E +  ++
Sbjct: 449 DRKPGIWMGETLDRILIWQLDNPDISKETFIENLNDIV 486

>AGR118W [4429] [Homologous to ScYER168C (CCA1) - SH]
           complement(967217..968818) [1602 bp, 533 aa]
          Length = 533

 Score =  392 bits (1008), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/513 (39%), Positives = 300/513 (58%), Gaps = 36/513 (7%)

Query: 26  IKLTPIEKDICKLLNDYTLHYNQTHLDIKEPLTLRITGGWVRDKLLGQGSHDLDIAINIM 85
           I+LT +E+ IC ++ DY        L    P   RI GGWVRDKLLG  S DLDI +N +
Sbjct: 50  IQLTALERRICDVIRDYCAQLGDAGL---RP---RIAGGWVRDKLLGLESEDLDIVLNNV 103

Query: 86  SGESFARGLNEYLTKHYARYGIKPHSIHKIDKNPEKSKHLETATTKLFDIEVDFVNLRAE 145
           +GE FA GL E+L       G     +HKI +NP +SKHLET TT +  + VDFVNLR+E
Sbjct: 104 TGERFASGLVEFLKAQ----GGSARGVHKIQRNPARSKHLETCTTTVLGVAVDFVNLRSE 159

Query: 146 EYTELSRIPITKFGTPEEDALRRDATLNALFYNIQENQIEDFTRKGLTDLKNGILRTPLP 205
            Y E SR+P  +FGTP +DA+RRDATLNALFYNI E  +EDFT +GL DL  G+LRTP+P
Sbjct: 160 TYAEESRVPTVEFGTPLQDAMRRDATLNALFYNILEGVVEDFTGRGLADLAAGVLRTPMP 219

Query: 206 ARKTFLDDPLRVLRLIRFASRFNFTIEDNVLKEMSNPEINAAFITKISRERVGNEMEKIL 265
           AR+TFLDDPLRVLRL+RFA+RF F +++   + M+  +I+AA + KISRERVG E+ K+L
Sbjct: 220 ARQTFLDDPLRVLRLVRFAARFGFELDNEAREGMAYRDIHAALVRKISRERVGTELHKML 279

Query: 266 IGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHLLK 325
              +P+ GL L+ +A L  A+F        +  +      +   +   YQ   L  HL  
Sbjct: 280 TSADPLYGLRLLCEAGLLPAVF--------LSPDGLPRGAEQHVLGMDYQVEALCAHL-- 329

Query: 326 VIDNYQLLLSRSPILQSHILNNNTFKQNFILASSLLPFATLRIIALPKKKLNNTCYVSES 385
                  L  R P   +  L +  F++ F+L++ L  F  +   +  K+ +        S
Sbjct: 330 -----SALKERCPGFAA-ALEDEAFRERFLLSTVLARFRGVHATSTKKQPVEAVV----S 379

Query: 386 IIKEGLKMNKLDAKIVSQTVENVSKHKALIKEFVQNSNSLQRSKLGTYLRSYSGHWEIVH 445
           I++EGLK+ +     V   V ++  +     E V+N  S  R+++G  LR    HW   H
Sbjct: 380 IVREGLKLGRATVSAVQMAVRSIDDY----HEMVENYGSWSRARVGLQLRGLEDHWRQCH 435

Query: 446 FVALLEEFINLQSNDDHTAIELFKDYNSFYSFILDQGLKNCHEMKPLIDGKKMLKVLNMK 505
           + A+  ++  L +N+D   + L   Y  F   + ++GL++ H+++P+IDG +++K+L  K
Sbjct: 436 YTAMACQYF-LAANED-ARLALIGLYGRFEQHVREEGLEDAHKLRPMIDGNQLVKLLGTK 493

Query: 506 AGPWMSELNNNIIVWQFDNPNGTEAQLLEYIKT 538
            GPWMS   + ++ WQ ++P+GT  QL ++++ 
Sbjct: 494 GGPWMSRAMSMMVEWQLEHPHGTSEQLADWLQA 526

>Kwal_33.13968
          Length = 295

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 4/78 (5%)

Query: 249 ITKISRERVGNEMEKILIGNNPILGLSLIQQAHLENAIFFWHNDPSIIECNETSNKEQMQ 308
           + K  R R+G     I + +      + I Q H  N +  W  DP+I +C     K+ + 
Sbjct: 143 VNKFLRYRIGLMERSIALLDFEDETNNYIAQVHDYNGVSMWRMDPAIKKC----TKQVIA 198

Query: 309 TIQKIYQEGILNKHLLKV 326
             QK Y E +  K+ + V
Sbjct: 199 VFQKYYPELLSEKYFVNV 216

>Scas_612.6
          Length = 701

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%)

Query: 172 LNALFYNIQENQIEDFTRKGLTDLKNGILRTPLPARKTFLDDPLRVLRLIRFASRFNFTI 231
           +N + + I  N    F+R   + ++  +L   +P+R+T L++ LR L   +     +  I
Sbjct: 511 VNGMVFGISINTENLFSRLMKSGVRTLLLNDSVPSRQTGLENDLRNLATQKLRCTTDQEI 570

Query: 232 EDNVLKEMSNPEINAA 247
            DN+L++M++ E+   
Sbjct: 571 YDNILEKMNSFELTVG 586

>KLLA0A05885g complement(547338..548231) similar to sp|P47008
           Saccharomyces cerevisiae YJL145w singleton, start by
           similarity
          Length = 297

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 276 LIQQAHLENAIFFWHNDPSIIECNETSNKEQMQTIQKIYQEGILNKHLLKV 326
           L+ Q H  N +  W  DP+I +C    +K  ++  Q  Y E + +K  + V
Sbjct: 161 LMTQVHDYNNVSMWRLDPAIKKC----SKAIIEVFQDFYPETLFSKFFVNV 207

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,213,461
Number of extensions: 834032
Number of successful extensions: 2568
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2627
Number of HSP's successfully gapped: 34
Length of query: 543
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 436
Effective length of database: 12,891,983
Effective search space: 5620904588
Effective search space used: 5620904588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)