Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_681.1986486441660.0
AGR117C79987118870.0
YER169W (RPH1)79683518720.0
KLLA0C17710g82190018150.0
CAGL0L11880g98038513331e-169
Kwal_56.2345382840013121e-168
YDR096W (GIS1)8945118443e-99
Scas_76.12282266122e-73
Kwal_55.218555212163041e-28
KLLA0D10758g8501782931e-26
ABR167C7762092883e-26
YJR119C7282362875e-26
CAGL0H00528g7402082865e-26
Sklu_2303.67952142822e-25
Scas_691.277352632544e-22
CAGL0G08107g6251191972e-15
Scas_709.32822561661e-11
Scas_602.9547571525e-10
Sklu_2181.1410541507e-10
Kwal_47.17241403541499e-10
AGR031W140551399e-10
ACL057W520511491e-09
KLLA0F26961g694661492e-09
Scas_649.28730561492e-09
CAGL0L06072g300561432e-09
Sklu_2357.7157551363e-09
Kwal_26.8351698681464e-09
CAGL0E04884g1489531464e-09
YKL062W (MSN4)630541454e-09
KLLA0C17072g474541444e-09
CAGL0K02145g317571415e-09
CAGL0M13189g541581437e-09
ABR089C571561437e-09
AGR172W1057531438e-09
Scas_721.921152531421e-08
YDR043C (NRG1)231621351e-08
YJR127C (ZMS1)13801081402e-08
CAGL0K12078g463621382e-08
KLLA0F13046g1379531393e-08
YMR037C (MSN2)704511383e-08
Scas_703.231341601393e-08
Kwal_56.2420615022221383e-08
Kwal_27.10925264551334e-08
Sklu_2351.6548521374e-08
Scas_718.44266521325e-08
Scas_569.2293951318e-08
CAGL0F05995g597511349e-08
KLLA0F18524g357521329e-08
YOR113W (AZF1)914511331e-07
CAGL0H04213g13211211331e-07
CAGL0M00594g1020511331e-07
KLLA0B04477g1332601322e-07
YML081W1251591312e-07
YER130C443571292e-07
Scas_707.31289571263e-07
Kwal_47.166211178681303e-07
AER159C1191591303e-07
YGL035C (MIG1)504561284e-07
Scas_575.3455941266e-07
KLLA0E10989g474501267e-07
CAGL0L07480g314551247e-07
Sklu_2443.22213591217e-07
Scas_697.35839581268e-07
YDR216W (ADR1)1323571261e-06
Kwal_14.2278463551241e-06
CAGL0A01628g424521231e-06
YPL038W (MET31)177551171e-06
AFL127C15212051242e-06
AFR471C389521222e-06
ACR264W769581232e-06
AFR580C838561213e-06
KLLA0B07909g922561223e-06
KLLA0F23782g782501213e-06
Kwal_47.17888786501213e-06
Scas_378.1208601163e-06
Scas_712.42*290511175e-06
CAGL0K09372g396501185e-06
YBR066C (NRG2)220501146e-06
Scas_717.17525531177e-06
KLLA0C16203g14542131187e-06
AGL207W277581141e-05
Scas_693.31635551161e-05
YGR067C794561171e-05
YPL230W391861141e-05
YGL209W (MIG2)382511132e-05
CAGL0K04631g1013551142e-05
Scas_683.25879511133e-05
CAGL0L03916g642501106e-05
Kwal_56.23925745601097e-05
Scas_719.681350801107e-05
YDR146C (SWI5)709551098e-05
AGL197W844511072e-04
Kwal_26.8021507531062e-04
Kwal_47.19045266551032e-04
KLLA0D16456g854471052e-04
KLLA0B03454g472561043e-04
KLLA0B00605g239511013e-04
Kwal_27.11460531551043e-04
Scas_687.33288511023e-04
YDR253C (MET32)19150994e-04
Sklu_2389.2767811034e-04
CAGL0H07557g476581024e-04
Scas_636.14d275551014e-04
YER028C394771025e-04
KLLA0E08679g596421026e-04
Scas_568.519952986e-04
Scas_627.17d27555996e-04
CAGL0E01331g689601017e-04
CAGL0M06831g6451011017e-04
AGL071C39653990.001
CAGL0C02519g31850980.001
KLLA0F20636g28554980.001
KLLA0E18645g43157990.001
Scas_720.3331653980.001
AEL174W66173990.001
KLLA0F11682g37460980.001
ADL198W54749970.002
YMR176W (ECM5)1411244970.002
YMR182C (RGM1)21151930.002
AEL278W47669960.002
YJL056C (ZAP1)88041960.003
KLLA0C16005g33145940.003
CAGL0E06116g61343940.004
CAGL0K03003g64771940.005
CAGL0M01870g31550920.007
CAGL0J05060g71341920.008
CAGL0M04323g70355920.008
Scas_717.60d16761870.009
AGL246W22752890.009
AFL136W40943910.010
Scas_695.257149910.010
Kwal_23.540042944910.011
Scas_711.5683241910.011
YMR070W (MOT3)49058900.013
YNL027W (CRZ1)67858900.013
YLR131C (ACE2)77048900.013
CAGL0B02651g18952860.017
YPR186C (PZF1)42953880.022
CAGL0G10021g39453870.025
Scas_721.5619955850.025
CAGL0L12562g22355850.026
Kwal_47.1657788155880.027
Scas_720.391455225870.035
KLLA0A04609g42357860.035
Scas_631.743344860.038
Kwal_27.1046730250850.040
KLLA0F10109g62383860.043
Sklu_1527.120550830.044
KLLA0F01463g78144860.045
Kwal_14.254371154860.046
Scas_627.6120777860.047
Scas_718.6747379850.052
CAGL0L00583g38839840.068
CAGL0I02838g65539840.078
Sklu_2126.544844830.078
Sklu_2289.129165810.10
Kwal_14.220625448800.12
Kwal_27.1182419953800.12
AFR190C43285800.18
Scas_604.458544790.25
KLLA0E00726g51745790.27
Sklu_2436.951783790.29
CAGL0E04312g68877780.33
ADL298C1476119790.34
Sklu_2244.327151770.35
Scas_718.36d33050770.41
ADL040W33050760.46
ADR308C27850760.46
CAGL0K01727g49972770.49
YOR346W (REV1)98571760.67
YHR006W (STP2)54186750.73
KLLA0D11902g28952740.82
Scas_713.1146571750.82
YHL027W (RIM101)62545750.82
CAGL0E03762g58444741.0
Scas_717.1835467731.2
Sklu_2359.572267741.2
Scas_660.1236764731.2
AFR461C54470731.4
YDL020C (RPN4)53157731.5
AFR531W274116721.6
CAGL0K02343g116267731.6
CAGL0L02783g89140731.6
Scas_605.1789142731.6
YPR022C113351722.3
Kwal_47.1833753678712.3
CAGL0I02816g29155702.4
Kwal_27.1161956852712.4
KLLA0A10373g20660692.5
Kwal_26.930030424702.5
YGL254W (FZF1)29954693.0
Scas_641.2453264703.0
CAGL0G07172g86660694.1
Kwal_55.2063441945694.3
YDR463W (STP1)51964694.7
Scas_641.19104676686.4
CAGL0K04697g51555677.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_681.19
         (864 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_681.19                                                          1609   0.0  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   731   0.0  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   725   0.0  
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   703   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   518   e-169
Kwal_56.23453                                                         509   e-168
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   329   3e-99
Scas_76.1                                                             240   2e-73
Kwal_55.21855                                                         121   1e-28
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   117   1e-26
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   115   3e-26
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   115   5e-26
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   114   5e-26
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          113   2e-25
Scas_691.27                                                           102   4e-22
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    80   2e-15
Scas_709.32                                                            69   1e-11
Scas_602.9                                                             63   5e-10
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            62   7e-10
Kwal_47.17241                                                          62   9e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    58   9e-10
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    62   1e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    62   2e-09
Scas_649.28                                                            62   2e-09
CAGL0L06072g complement(679924..680826) some similarities with s...    60   2e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        57   3e-09
Kwal_26.8351                                                           61   4e-09
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    61   4e-09
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    60   4e-09
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    60   4e-09
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    59   5e-09
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    60   7e-09
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    60   7e-09
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    60   8e-09
Scas_721.92                                                            59   1e-08
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    57   1e-08
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    59   2e-08
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    58   2e-08
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    58   3e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    58   3e-08
Scas_703.23                                                            58   3e-08
Kwal_56.24206                                                          58   3e-08
Kwal_27.10925                                                          56   4e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       57   4e-08
Scas_718.44                                                            55   5e-08
Scas_569.2                                                             55   8e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    56   9e-08
KLLA0F18524g complement(1701498..1702571) some similarities with...    55   9e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    56   1e-07
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    56   1e-07
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    56   1e-07
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    55   2e-07
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    55   2e-07
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    54   2e-07
Scas_707.31                                                            53   3e-07
Kwal_47.16621                                                          55   3e-07
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    55   3e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    54   4e-07
Scas_575.3                                                             53   6e-07
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    53   7e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    52   7e-07
Sklu_2443.22 , Contig c2443 45390-46027                                51   7e-07
Scas_697.35                                                            53   8e-07
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    53   1e-06
Kwal_14.2278                                                           52   1e-06
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    52   1e-06
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    50   1e-06
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    52   2e-06
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    52   2e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    52   2e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    51   3e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    51   3e-06
Kwal_47.17888                                                          51   3e-06
Scas_378.1                                                             49   3e-06
Scas_712.42*                                                           50   5e-06
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    50   5e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    49   6e-06
Scas_717.17                                                            50   7e-06
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    50   7e-06
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    49   1e-05
Scas_693.31                                                            49   1e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    50   1e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    49   1e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    48   2e-05
CAGL0K04631g complement(440721..443762) some similarities with s...    49   2e-05
Scas_683.25                                                            48   3e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   6e-05
Kwal_56.23925                                                          47   7e-05
Scas_719.68                                                            47   7e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    47   8e-05
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    46   2e-04
Kwal_26.8021                                                           45   2e-04
Kwal_47.19045                                                          44   2e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    45   2e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    45   3e-04
KLLA0B00605g complement(46736..47455) some similarities with sp|...    44   3e-04
Kwal_27.11460                                                          45   3e-04
Scas_687.33                                                            44   3e-04
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    43   4e-04
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            44   4e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    44   4e-04
Scas_636.14d                                                           44   4e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    44   5e-04
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    44   6e-04
Scas_568.5                                                             42   6e-04
Scas_627.17d                                                           43   6e-04
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    44   7e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    44   7e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    43   0.001
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    42   0.001
KLLA0F20636g complement(1914452..1915309) some similarities with...    42   0.001
KLLA0E18645g complement(1648263..1649558) some similarities with...    43   0.001
Scas_720.33                                                            42   0.001
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    43   0.001
KLLA0F11682g complement(1068992..1070116) some similarities with...    42   0.001
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    42   0.002
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    42   0.002
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.002
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    42   0.002
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    42   0.003
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    41   0.003
CAGL0E06116g complement(604708..606549) some similarities with t...    41   0.004
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    41   0.005
CAGL0M01870g complement(219813..220760) some similarities with t...    40   0.007
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    40   0.008
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    40   0.008
Scas_717.60d                                                           38   0.009
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    39   0.009
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    40   0.010
Scas_695.2                                                             40   0.010
Kwal_23.5400                                                           40   0.011
Scas_711.56                                                            40   0.011
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    39   0.013
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    39   0.013
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    39   0.013
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    38   0.017
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.022
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    38   0.025
Scas_721.56                                                            37   0.025
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    37   0.026
Kwal_47.16577                                                          39   0.027
Scas_720.39                                                            38   0.035
KLLA0A04609g complement(411494..412765) some similarities with s...    38   0.035
Scas_631.7                                                             38   0.038
Kwal_27.10467                                                          37   0.040
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    38   0.043
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             37   0.044
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    38   0.045
Kwal_14.2543                                                           38   0.046
Scas_627.6                                                             38   0.047
Scas_718.67                                                            37   0.052
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    37   0.068
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    37   0.078
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            37   0.078
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          36   0.10 
Kwal_14.2206                                                           35   0.12 
Kwal_27.11824                                                          35   0.12 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    35   0.18 
Scas_604.4                                                             35   0.25 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    35   0.27 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          35   0.29 
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    35   0.33 
ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH] (174376..17...    35   0.34 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                34   0.35 
Scas_718.36d                                                           34   0.41 
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    34   0.46 
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    34   0.46 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    34   0.49 
YOR346W (REV1) [5123] chr15 (981823..984780) Deoxycytidyl transf...    34   0.67 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    33   0.73 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    33   0.82 
Scas_713.11                                                            33   0.82 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    33   0.82 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    33   1.0  
Scas_717.18                                                            33   1.2  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          33   1.2  
Scas_660.12                                                            33   1.2  
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    33   1.4  
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    33   1.5  
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    32   1.6  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    33   1.6  
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...    33   1.6  
Scas_605.17                                                            33   1.6  
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    32   2.3  
Kwal_47.18337                                                          32   2.3  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   2.4  
Kwal_27.11619                                                          32   2.4  
KLLA0A10373g complement(907244..907864) some similarities with c...    31   2.5  
Kwal_26.9300                                                           32   2.5  
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    31   3.0  
Scas_641.24                                                            32   3.0  
CAGL0G07172g complement(678730..681330) some similarities with Y...    31   4.1  
Kwal_55.20634                                                          31   4.3  
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    31   4.7  
Scas_641.19                                                            31   6.4  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    30   7.1  

>Scas_681.19
          Length = 864

 Score = 1609 bits (4166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/864 (91%), Positives = 789/864 (91%)

Query: 1   MADYSDIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDN 60
           MADYSDIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDN
Sbjct: 1   MADYSDIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDN 60

Query: 61  PPSVEALQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRD 120
           PPSVEALQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRD
Sbjct: 61  PPSVEALQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRD 120

Query: 121 KNKDPDTNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLN 180
           KNKDPDTNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLN
Sbjct: 121 KNKDPDTNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLN 180

Query: 181 FLENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAG 240
           FLENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAG
Sbjct: 181 FLENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAG 240

Query: 241 LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR 300
           LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR
Sbjct: 241 LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR 300

Query: 301 HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI 360
           HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI
Sbjct: 301 HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI 360

Query: 361 GERANKCLCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQ 420
           GERANKCLCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQ
Sbjct: 361 GERANKCLCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQ 420

Query: 421 KKQQVQPIRTFTESNKDVSLRXXXXXXXXXXXXNETNKPVISRVSSPFLSRMMDLSNIVE 480
           KKQQVQPIRTFTESNKDVSLR            NETNKPVISRVSSPFLSRMMDLSNIVE
Sbjct: 421 KKQQVQPIRTFTESNKDVSLRSTSPTPSQFFTTNETNKPVISRVSSPFLSRMMDLSNIVE 480

Query: 481 PTLEDPTLKFKRKLNAPSVSQNNTLPPISMPPLFQSPLLEDNEDNMIALSLANMANSGTS 540
           PTLEDPTLKFKRKLNAPSVSQNNTLPPISMPPLFQSPLLEDNEDNMIALSLANMANSGTS
Sbjct: 481 PTLEDPTLKFKRKLNAPSVSQNNTLPPISMPPLFQSPLLEDNEDNMIALSLANMANSGTS 540

Query: 541 SPRLIIPALXXXXXXXXXXXXXXXXXXXXXLAPKPSLSSSPYVTSNNNNPMTYXXXXXXX 600
           SPRLIIPAL                     LAPKPSLSSSPYVTSNNNNPMTY       
Sbjct: 541 SPRLIIPALNSSIDPINSSSSNGNDRISSILAPKPSLSSSPYVTSNNNNPMTYNSTFSNH 600

Query: 601 XXXXXXXVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGT 660
                  VVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGT
Sbjct: 601 NNNIQNNVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGT 660

Query: 661 LPYSAIPQSSLNQMEXXXXXXXXXXXXXXXXXSELSILNQPPQKKQRLTNGTRSNQRKME 720
           LPYSAIPQSSLNQME                 SELSILNQPPQKKQRLTNGTRSNQRKME
Sbjct: 661 LPYSAIPQSSLNQMELNNPLGNDDTNNNTVTNSELSILNQPPQKKQRLTNGTRSNQRKME 720

Query: 721 LGVEQPSGDGVLIGXXXXXXXXXXXAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHL 780
           LGVEQPSGDGVLIG           AQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHL
Sbjct: 721 LGVEQPSGDGVLIGNSSSNNNNNTNAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHL 780

Query: 781 TRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAIATTATLGASKT 840
           TRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAIATTATLGASKT
Sbjct: 781 TRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAIATTATLGASKT 840

Query: 841 ATTGATPLIEQNGTKVEKQEATVE 864
           ATTGATPLIEQNGTKVEKQEATVE
Sbjct: 841 ATTGATPLIEQNGTKVEKQEATVE 864

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/871 (46%), Positives = 525/871 (60%), Gaps = 123/871 (14%)

Query: 9   PALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQ 68
           P   E G+P+F+P+++EF+DFYK+M  I+++GM+SG+VK+IPP EW++ L   P VE L+
Sbjct: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64

Query: 69  GIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTN 128
            I I++PI+Q +SG+ G+F+  N+ER K+Y+IIQWK+L++DY LP D      +      
Sbjct: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLP-DMRGYGGSLSRSAA 123

Query: 129 NGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYWK 188
            G     PS+  + T    Q SFS EDF+ FQ+++N   E L Q++D+  L  LENYYWK
Sbjct: 124 AGGARPRPSNIRTRT----QDSFSDEDFREFQEHYNV--EGLAQYDDESFLRGLENYYWK 177

Query: 189 TLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFPW 248
           TLNFT PMYGADT G++F ++L+ WNVS+LPNLLD+L++++PGVN S+LYAGLWKASF W
Sbjct: 178 TLNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAW 237

Query: 249 HLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASP 308
           HLEDQDLYSIN++HFGAPKQWYSIPQED   F+ FM+EQFPEE+ +C EFLRHK FM SP
Sbjct: 238 HLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSP 297

Query: 309 KLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKCL 368
           K+L  NGIRCN IVH Q+EFM+T+PYGYH+GFNYGYNLAESVNFALE WL IGE+A KC+
Sbjct: 298 KVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCM 357

Query: 369 CVNDSVEIDVRKLASNWYI------------------FKNKPNLKN-------ETDLRVR 403
           CV+DSV ID++KL S ++                    K +PN  +       +T   ++
Sbjct: 358 CVDDSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLK 417

Query: 404 SFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRXXXXXXXXXXXXNETNKPVISR 463
           SF EL+NHS+ ELQ ++     + IR+ T  N+  S                   P ISR
Sbjct: 418 SFNELINHSAYELQAMEDNPNQRSIRS-TTPNQYFS------------------NPSISR 458

Query: 464 VSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNNTLPPIS------MPPLFQSP 517
           +SSP LSRMMDLSNIVEPTLEDPTLKFKRK+ A   S      P+S             P
Sbjct: 459 MSSPLLSRMMDLSNIVEPTLEDPTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPP 518

Query: 518 LLED-NEDNMIALSLANMANSGTSSPRLIIPALXXXXXXXXXXXXXXXXXXXXXLAPKPS 576
            L + +E++++ALSLA+MANSG SSPR  +P L                     LAP+PS
Sbjct: 519 ALNNLHEESVLALSLASMANSGNSSPRNALPPLNSAVGNSRPYTPTGDAI----LAPRPS 574

Query: 577 LSSSPYVTSNNNNPMTYXXXXXXXXXXXXXXVVPLSPGGRSNLSFIKRIKSPNIVTLNIS 636
                     + NP++Y                      +S +   KRI SPN VTLNIS
Sbjct: 575 Y---------DQNPLSYYSTQTT----------------KSPMPLFKRINSPNRVTLNIS 609

Query: 637 RETSRSPILTSVPDFRSNNNNTGTLPYSAIPQSSLNQMEXXXXXXXXXXXXXXXXXSELS 696
           RE+SRSPI       +   +    L   A+  +SLNQ+                     +
Sbjct: 610 RESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVS--------------------T 649

Query: 697 ILNQPPQKKQRLTNGTRSNQRKMELGVEQPS-------------GDGVLIGXXXXXXXXX 743
           I    P  + R       ++  +  GV                  D  L           
Sbjct: 650 IERNIPSHRDRSAKAYHGDKVNIH-GVSSGKFVGHQINDSLALLNDDALTNSVLPGAGRP 708

Query: 744 XXAQAP--KFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGK 801
             A +P  K +++EII+S+ GK YVC EC+RQF+SGHHLTRHKKSVHSGEKPHSCPKCGK
Sbjct: 709 ERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 768

Query: 802 KFKRRDHVLQHLNKKIPCVPEEGSSNAIATT 832
           KFKRRDHVLQHLNKKIPCV E+    A AT 
Sbjct: 769 KFKRRDHVLQHLNKKIPCVTEKHEDPATATA 799

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/835 (48%), Positives = 504/835 (60%), Gaps = 80/835 (9%)

Query: 7   IKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEA 66
           I P+ I  G+P+FKPT+++F+DFY + +AINK+GM+SG+VKVIPP EW   LD P S E 
Sbjct: 5   IAPSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAET 64

Query: 67  LQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPD 126
           LQ IKIK+PI+Q ISG  GLFM  N+E++KTY+IIQWK+LSKDY  P+DP +R  ++   
Sbjct: 65  LQKIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGS 124

Query: 127 TNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYY 186
            +    +++         +  + SF+ +DF+ F+  +      L  F + ERL FLE YY
Sbjct: 125 VSKSTKLKL---------KNFESSFNIDDFEQFRTEYTID---LSDFQNTERLKFLEEYY 172

Query: 187 WKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASF 246
           WKTLNFT PMYGADT GSIF E LNVWNV+KLPN+LD+++ ++PGVNDS+LYAGLWKASF
Sbjct: 173 WKTLNFTTPMYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASF 232

Query: 247 PWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMA 306
            WHLEDQDLYSIN+IHFGAPKQWYSIPQED   FY FM+EQFPEEAK CPEFLRHK F+A
Sbjct: 233 SWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLA 292

Query: 307 SPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANK 366
           SPKLL ENGIRCN+IVH++ EFMIT+PYGYHAGFNYGYNLAESVNFALEEWL IG++A K
Sbjct: 293 SPKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGK 352

Query: 367 CLCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQKKQQVQ 426
           C C++DSVEIDV+KLA +W             + +    T  LN    +L N       +
Sbjct: 353 CHCISDSVEIDVKKLAKSW-----------RDNNKESKGTPPLN----QLPNPAMPLLHR 397

Query: 427 PIRTFTESNKDVSLRXXXXXXXXXXXXNETNKPVISRVSSPFLSRMMDLSNIVEPTLEDP 486
           P     ES+   SLR                K   S VSSP LSRM D SNIVEPTLEDP
Sbjct: 398 PTLKEMESS---SLRSTSPDVGHFSNF----KSKSSGVSSPLLSRMKDYSNIVEPTLEDP 450

Query: 487 TLKFKRKLNAPSVSQNNTLPPISMPPLFQSPLLEDNEDNMIALSLANMANSGTSSPRLII 546
           TLK KR     S  Q   L  +      Q+ +L D+EDN++A+SL +MANS  SSPRL +
Sbjct: 451 TLKLKRI----SSFQEQPLNKLLKRETSQTAMLTDHEDNIVAMSLTSMANSAASSPRLPL 506

Query: 547 PALXXXXXXXXXXXXXXXXXXXXXLAPKPSLSSSPYVTSNNNNPMTYXXXXXXXXXXXXX 606
             L                       P+P+  S         NP+ Y             
Sbjct: 507 SRLNSSNELSNAQPLLDMTNNTLAF-PRPNGPSGL-------NPLLYISNKNISGISHSA 558

Query: 607 XVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGTLPYSAI 666
              P++P    N+S IKR+KSPNIVTLNISRE+SRSPI                L Y A 
Sbjct: 559 PHSPVNP----NISLIKRVKSPNIVTLNISRESSRSPI---------------ALNYEAR 599

Query: 667 PQSSLNQMEXXXXXXXXXXXXXXXXXSELSILNQPPQKKQRLTNGTRSNQRKMELGVEQP 726
            Q S                      S+ + +  P    +R  + T +   K E  VE  
Sbjct: 600 QQHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTP--HPERPNHKTANRILKKESPVETS 657

Query: 727 SGDGVLIGXXXXXXXXXXXAQAPKFTSDE-------------IIMSETGKVYVCLECKRQ 773
             + +L             ++      ++             I++S   K+Y+C EC+R+
Sbjct: 658 KSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRK 717

Query: 774 FTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNA 828
           F+SGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKIPC+  E + +A
Sbjct: 718 FSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPCISNETTVDA 772

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/900 (45%), Positives = 533/900 (59%), Gaps = 158/900 (17%)

Query: 8   KPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEAL 67
           +P   E  +P+FKP ++ F+DFYKFM  +NK+GM+SGI+K++PP +W+  +  PPS E L
Sbjct: 4   EPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETL 63

Query: 68  QGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDT 127
           Q IKIK PI+Q ISG+ G+F+  N+E+ K+Y++IQWK LS DY LP+  HS  KN+D   
Sbjct: 64  QKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSA-KNED--- 119

Query: 128 NNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYW 187
                IE P   S+    K   SF+ +DF+ F++NFN   + L+QF+D++R+ FLE+YYW
Sbjct: 120 --SSGIE-PHQQSNKVRSKCLDSFTLDDFEKFRENFN--CDHLEQFDDEQRVEFLESYYW 174

Query: 188 KTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFP 247
           KTLNFT PMYGAD+ GS+F +++  WN+S LP++L+YLD+++PGVN+S+LYAGLWKASF 
Sbjct: 175 KTLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFA 234

Query: 248 WHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMAS 307
           WHLEDQDLYSIN+IHFGAPKQWYSIPQED + FYNFM+EQFPEE+K C EFLRHK F+ S
Sbjct: 235 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVS 294

Query: 308 PKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKC 367
           PKLL  NGIRCN IVH Q EF++T+P+GYHAGFNYGYNLAESVNFAL  WL+IG +A KC
Sbjct: 295 PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKC 354

Query: 368 LCVNDSVEIDVRKLASNWY-----------------------------IFKNKPNLK--- 395
           LC++D+V I+V+KL SN+                              + + +P LK   
Sbjct: 355 LCIDDAVGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFK 414

Query: 396 -NETDL---RVRSFTELLNHSSQELQN------IQKKQQVQPIRTFTESNKDVSLRXXXX 445
             ++D     V+S  E L  ++ +L +               IR+ T +++   L     
Sbjct: 415 MGDSDRSFDSVKSTPEFLLKTNSDLLDEKANLDNLNNNNNSSIRSTTPNSQKTGLYGFGI 474

Query: 446 XXXXXXXXNETNKPVISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRK----LNAPSVSQ 501
                   N +    ISRVSSP LSRMMDLS+IVEPTLEDPTLKFK+K    +      Q
Sbjct: 475 KKEGAFNSNTS----ISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMAQQ 530

Query: 502 NNTLPPISMPPL-------------FQSPLLEDNEDNMIALSLANMANSG---------- 538
               PP +  PL             F SP   D+EDNMIALSLA MANS           
Sbjct: 531 QAIFPPPAQNPLPAPSGQMSPSENAFFSP-SHDHEDNMIALSLALMANSSPAFNQLPPLN 589

Query: 539 TSSPRLIIPALXXXXXXXXXXXXXXXXXXXXXLAPKPSLSSSPYVTSNNNNPMTYXXXXX 598
            S+PR   P L                     L+P+PS          N+N ++Y     
Sbjct: 590 ISNPRPYSPIL-----------------QDSILSPRPSY---------NSNVLSYGQAGN 623

Query: 599 XXXXXXXXXVVPLSPGGRSN---LSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNN 655
                      PL  GG S+   L FIKRI+SPN VTLNISRE+SRSP+  S+     N 
Sbjct: 624 TKS--------PL--GGFSSSTQLPFIKRIQSPNRVTLNISRESSRSPV--SLSGMYGNP 671

Query: 656 NNTGT---LPYSAIPQSSLNQMEXXXXXXXXXXXXXXXXXSELSILNQPPQKKQRLTNGT 712
           N        PY +   S+LNQ+                  +E S    PP    +     
Sbjct: 672 NAMMVPIPHPYQSSQTSTLNQV----------------STAERSPAVTPPTSPSKNKPAR 715

Query: 713 RSNQRKMELGVEQPSGDGVLIGXXXXXXXXXXXAQAPKFTSDEIIMSETG-KVYVCLECK 771
           +   ++ +  ++  S    L             AQ+ K   +EI+  + G KVYVC EC 
Sbjct: 716 KKAPKQPKAKIDPESPTSAL-------------AQS-KINDEEIMFLDDGSKVYVCQECA 761

Query: 772 RQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAIAT 831
           RQF+SGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVP++ ++  + +
Sbjct: 762 RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPDQDTAPKVGS 821

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  518 bits (1333), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 300/385 (77%), Gaps = 2/385 (0%)

Query: 12  IEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQGIK 71
           + DG+P+F+P ++EFKDF  +ME I   GM SGIVKVIPP EWL      P  + L+ ++
Sbjct: 3   VVDGVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVR 62

Query: 72  IKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTNNGK 131
           I+NPI+Q +SG+ G++M +N+E++KTY++IQWK+LS D+ +P DP S     +    + +
Sbjct: 63  IRNPIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNE 122

Query: 132 TIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYWKTLN 191
             +    +SS    K   S ++EDF+NF K +N   E ++ F+D+ERL FLE+YYWKTLN
Sbjct: 123 RSQQRRRSSSGIKLKNCDSATEEDFQNFMKEYNA--ENIRDFDDEERLKFLESYYWKTLN 180

Query: 192 FTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFPWHLE 251
           FT P+YGAD+SGSIF  +L  WNV+KLPN+L ++D++IPGVN ++LYAGLWKASF WHLE
Sbjct: 181 FTTPLYGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLE 240

Query: 252 DQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASPKLL 311
           DQDLYSIN+IHFGAPKQWYSIPQEDH+ FY FM+E+FPEEA KC EFLRHK F+ SPK+L
Sbjct: 241 DQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVL 300

Query: 312 SENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKCLCVN 371
            EN I+CNK+ HY++EF+IT+PYGYHAGFNYGYNLAESVNFALE+WLEIG++A KC C++
Sbjct: 301 KENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCIS 360

Query: 372 DSVEIDVRKLASNWYIFKNKPNLKN 396
           DSVE+DV KLA NW  FK K  +++
Sbjct: 361 DSVEVDVDKLAENWSNFKKKREIED 385

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%)

Query: 746 AQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 805
           AQ PKF   E+I+S++GK+YVC ECKRQF+SGHHLTRHKKSVHSGEKPHSCPKCGK+FKR
Sbjct: 883 AQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKR 942

Query: 806 RDHVLQHLNKKIPCVPEEGSS 826
           RDHVLQHLNKKIPC+P  GSS
Sbjct: 943 RDHVLQHLNKKIPCIPGVGSS 963

 Score =  117 bits (294), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 133/287 (46%), Gaps = 66/287 (22%)

Query: 401 RVRSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRXXXXXXXXXXXXNETNKPV 460
           ++R F ELLN S Q    ++   +  P        +D  LR            +      
Sbjct: 490 KLRGFDELLNRSPQNSPRMETSLKNDPFFA-----RDSPLRSNSPGTNLFFNQS------ 538

Query: 461 ISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPS--VSQNNTLPP----------- 507
           I R+SSP LS+M+DLSNIVEPTL+DPTLKFKRK N PS  +  +N   P           
Sbjct: 539 IQRMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLQNIQDQQNQ 598

Query: 508 ---------------ISMPP----LFQSP-LLEDNEDNMIALSLANMANSGTSSPRLIIP 547
                          +S  P    L  +P LL++N+DNM+ALSL +MANS  SSPRL   
Sbjct: 599 QQQQQRSQNGTPLSNLSFGPMRSGLGSNPVLLDNNDDNMLALSLTSMANSRPSSPRLHHI 658

Query: 548 ALXXXXXXXXXXXXXXXXXXXXXLAPKPSLSSSPYVTSNNN----------NPMTYXXXX 597
            +                            ++S +VTS +N           P+ Y    
Sbjct: 659 NIPNEANSKMKSGSNDTVN-----------AASNFVTSGSNVQQGMSVVSPKPVPYYGNQ 707

Query: 598 XXXXXXXXXXVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPI 644
                      +P+SPGG SN+ FIKR+KSPNIVTLNISRE S+SP+
Sbjct: 708 FERTFNSMPSPIPMSPGG-SNMPFIKRLKSPNIVTLNISREGSKSPV 753

>Kwal_56.23453
          Length = 828

 Score =  509 bits (1312), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 301/400 (75%), Gaps = 11/400 (2%)

Query: 5   SDIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSV 64
           S++ P+  E G+P+F+P ++ FKDFY++M A++K+G +SGIVKVIPP EWL  L+ PP V
Sbjct: 2   SEVAPSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGV 61

Query: 65  EALQGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKD 124
           E LQ I+I+ PI+Q  +G+ G+F+  N+E+SK+Y+IIQWK++S DY LP        + +
Sbjct: 62  ETLQKIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSSE 121

Query: 125 PDTNNGKTI---EMPSSTSSATHRKRQ-HSFSKEDFKNFQKNFNESDEILKQFNDKERLN 180
            D   G T+   + PS   S+  + R   SFS  +F+ F  ++N  +  L  F D  R  
Sbjct: 122 ADA--GDTLGARKSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDN--LGDFRDPSRRE 177

Query: 181 FLENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAG 240
           FLE+Y+WKTL FT PMYGAD+ GS+F + L+VWNVSKLPN+LD+++ ++PGVN S+LYAG
Sbjct: 178 FLESYFWKTLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAG 237

Query: 241 LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR 300
           LWKASF WHLEDQDLYSIN+IHFGAPKQWYSIPQED   FY FM+EQFPE A KC EFLR
Sbjct: 238 LWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLR 297

Query: 301 HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI 360
           HKTF+ SPK+L +NGIRCNKIVHYQ EF+IT+PYGYHAGFNYGYNLAESVNFALE WL+I
Sbjct: 298 HKTFLVSPKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDI 357

Query: 361 GERANKCLCVNDSVEIDVRKLASNWYIFKN---KPNLKNE 397
           G +A +CLC++D+V IDV KL  +W   K    KP +K+E
Sbjct: 358 GIKAKRCLCIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHE 397

 Score =  148 bits (374), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (86%)

Query: 750 KFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 809
           K  S+EII+S+ GKVYVC EC+RQF+SGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV
Sbjct: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 779

Query: 810 LQHLNKKIPCVPEEGSSNAIATT 832
           LQHLNKKIPC  E G S +  +T
Sbjct: 780 LQHLNKKIPCTAEGGQSPSSKST 802

 Score =  140 bits (354), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 131/252 (51%), Gaps = 48/252 (19%)

Query: 394 LKNETDLRVRSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRXXXXXXXXXXXX 453
           L N+ + R++ F ELL+HSS ELQ ++   Q   IR+ T +                   
Sbjct: 459 LTNKENPRMKGFNELLHHSSYELQAMEDNPQQSAIRSTTPNPGQYYSGLSQS-------- 510

Query: 454 NETNKPVISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNNTLPPISMPPL 513
                  ISR+SSP LSRMMDLSNIVEPTLEDPTLKFK+  N   +SQ N+  P      
Sbjct: 511 -------ISRISSPLLSRMMDLSNIVEPTLEDPTLKFKKSSN---LSQQNSQTP------ 554

Query: 514 FQSPLLEDNEDNMIALSLANMANSGTSSPRLIIPALXXXXXXXXXXXXXXXXXXXXXLAP 573
               +LEDN+DNM+ALSLA+MA SG SSPR  +P +                     +A 
Sbjct: 555 ---QVLEDNDDNMLALSLASMA-SGASSPRYPLPPI-------------QPRPYSPAVAG 597

Query: 574 KPSLSSSPYVTSNNNNPMTYXXXXXXXXXXXXXXVVPLSPGGRSNLSFIKRIKSPNIVTL 633
              L+S P       NP +Y                P SP   SNL FIKR+KSPN VTL
Sbjct: 598 DSMLASGPLY---EQNPFSYYSTNFKSTMGSPQ---PSSP-ALSNLPFIKRLKSPNRVTL 650

Query: 634 NISRETSRSPIL 645
           NISRE+SRSPIL
Sbjct: 651 NISRESSRSPIL 662

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  329 bits (844), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 191/511 (37%), Positives = 282/511 (55%), Gaps = 63/511 (12%)

Query: 6   DIKPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVE 65
           +IKP  + DG+P+FKP+  EF +F  F++ I KFG+++GIVKVIPP EWL+LL+  P  E
Sbjct: 2   EIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAE 61

Query: 66  ALQGIKIKNPIEQEIS----GTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDK 121
           +L+ I++ +PI+Q+        +G+F   N   +K+Y++ QWK L++             
Sbjct: 62  SLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAE------------- 108

Query: 122 NKDPDTNNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNF 181
                              S   R  Q  F+ +  K   +  ++ D       D  +L  
Sbjct: 109 -------------------SLDSRISQGDFNDKTLKENCRVDSQQDCY-----DLAQLQI 144

Query: 182 LENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGL 241
           LE+ +WKT+ F+ P Y  D + SIF  +L +WN++ LP+ ++  ++         L  G 
Sbjct: 145 LESDFWKTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQ 196

Query: 242 WKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRH 301
            K  FPWHL++Q+  SIN++HFGAPKQWYSIP  +   F   + ++     + CP F+RH
Sbjct: 197 SKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRH 256

Query: 302 KTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIG 361
           +  + SP  L +N I+ N++V +Q+EF+ITFPY  ++GFNYGYN  ES+ F L++   + 
Sbjct: 257 QNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVR 316

Query: 362 ERANKCLCVNDSVEIDVRKLA--SNWYIFKNKPNLK-----NETDL--RVRSFTELLNHS 412
           ++  KC C N   E   RK    SN     N+   +     N+ DL  +VRSF ELLNHS
Sbjct: 317 KQPLKCGCGNKKEE---RKSGPFSNLSYDSNESEQRGSITDNDNDLFQKVRSFDELLNHS 373

Query: 413 SQELQNIQKKQQVQPIRTFTESNKDVSLRXXXXXXXXXXXXNETNKPVISRVSSPFLSRM 472
           SQELQN++  +   P+ +    N+  S                 N+  ISR+SSP LSRM
Sbjct: 374 SQELQNLEDNK--NPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRM 431

Query: 473 MDLSNIVEPTLEDPTLKFKRKLNAPSVSQNN 503
           MDLSNIVEPTL+DP  KFKRK+  P + Q N
Sbjct: 432 MDLSNIVEPTLDDPGSKFKRKVLTPQLPQMN 462

 Score =  181 bits (458), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 166/356 (46%), Gaps = 74/356 (20%)

Query: 516 SPLLEDNEDNMIALSLANMANSGTSSPRLIIPALXX------------------------ 551
           S L  DN+DNM+ALSLA +ANS T+SPRL +P L                          
Sbjct: 555 SGLGGDNDDNMLALSLATLANSATASPRLTLPPLSSPMNPNGHTSYNGNMMNNNSGNGSN 614

Query: 552 ------XXXXXXXXXXXXXXXXXXXLAPKPSLSSSP---YVTSNNNNPMTYXXXXXXXXX 602
                                    ++P P+ S +P   Y+T N+ NP+           
Sbjct: 615 GSNSYSNGVTTAAATTTSAPHNLSIVSPNPTYSPNPLSLYLT-NSKNPLN---------- 663

Query: 603 XXXXXVVPLSPGGRSNLSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSNNNNTGTLP 662
                + PLSP   SN+ F+KR    N+VTLNISRE S+SPI + V D+RS    +  L 
Sbjct: 664 ---SGLAPLSPS-TSNIPFLKR---NNVVTLNISREASKSPISSFVNDYRSPLGVSNPLM 716

Query: 663 YSAIPQSSLNQMEXXXXXXXXXXXXXXXXXSELSILNQPPQKKQRLTNGTRSNQRKME-- 720
           YS+      N                    S       P  KK ++ NG  ++       
Sbjct: 717 YSSTINDYSNGTGIRQNSNNINPLDAGPSFS-------PLHKKPKILNGNDNSNLDSNNF 769

Query: 721 ----LGVEQPSGDGVLIG----------XXXXXXXXXXXAQAPKFTSDEIIMSETGKVYV 766
                G +Q S   +L                       A + KF  +E+IMS+ GK+Y+
Sbjct: 770 DYSFTGNKQESNPSILNNNTNNNDNYRTSSMNNNGNNYQAHSSKFGENEVIMSDHGKIYI 829

Query: 767 CLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPE 822
           C EC RQF+SGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRDHVLQHLNKKIPC  E
Sbjct: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIPCTQE 885

>Scas_76.1
          Length = 228

 Score =  240 bits (612), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 160/226 (70%), Gaps = 23/226 (10%)

Query: 91  NIERSKTYHIIQWKELSKDYTLPQ-----DPHSR------------DKNKDPDTNNGKTI 133
           N+E++K Y+IIQWK+LS DY  P+     DP ++            +++ + +TN+    
Sbjct: 3   NVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEHVT 62

Query: 134 EMPSSTS---SATHRKRQH-SFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYWKT 189
           +   S S   S+  + R H +F+ EDF+ F  ++N   E L Q  +  RL FLE+YYW+T
Sbjct: 63  QKKKSQSPMKSSKIKLRNHENFTLEDFEEFLPSYN--CENLSQLTEPSRLEFLESYYWRT 120

Query: 190 LNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFPWH 249
           LNFT PMYGADT GS+FN+ L+ WNVS+LPNLLD++D+ +PGVNDS+LYAGLWKASF WH
Sbjct: 121 LNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWH 180

Query: 250 LEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKC 295
           LEDQDLYSIN++HFGAPKQWYSIPQ+D   FY FM++QFPE+A K 
Sbjct: 181 LEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDAAKL 226

>Kwal_55.21855
          Length = 521

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 109/216 (50%), Gaps = 17/216 (7%)

Query: 214 NVSKLPN----LLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQW 269
           N+  LP+    LL    K+I G+   ++Y G   ++F WHLEDQ   S NF H G PK W
Sbjct: 140 NLVNLPSAKGSLLSVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANFQHEGDPKVW 199

Query: 270 YSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASP--KLLSENGIRCNKIVHYQNE 327
           YSIP      F   MR+  P+  +K P+ L     + +P      +  I C K + Y  E
Sbjct: 200 YSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQLVTLIAPYDSAFKDAKISCYKAIQYPGE 259

Query: 328 FMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERA------NKCLCVNDSVEIDVRKL 381
           ++ITFP  YH+GFN GYN  E+VNF L+ WL  G  A      +K  CV D  E+ +  L
Sbjct: 260 YIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPYGIEATHDYIESKKRCVFDMWELMLTVL 319

Query: 382 ASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQ 417
                 +   P L +E  +R R   ELL   +QE++
Sbjct: 320 VE----YLEDPTLFDEALIR-RCHLELLEKFNQEVK 350

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 95/178 (53%), Gaps = 10/178 (5%)

Query: 194 MPMYGADTSGSIFNENLNV----WNVSKLP----NLLDYLDKEIPGVNDSFLYAGLWKAS 245
           +P +  D     F + L V    WN+  LP    +LL  ++++I G+   ++Y G   ++
Sbjct: 427 VPPFITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMTIPWIYVGSTFST 486

Query: 246 FPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFM 305
           F WHLEDQ   S N+ H G+ K WYSIP+     F   M+   P+  ++ P+ L     +
Sbjct: 487 FCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFERQPDLLHQLITL 546

Query: 306 ASP--KLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIG 361
            SP  K   E GI C K +    E+++T+P  YHAGFN G+N  E+VNF L+ WL  G
Sbjct: 547 VSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWLPYG 604

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 16 IPIFKPTFQEFKDFYKFMEA--INKFGMQSGIVKVIPP 51
          IP  +P+ ++F D   F+ +  + K GM+ G++K+IPP
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPP 41

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 104/209 (49%), Gaps = 13/209 (6%)

Query: 220 NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQL 279
           +LL    + I G+   +LY G   ++F WHLEDQ   S N+ H G PK WYSIP++    
Sbjct: 404 SLLPVFGRSISGMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEQSATA 463

Query: 280 FYNFMREQFPEEAKKCPEFLRHKTFMASP--KLLSENGIRCNKIVHYQNEFMITFPYGYH 337
           F   M+   P+  +K P+ +     + SP  +      I C K V Y  E++IT+P  YH
Sbjct: 464 FNKLMKNIAPDLFEKQPDLMHQLVTLISPYDEKFEAANIACYKAVQYPGEYIITYPKCYH 523

Query: 338 AGFNYGYNLAESVNFALEEWLEIGERANKCL------CVNDSVEIDVRKLASNWYIFKNK 391
           AGFN GYN  E+VNF L+ W+  G  A++        CV D  E+ +  L      +  +
Sbjct: 524 AGFNTGYNFNEAVNFTLDLWVPYGLSASEDYRLTGKRCVFDMWELMLNVLLQ----YLER 579

Query: 392 PNLKNETDLRVRSFTELLNHSSQELQNIQ 420
           P    E  +R R   EL N    E++ IQ
Sbjct: 580 PQTHQEALIR-RCHLELQNIFHSEMKYIQ 607

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 16 IPIFKPTFQEFKDFYKFME--AINKFGMQSGIVKVIPP 51
          +P+  PT  EF+D   ++   A+ + G   G+VK++PP
Sbjct: 9  VPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVPP 46

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  115 bits (287), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 115/236 (48%), Gaps = 17/236 (7%)

Query: 214 NVSKLP----NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQW 269
           N++ LP    +LL    + I G+   ++Y G   ++F WH+EDQ   S N+ H G PK W
Sbjct: 388 NLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDPKVW 447

Query: 270 YSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASPKL--LSENGIRCNKIVHYQNE 327
           YSIP+     F + + +  P+   K P+ L     + SP      ++GI   K V   NE
Sbjct: 448 YSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQKPNE 507

Query: 328 FMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERA------NKCLCVNDSVEIDVRKL 381
           ++ITFP  YHAGFN GYN  E+VNF ++ WL  G  A       +  CV D  ++ +  L
Sbjct: 508 YIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGAITDYKLTQKACVFDMFDLMINVL 567

Query: 382 ASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKD 437
                   NK  L        + ++ L+   + EL+ I+K Q + P  T  E + D
Sbjct: 568 DK-----YNKDTLLFNDAFVRQCYSSLIVFYNTELKRIRKIQAIVPRTTLLEVHTD 618

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 16 IPIFKPTFQEFKDFYKFME--AINKFGMQSGIVKVIPPTEW-------LKLLDNPPSVEA 66
          IP   PT QEFK+   ++    I + G++ G+VKV+PP  +       ++     P ++ 
Sbjct: 4  IPALYPTEQEFKNPIDYLSNPHIKRLGVRYGMVKVVPPNGFCPPLSIDMENFTFQPRIQN 63

Query: 67 LQGIKIKN 74
          L+ + +KN
Sbjct: 64 LENLDLKN 71

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 11/208 (5%)

Query: 220 NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQL 279
           +LL +L++ I G+   ++Y G   ++F WHLEDQ   S N+ H G+PK WYSIP      
Sbjct: 400 SLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWYSIPDNSCDN 459

Query: 280 FYNFMREQFPEEAKKCPEFLRHKTFMASPK--LLSENGIRCNKIVHYQNEFMITFPYGYH 337
           F+  + +  P+  +K P+ L     + SP   L  +  ++  K V + NE+++TFP  YH
Sbjct: 460 FHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNEYIVTFPKCYH 519

Query: 338 AGFNYGYNLAESVNFALEEWLEIGERA------NKCLCVNDSVEIDVRKLASNWYIFKNK 391
           AGFN GYN+ E+VNF  E WL  G  A       K + V D  E+ V  L    Y   N 
Sbjct: 520 AGFNTGYNINEAVNFTSESWLPYGLEAISDYQLTKKMPVFDMYELMVNILVM--YYRDNL 577

Query: 392 PNLKNETDLRVRSFTELLNHSSQELQNI 419
           P+  ++  L+     ELL++ ++E +NI
Sbjct: 578 PSPVSDAFLQ-HCHHELLSYINKETRNI 604

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 16 IPIFKPTFQEFKDFYKFME--AINKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQGIKIK 73
          +P+  PT +EF D   ++   A+ + G   G+V+++PP  +     NPP        K K
Sbjct: 6  VPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPPAGF-----NPPLALDKARFKFK 60

Query: 74 ----NPIEQEISGTHGLFMSNNI 92
              N  E ++     LF  NN+
Sbjct: 61 VRWQNLNELQLLNRARLFFINNL 83

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 111/214 (51%), Gaps = 13/214 (6%)

Query: 220 NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQL 279
           +LL    K+I G+   ++Y G   ++F WHLEDQ   S N+ H G PK WYSIP+     
Sbjct: 421 SLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEHSCDK 480

Query: 280 FYNFMREQFPEEAKKCPEFLRHKTFMASP--KLLSENGIRCNKIVHYQNEFMITFPYGYH 337
           F   M++  P+  +K P+ L     + SP  K   +  I C K +    E++ITFP  YH
Sbjct: 481 FNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQKPGEYIITFPKCYH 540

Query: 338 AGFNYGYNLAESVNFALEEWLEIGERANKCL------CVNDSVEIDVRKLASNWYIFKNK 391
           AGFN GYN  E+VNF L+ WL  G  A +        CV D  E+ +  L    Y+    
Sbjct: 541 AGFNTGYNFNEAVNFTLDTWLPYGIEACQDYKDTGKQCVFDMWELMLNVLIQ--YLENKT 598

Query: 392 PNLKNETDLRVRSFTELLNHSSQELQNIQKKQQV 425
           P   NE+ +R R   ELLN  + +++ I++  +V
Sbjct: 599 PF--NESLVR-RCHLELLNIFNGDVKIIKQLHRV 629

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 16 IPIFKPTFQEFKDFYKFME--AINKFGMQSGIVKVIPPTEW 54
          +P+  PT QEF+D   ++    + + G   G++K++PP E+
Sbjct: 7  VPVLYPTLQEFEDPISYLSQPQVQRQGHICGMIKLVPPREF 47

>Scas_691.27
          Length = 735

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 119/263 (45%), Gaps = 36/263 (13%)

Query: 159 FQKNFNESDEILKQFNDKERLNFLENYYWKTLN--------FTMPMYGADTSGS------ 204
            Q   NE +E     +  + ++ LE  +W+ +N         ++ MYGAD   S      
Sbjct: 316 LQNFINECEE-----DTSKSIDQLEKEFWEKVNDNSISNNPSSLIMYGADIHNSEQISGF 370

Query: 205 -IFNENL---------NVWNVSKLPNLLDYL-----DKEIPGVNDSFLYAGLWKASFPWH 249
            + N  L         +  N+  LPN L  L     +K I G+   ++Y G   ++F WH
Sbjct: 371 PLSNHALEKGSSKYVSHPMNLVNLPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWH 430

Query: 250 LEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMASPK 309
           +EDQ   S N+ H GA K WYSIP    + F   +    P+   K  + +     + SP 
Sbjct: 431 MEDQYTLSANYQHEGASKIWYSIPASSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSPY 490

Query: 310 LLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIG-ERANKCL 368
            L ++ I C K +   NE++ITFP  +H+GFN GYNL E+VNF    WL  G E  +   
Sbjct: 491 DLPKS-INCYKAIQNPNEYIITFPKCFHSGFNTGYNLNEAVNFTTPFWLPFGVEAVDDYK 549

Query: 369 CVNDSVEIDVRKLASNWYIFKNK 391
                   DV +L  N   + NK
Sbjct: 550 LTQRKCAFDVNELLLNLIKYMNK 572

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 704 KKQRLTNGTRSNQRKMELGVEQPSGDGVLIGXXXXXXXXXXXAQAP---KFTSDEIIMSE 760
           K Q  T  T    +K+ L + QPSG  +L+                   +  + +I  S+
Sbjct: 499 KIQTNTKSTFPVAKKLRL-LPQPSGFSLLVPEETFLSDDESSKNVESLGQIFNSKIRYSD 557

Query: 761 TGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819
             K + C  C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL KK PC
Sbjct: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKTPC 616

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 77/189 (40%), Gaps = 6/189 (3%)

Query: 182 LENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDY-LDKEIPGVNDSFLYAG 240
           LEN +W+        Y +  S  I ++ +    ++K    L+Y L  E P   +  +   
Sbjct: 132 LENIFWEH----QYAYTSYYSSLILDKTVPQNEINKELYDLEYILSSERPDCKEK-IKLC 186

Query: 241 LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR 300
            +    PW ++  + Y + F  FG P QWY +   +     +++++  P+ ++ C  F  
Sbjct: 187 CFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYI 246

Query: 301 HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI 360
           HK +   P  L    I    +V    +  I+ P      F+YGY++        ++ +  
Sbjct: 247 HKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKCDQTIFT 306

Query: 361 GERANKCLC 369
            +     LC
Sbjct: 307 AQHVFPALC 315

>Scas_709.32
          Length = 822

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
            S+  K + C  C + F    HL RH +SVHS E+P +CP C KKF R D++ QH+
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>Scas_602.9
          Length = 547

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           ++ +  K + C  C+R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +  K + C  C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>Kwal_47.17241
          Length = 403

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +  K + C  C R+F    HL RH +S+H GEKP  C  CGKKF R D++ QH+
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 58.2 bits (139), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           E  + ++C  C + FT+  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K + C  C+R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 458 KPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 748 APKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 807
            PK TS    M E  K + C +C + F    HL RH +SVHS E+P  C  C KKF R D
Sbjct: 607 GPKSTSP---MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSD 663

Query: 808 HVLQHL 813
           ++ QHL
Sbjct: 664 NLSQHL 669

>Scas_649.28
          Length = 730

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           + +  K + C EC + F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 666 LDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHL 721

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           ++ +  K++ C  C+R+F    HL RH  S+H GE+P+SC  C K F R D++ QH
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           E  + YVC  C R FT+  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>Kwal_26.8351
          Length = 698

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 38/68 (55%)

Query: 746 AQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 805
           ++ P+ +     + E  K + C EC + F    HL RH +SVHS E+P  C  C KKF R
Sbjct: 622 SKPPRNSKSSSPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSR 681

Query: 806 RDHVLQHL 813
            D++ QHL
Sbjct: 682 SDNLSQHL 689

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +++VC  C R F    HLTRH++S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +  K + C +C++ F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +  K + C  C R+F    HL RH +S+H  EKP+ C  CGKKF R D++ QHL
Sbjct: 413 DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 790 GEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819
             KP  C  C ++FKR++H+ +H+     C
Sbjct: 414 ASKPFGCEYCDRRFKRQEHLKRHIRSLHIC 443

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           ++ +  K + C  C R+F    HL RH +S+H GEKP+ C  C KKF R D++ QH+
Sbjct: 256 LVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 756 IIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           + + +  K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 475 VELPDGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           + E  K + C EC + F    HL RH +SVHS ++P  C  C KKF R D++ QHL
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +++VC  C R F    HL RHK+S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHAHK 98

>Scas_721.92
          Length = 1152

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +++VC  C R F    HL RH +S H+ EKP+ C  C KKF RRD +L+H  K
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 4/62 (6%)

Query: 753 SDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVL 810
           SDE  + +  K Y+C  C R FT+  HL RH + +H+GEK H CP   C ++F R D+ L
Sbjct: 163 SDEEDLEQRRK-YICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFSRHDNCL 220

Query: 811 QH 812
           QH
Sbjct: 221 QH 222

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 24/108 (22%)

Query: 708 LTNGTRSNQRKMELGVEQPSGDGVLIGXXXXXXXXXXXAQAPKFTSDEIIMSETGKVYVC 767
             NG +SN  K       P+G G+L                P      II ++  + ++C
Sbjct: 117 FVNGNQSNFAK-------PAGQGIL----------------PIPKKSRIIKTDKPRPFLC 153

Query: 768 LECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
             C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+H  K
Sbjct: 154 PTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLRHQQK 200

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 6/62 (9%)

Query: 753 SDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVL 810
           SD+I   E  + Y+C  C + FT+  HL RH + +H+GEK H CP   CG++F R D+ L
Sbjct: 393 SDDI---ELRRKYLCKVCGKGFTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRHDNCL 448

Query: 811 QH 812
           QH
Sbjct: 449 QH 450

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +++VC  C R F    HLTRH++S H+ EKP+ C  C ++F RRD +++H  K
Sbjct: 123 RLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHCQK 174

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 10/88 (11%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK---IPC 819
           K YVC  C+R+FT    L RH + +H G        CG   +R    ++  +KK      
Sbjct: 151 KPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKKDNGAVL 203

Query: 820 VPEEGSSNAIATTATLGASKTATTGATP 847
            P   S       +T+  +   ++  TP
Sbjct: 204 DPSSSSETDTPNNSTVSPNSDVSSSVTP 231

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K + C  C + F    HL RH +SVHS E+P +C  C KKF R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>Scas_703.23
          Length = 1341

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 756 IIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +I ++  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 63  VIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQHK 121

>Kwal_56.24206
          Length = 1502

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 86/222 (38%), Gaps = 52/222 (23%)

Query: 202 SGSIFNENLNVWNVSKLP----NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYS 257
           SG      L+ WN++ +     ++L YLD +     D+ L  G+  +   W +ED  L S
Sbjct: 498 SGDSLPGALSPWNLNNVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIEDNFLAS 557

Query: 258 INFIHFGAPKQWYSIPQEDHQLFYNFMR----------------------------EQFP 289
           I++ H G+ K WY IP +D + F   +                             + F 
Sbjct: 558 IHYHHVGSSKLWYVIPPQDMEKFERLIEFYESQPQDVESSYPNGVETKQFEKSEFYQSFL 617

Query: 290 EEAKKCPEFLR---------HKTFMAS-----------PKLLSENGIRCNKIVHYQNEFM 329
           +     P  +R         +K F +S           P+ L ++GI   K+V     F+
Sbjct: 618 DTTPSRPTSMRPHRVNTHTLNKNFQSSNSTLANDWNFHPETLKDHGITVYKVVQDPRSFI 677

Query: 330 ITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKCLCVN 371
             FP  Y +  + G++++E   FA   WL I     K L  N
Sbjct: 678 FRFPKSYSSNISSGFSVSEFALFAPTSWLGIAIEGEKWLSKN 719

>Kwal_27.10925
          Length = 264

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 812
           E  + YVC  C + FT+  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 196 EQRRRYVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + YVC  C R F    H TRH ++ H+GEKPH+C  P CGK+F R D + +H
Sbjct: 32  RPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>Scas_718.44
          Length = 266

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           + +VC  C   FT+  HL+RH + +H+GEK HSCP   C +KF R D+ LQH
Sbjct: 208 RKHVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>Scas_569.2
          Length = 293

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 720 ELGVEQPSGDGVLIGXXXXXXXXXXXAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHH 779
           E+G   PS DG                   K   +E +  E  + Y+C  C + FT+  H
Sbjct: 185 EMGYYYPSEDGSKKHRISKRQRAIMVKDLKKRKHEEEL--EKRRKYICKVCSKGFTTSGH 242

Query: 780 LTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           L RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 243 LARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K + C  C + F    HL RH +SVHS ++P SC  C KKF R D++ QH+
Sbjct: 533 KPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + Y+C  C R FT+  HL RH + +H+GEK H C  P C ++F R D+ +QH
Sbjct: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K +VC  C ++FT G +L  H++ +H+GEKP+SC  C KKF R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C  C R F+   HL  H +S H G KP  C  CGK+F +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (47%), Gaps = 6/121 (4%)

Query: 748 APKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 807
           AP       I ++  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD
Sbjct: 16  APIPKKSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRD 74

Query: 808 HVLQHLNKKIPCVPE---EGS-SNAIATTATLGASKTA-TTGATPLIEQNGTKVEKQEAT 862
            VL+H  K  P +     EGS  N+   + + G+  ++    A   I  N  KV    AT
Sbjct: 75  LVLRHQYKLHPTLVSKNNEGSLDNSRNNSVSPGSDNSSDALKAEAAINDNIIKVSGNRAT 134

Query: 863 V 863
           +
Sbjct: 135 I 135

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           ++C  C R F    HL RH+ S H+ EKP  C  CGK F R+D VL+HL K
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHLQK 76

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 756 IIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +I ++  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 74  LIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 132

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           I ++  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 53  IKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQHK 110

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           ++ +  K + C  C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 381 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>Scas_707.31
          Length = 289

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           I+ +  K Y C  CK++F    HL RH +++H   +P  C  C K+F R D++ QH+
Sbjct: 215 ILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHV 271

>Kwal_47.16621
          Length = 1178

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           I ++  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H  K 
Sbjct: 70  IKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRHQQKL 128

Query: 817 IPCVPEEG 824
              + + G
Sbjct: 129 HSTLADSG 136

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           I ++  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 72  IKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 129

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 759 SETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           SE  + + C  C R F    H TRH + +H+GEKPH+C  P C K+F R D + +H
Sbjct: 32  SEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRSDELTRH 86

>Scas_575.3
          Length = 455

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 15/94 (15%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH-------- 812
           + +VC  C+R F    H TRH ++ H+GEKPH C  P C KKF R D + +H        
Sbjct: 66  RPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQ 124

Query: 813 ----LNKKIPCVPEEGSSNAIATTATLGASKTAT 842
                 +K   V ++   NA      LG S T +
Sbjct: 125 PRGKRGRKKKVVTDQTGGNATGAKFELGESTTTS 158

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           YVC  C+R F    H TRH +  H+GE+PH+C  P C K+F R D + +H
Sbjct: 26  YVCPICQRGFHRLEHQTRHIR-THTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 783 HKKSVHS----GEKPHSCPKCGKKFKRRDHVLQHL 813
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 812
           E  + ++C  C   FT+  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           I ++  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 40  IKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 97

>Scas_697.35
          Length = 839

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 757 IMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           I S  G K Y C  C ++FT G +L  H++ +H+GEKP+ C  C KKF R+ ++  HL
Sbjct: 534 IRSHLGYKPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           + E  K + C  C R F    HL  H +S H G KP+ C  CGK+F +  ++  H
Sbjct: 508 LHEGSKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 785 KSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 761 TGKV--YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           +GK+  +VC  C R F    HL RH +S H+ EKP+ C  C + F RRD +++H  K
Sbjct: 98  SGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>Kwal_14.2278
          Length = 463

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           E+ + Y+C  C R F    H TRH ++ H+GEKPH+C    C K+F R D + +H
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + +VC  C R F    H TRH ++ H+GEKPH+C  P C K+F R D + +H
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 792 KPHSCPKCGKKFKRRDHVLQHL 813
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
           E  ++Y C +C+ +F+    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 90  EGAQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 76/205 (37%), Gaps = 54/205 (26%)

Query: 208 ENLNVWNVSKLP----NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHF 263
           E L+ WN++ +P    +LL YLD +   +    ++ G+  ++  W L DQ L +I + H 
Sbjct: 539 ELLDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHL 598

Query: 264 GAPKQWYSIPQEDHQLFYNFM-------REQFPEEAKKCPEF------------------ 298
           G    WY I  E  + F   +       R+   +E    PEF                  
Sbjct: 599 GCSLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRL 658

Query: 299 -----LRHKT--------------------FMASPKLLSENGIRCNKIVHYQNEFMITFP 333
                LR K                         P+ L + GI+    +     F+I +P
Sbjct: 659 NDTHKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYP 718

Query: 334 YGYHAGFNYGYNLAESVNFALEEWL 358
             Y+     G++++ES   A E WL
Sbjct: 719 RAYNTSIAAGFHVSESCYLAPESWL 743

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + YVC  C R F    H TRH ++ H+GEKPH+C    CGK+F R+D + +H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD----HVLQHLNKK 816
           K + C  C ++FT G +L  H + +H+GE+P+ C KCGK+F R+     H+L H N K
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHMLTHENYK 569

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 816
           K + C  C + FT   HL  H +S H G KP  C  CGK+F +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           M  + + Y+C  C + F+   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 1   MVASQRKYICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           M  + + Y+C  C + F+   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 1   MVASQRKYICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C  C ++FT G +L  H + +H+GEKP+ C +CG+KF R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 816
           K + C  C + FT   HL  H +S H G KP SC  CGK+F +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 757 IMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 813
           I   TG K Y C  C R+F+   +L  HK + H   KP  C    C K F +  ++  H 
Sbjct: 570 IRLHTGEKPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQ 628

Query: 814 NK 815
           N+
Sbjct: 629 NR 630

>Kwal_47.17888
          Length = 786

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C  C ++FT G +L  H + +H+GEKP+ C KCG++F R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 816
           K + C  C + FT   HL  H +S H G KP  C  CGK+F +    R HV  H  +K
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

>Scas_378.1
          Length = 208

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           +  +T  VY C  C + F     L RH  + HS ++ +SCPKC  K KR+D++LQHL  K
Sbjct: 76  VERDTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>Scas_712.42*
          Length = 290

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 813
           + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 18  FRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 812
           + C  C   FT+  HL+RH + +H+GEK H CP   CG++F R D+  QH
Sbjct: 153 HFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQH 201

>Scas_717.17
          Length = 525

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           VY+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 83/213 (38%), Gaps = 48/213 (22%)

Query: 193 TMPMYGADTSGSIFNE-NLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFPWHLE 251
           T  M  +D +  + +  NLN  N+S+  +LL Y D +   +    +  G+  ++  W LE
Sbjct: 522 TSKMASSDETKRLIDAWNLNTINLSE-KSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALE 580

Query: 252 DQDLYSINFIHFGAPKQWYSIP--------------------QEDHQLFYNFMREQFPEE 291
           D+ L  ++F + G+ K WY +P                    +   Q   +F    F + 
Sbjct: 581 DEFLPLLDFSYLGSSKVWYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQS 640

Query: 292 AKKCPEFLRHKT--------------------------FMASPKLLSENGIRCNKIVHYQ 325
            ++     +HKT                          F  S   LS + IR  K++   
Sbjct: 641 FQETNFLDQHKTSRKRSINHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDP 700

Query: 326 NEFMITFPYGYHAGFNYGYNLAESVNFALEEWL 358
             F++ +P  Y    + G+ ++E   FA EEW+
Sbjct: 701 KTFIMKYPQVYSTSISSGFQISEKSLFAPEEWV 733

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           + ++  + YVC EC + F     L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 175 VQNKAPQRYVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>Scas_693.31
          Length = 635

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 765 YVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 817
           Y C    C + F   H L RHKK VHS EK ++CP CGKKF R D ++ H ++ I
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI 570

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           M+   K Y+C  C + F+   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 1   MAAGQKKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 36/86 (41%), Gaps = 9/86 (10%)

Query: 730 GVLIGXXXXXXXXXXXAQAPKFTSDEIIMSETGKVYVCLE---CKRQFTSGHHLTRHKKS 786
           GVL             A  PK +      S   K + C     C   FT   HL RH + 
Sbjct: 11  GVLTSSNGNFATNSVAASTPKRSK-----SARRKTFKCTGYDGCTMSFTRAEHLARHIRK 65

Query: 787 VHSGEKPHSCPKCGKKFKRRDHVLQH 812
            H+GEKP  CP C K F R D++ QH
Sbjct: 66  -HTGEKPFQCPACLKFFSRVDNLKQH 90

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 813
           + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 761 TGKV--YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           TGK   + C  C + F+   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 6   TGKTKRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>Scas_683.25
          Length = 879

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K ++C  C + F+   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C  C ++FT   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           Y C  C + F+   HL  H K+ H G KP  C  CGK+F +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

>Kwal_56.23925
          Length = 745

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAI 829
           C + F   H L RHKK+    EK + CP CGKKF R D +L H ++ I CV  +  SN +
Sbjct: 622 CHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI-CVGAKKYSNVV 677

>Scas_719.68
          Length = 1350

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 757 IMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           I ++  + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++  K 
Sbjct: 33  IKTDKPRPFLCPICTRT----EHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQTKL 87

Query: 817 IPCVPEEGSS---NAIATTA 833
              +    ++   N +A+TA
Sbjct: 88  HSSIMNNSATHNDNILASTA 107

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 765 YVCLE--CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 817
           Y C    C + F   H L RHKKS    EK ++CP CGKKF R D ++ H ++ I
Sbjct: 580 YSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI 631

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCV 820
           C + F   H L RHKK+    EK  +CP CGKKF R D +L H  + I CV
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI-CV 757

>Kwal_26.8021
          Length = 507

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>Kwal_47.19045
          Length = 266

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 817
           + C  C + F    H  RH ++ H+GEKPHSC  P C K+F R D + +H+   +
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           C++ F   H L RHKKS    EK +SC  CGKKF   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 760 ETGKVYVC--LECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +  KVY C    C + FT    LT H+ +VH G KP  C  CGK+F ++ H+ +H+
Sbjct: 101 QRSKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 751 FTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL 810
            T  ++ +    K + C  C ++F    HL RH  S H+ +KP +C  CGK    R  + 
Sbjct: 123 LTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLK 181

Query: 811 QH 812
           +H
Sbjct: 182 RH 183

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 813
           Y+C  C  +F    H TRH ++ H+GEKP +C  P C K+F R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>Kwal_27.11460
          Length = 531

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           + +   VY C  C ++FT  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 406 LQKNASVYACELCDKKFTRPYNLKSHLRT-HTDERPFSCAICGKAFARQHDRKRH 459

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 813
           + C  C + F   H   RH+  +H+G+K ++C           CGKKF R D + +H 
Sbjct: 441 FSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

>Scas_687.33
          Length = 288

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 813
           + C  C R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C +C  +F+    L RH+K+ H    P+ CP+CGK F R+D + +H
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRH 144

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGS--SN 827
           C + FT    L RH K VHSG KP  CP C KKF   D + QH+       P + +  + 
Sbjct: 635 CSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTK 693

Query: 828 AIATTATLGASKTATTGATPL 848
             AT+++L       TG  PL
Sbjct: 694 QFATSSSLRIHIRTHTGEKPL 714

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 750 KFTSDEI----IMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 804
           KF++++I    I + +G + + C  C +QF +   L  H ++ H+GEKP  C  CGK+F 
Sbjct: 666 KFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICGKRFN 724

Query: 805 RRDHVLQHL 813
              ++ +H+
Sbjct: 725 ESSNLSKHM 733

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 759 SETGKVYVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           +++G+ YVC    CKR+F+    L +H+ + H+ E+P+ C  P CGK+F R  H+  H
Sbjct: 51  TKSGRKYVCQIDGCKREFSVPSLLAQHRNA-HTDERPYVCDEPNCGKRFLRPCHLRVH 107

>Scas_636.14d
          Length = 275

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNKKIPCVPE 822
           + C  C R F    H  RH ++ H+GEKPH C    C K F R D + +HL      V  
Sbjct: 17  FRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQR 75

Query: 823 -----EGSSNAIATTAT 834
                +GS   +  TAT
Sbjct: 76  RRIKSKGSRKTVVNTAT 92

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 805
           VY C  C ++FT  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 20/100 (20%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQH--- 812
           YVC  C + F   H   RH+  +H+G++ + C           CGKKF R D + +H   
Sbjct: 497 YVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT 555

Query: 813 -LNKK--IPCVPE---EGSSNAIATTATLGAS-KTATTGA 845
            L KK  +P   E   E  +N  + TA  G S K+ T G+
Sbjct: 556 ELGKKCILPLYEEAELEKKANEASQTADAGGSGKSRTDGS 595

>Scas_568.5
          Length = 199

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
           K Y C +C+  F     L RH+K+ H    PH C +CGK F R+D + +H N
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFN 166

>Scas_627.17d
          Length = 275

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAI 829
           C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I C+  +  +N +
Sbjct: 593 CDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI-CIGGKKYANVV 648

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 15/101 (14%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKF-----KRRDHVLQHLNKKIPC 819
           YVC  C + F+  ++L  H ++ H+ EKP+ C  CGK F     K+R   L    K+  C
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVC 579

Query: 820 VPEE------GSSNAIATTATLGASKTATTG---ATPLIEQ 851
             +       G     A +  LG     ++G    TPL E+
Sbjct: 580 GGKLKDGTFWGCGKKFARSDALGRHFKTSSGRKCITPLYEE 620

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 813
           K Y C  C + F   H   RH+  +H+G+K + C           CGKKF R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRHE-DLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           ++ C  C++ F     L RH  S HS  KP+SCP C  + KR+D++ QHL  K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           + C  C R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 762 GKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 813
           GK  +C +C +QFT    L  H   VHSG+KP  C    C KKF  + ++++HL
Sbjct: 229 GKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKSNLIRHL 281

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           E+   Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>Scas_720.33
          Length = 316

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 763 KVYVCL---ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C    +C   FT   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 7/73 (9%)

Query: 747 QAPK-FTSDEI----IMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCG 800
             PK F++D+I    I + +G + + C  C++QF++   L  H ++ H+GEKP SC  CG
Sbjct: 548 HCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCG 606

Query: 801 KKFKRRDHVLQHL 813
           K+F    ++ +H+
Sbjct: 607 KRFNESSNLSKHM 619

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH--LNKKIPCV 820
           Y C EC + F     L+ H  ++H+G+KP+ C  P C K+F  + ++L+H  L+ K P V
Sbjct: 304 YRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTPKV 362

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           +Y C  C ++FT  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFARQHDRKRH 472

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 37/97 (38%), Gaps = 17/97 (17%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHLNK 815
           + C  C + F   H   RH+  +HSG+K + C           CGKKF R D + +H   
Sbjct: 454 FSCSVCGKAFARQHDRKRHED-LHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKT 512

Query: 816 KIPCVPEEGSSNAIATTATLGASKTATTGATPLIEQN 852
                  E     IA      + + A     PL E +
Sbjct: 513 -------ESGRRCIAPLYDEASKERAANNMAPLTEND 542

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 89/244 (36%), Gaps = 58/244 (23%)

Query: 210 LNVWNVSKLP----NLLDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFG- 264
           L+ WN+  +P    +LL +LD ++     +    G+  +   W + D  L SI+F H G 
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 265 -------APK--------------QWYSIPQE------DHQL-------FY-NFM----- 284
                  APK              +W +I         D +L       FY +F+     
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 285 ----------REQFPEE--AKKCPEFLRHKTFMASPKLLSENGIRCNKIVHYQNEFMITF 332
                     +  FPE+  A           F+  P  +  NGI+  K    Q  ++  F
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 333 PYGYHAGFNYGYNLAESVNFALEEWLEIGERANKCLCVNDSV-EIDVRKLASNWYIFKNK 391
           P  +      G+ L+++  FA   WL     A K       +  +DV +L  N  +  N 
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAKWTSKMGFLPGLDVNQLLINALLNSNN 718

Query: 392 PNLK 395
           P L+
Sbjct: 719 PVLR 722

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 765 YVCL---ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           Y C+   +C   F    HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 19  YRCVGYPDCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH---LNKKIPC 819
           + Y C +C R FT   HL RH  S HS  KP SC  CGK    R  + +H     K   C
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRHEITHTKSFKC 206

Query: 820 VPEEGSSNA 828
            P EG   A
Sbjct: 207 -PHEGCGEA 214

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C + FT    LT H+++ H G + + C +CG+ F ++ H+ +HL
Sbjct: 126 CYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHL 169

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKF 803
           K Y C  CKR F+S   L +H ++ HSGEKP+ C  C KKF
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 751 FTSDEIIMSETG-----KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 805
           F+S+E ++  T      K Y C  C ++F     L  H ++ H+GEKP  C  CGK+F  
Sbjct: 777 FSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRT-HTGEKPLQCKICGKRFNE 835

Query: 806 RDHVLQHL---NKKIPC 819
             ++ +H+    KK  C
Sbjct: 836 SSNLSKHIKTHQKKYKC 852

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 755 EIIMSETGKV-YVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 811
           E +    GK  Y CL  +C R F     L RH K VHS  KP+ C  C + F   + ++Q
Sbjct: 727 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLK-VHSKYKPYKCKTCKRCFSSEETLVQ 785

Query: 812 H 812
           H
Sbjct: 786 H 786

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 769 ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +C+ +FT   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 27  DCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           C+  F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 754 DEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           ++I +S     + C  C + F     L RH  S HS ++   CP C  + KRRD++LQH+
Sbjct: 523 EKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQHM 581

Query: 814 N-KKIPCVPEE 823
             K +P + +E
Sbjct: 582 KLKHVPNLLQE 592

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           ++C  C ++F     L+ H  ++H+GEKP+ CP   C K F  + ++L+H
Sbjct: 173 FICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKSFNAKSNMLRH 221

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKF 803
           K Y C +C++ F++   L +HK+ VHSGEKP+ C  C K+F
Sbjct: 595 KPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 754 DEIIMSETGKVYVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 811
           +E+ +++    Y C    C + F+    L RH K VHS  KP+ CP+C K F   D + Q
Sbjct: 556 EEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTEDTLNQ 614

Query: 812 H 812
           H
Sbjct: 615 H 615

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K Y C  C ++F   + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 623 KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 763 KVYVC--LECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 815
           K Y C    C + F   H L RHKK   + +K  SCP CGKKF     +++H N+
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>Scas_717.60d
          Length = 167

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 752 TSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 811
           +S EI+ S   +++ C EC + F +   L +H K  HS         CGK FKR+D    
Sbjct: 88  SSCEILTS--NELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKS 145

Query: 812 H 812
           H
Sbjct: 146 H 146

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 38.9 bits (89), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 762 GKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           GK + C +C+  F     L RH+K VH    P+ C  CGK F R+D + +H 
Sbjct: 144 GKRFHCTKCELVFRRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKRHF 194

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           C R FT   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>Scas_695.2
          Length = 571

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
            Y C  C + FT  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

>Kwal_23.5400
          Length = 429

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C + F+    LT H++ VH G KP  C  C ++F R+ H+ +H+
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHM 100

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 750 KFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGK----KFKR 805
           + T  + ++ +  K + C  C RQF+   HL RH  S HS +KP  C  CGK    K + 
Sbjct: 66  QLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQL 124

Query: 806 RDHVLQHLNKKIPCVPEEGSSNAIATTATLGA 837
           R H + H    +   P EG   +      L A
Sbjct: 125 RRHEITHTRSFV--CPHEGCEESFYKHPQLRA 154

>Scas_711.56
          Length = 832

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKF 803
           K + C  CK+ F++   L +H+++ HSGEKP  C  CGK+F
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN---KKIPC 819
           K + C  C ++F     L  H ++ H+GEKP  C  CGK F    ++ +H+    K+  C
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHMKTHLKRFKC 810

Query: 820 VPEEGSSNAIA 830
              E S N ++
Sbjct: 811 EKCEASFNTVS 821

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           C + F+    L RH + VHSG KP  C  C K F   + + QH
Sbjct: 703 CHKIFSQRQRLVRHMR-VHSGYKPFQCSICKKHFSNEETLKQH 744

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 759 SETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816
           S+   ++ C  C++ F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 340 SDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 813
           ++C  C + F   H   RH+  +H+G+K + C           CGKKF R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRHE-DLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           + C  C ++FT  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 817
           C + F   H L RHK S H+ +K + CP CGK+F R D ++ H ++ I
Sbjct: 640 CTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI 684

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
           K+Y C  C   +     L +H+++ H  ++ + C  CGKKF R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 763 KVYVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K Y C    C + FT    LT H+ SVH G +   C KC K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 751 FTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVL 810
            T  ++ + +  + + C +C + F    HL RH  + HS  KP  C  CGK    R  + 
Sbjct: 66  LTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGKGVTTRQQLK 124

Query: 811 QH--LNKKIPCVPEEGSS 826
           +H   + K    PEEG +
Sbjct: 125 RHEVTHTKSFICPEEGCN 142

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 763 KVYVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K Y+C    C + FT    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K + C +C+  FT   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 65  KPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>Scas_721.56
          Length = 199

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 759 SETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           S TG  + C +C+  F     L RH+K+ H    P+ C +CGK F R+D + ++ 
Sbjct: 111 SRTG--FQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKDALKRYF 162

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 37.4 bits (85), Expect = 0.026,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 759 SETGKVY-VCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           SE   VY  C +C  +F     L RH+++ H    P+ C +CGK F R+D + +H
Sbjct: 135 SEEDTVYHYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>Kwal_47.16577
          Length = 881

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKIPCVPE 822
           C + F+   HL RHK + HS EK + C  P CG++F R D   +H  + +  V E
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHLRDVDE 72

>Scas_720.39
          Length = 1455

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 44/225 (19%), Positives = 79/225 (35%), Gaps = 54/225 (24%)

Query: 189 TLNFTMPMYGADTSGSI-FNENLNVWNVSKLP----NLLDYLDKEIPGVNDSFLYAGLWK 243
            L+    +Y A+T   +   E  N W +  +P    +LL YLD ++     +    G++ 
Sbjct: 474 ALDLPSTIYPAETKFKLNIQEYNNPWRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGMFL 533

Query: 244 ASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFL---- 299
           +   W + D  L SI++ H G+ K WY +  +D +     M+    E  K   + L    
Sbjct: 534 SVAGWSVTDNFLPSIDYHHMGSSKLWYVVSPKDLEKLEALMKNVDTEIEKTQTQMLASIS 593

Query: 300 ------RHKTFMA---------------------------------------SPKLLSEN 314
                   + F+A                                       +   L +N
Sbjct: 594 LNDNFKESEFFIAYDMTKQTNFSIQTSADFRKDLSLTKENNFEQPSKPASLFTTAFLKKN 653

Query: 315 GIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLE 359
           GI    +      ++ T+P  Y +    G  L++   FA + WL+
Sbjct: 654 GIEVRTVSQDSGSYIFTYPKTYTSYIGAGVYLSQHATFAPKSWLK 698

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 762 GKVYVCLE-CKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHLNK 815
            + ++C   C R  T   HL     S+H+G+KP+ CPK  C K+F  + ++L+H  +
Sbjct: 341 NQCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>Scas_631.7
          Length = 433

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C + FT    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 749 PKFTSDEIIMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 807
           P   S+  +    G K + C +C +QF+   HL RH  S HS  KP  C  CGK    R 
Sbjct: 71  PSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQ 129

Query: 808 HVLQH 812
            + +H
Sbjct: 130 QLKRH 134

>Kwal_27.10467
          Length = 302

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           Y C +C + F     L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 15/83 (18%)

Query: 746 AQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP-------- 797
           +Q P   SDE    ET   +VC  C  +F    +LTRH K  H+ EK + CP        
Sbjct: 225 SQVPTDKSDE--KKETDMKFVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPS 281

Query: 798 --KCGKK--FKRRDHVLQHLNKK 816
             +C     F RRD    HL  +
Sbjct: 282 EKRCHSTGGFSRRDSYKTHLRSR 304

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           K Y C +C+  F     L RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 123 KKYQCDKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 171

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 669 CNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 746 AQAPKFTSDEIIMSETGKVYV------CLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKC 799
           A+  K  + + I+++  +V+       C  C + +++   L  H ++ H+GEKP SCP C
Sbjct: 695 AECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPIC 753

Query: 800 GKKFKRRDHVLQHL 813
            K+F    ++ +H+
Sbjct: 754 NKRFNESSNLAKHI 767

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 816
           K + C EC + F +   LT+H + VHSGE+P  C  C K +      R H+  H  +K
Sbjct: 690 KPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEK 746

>Kwal_14.2543
          Length = 711

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 767 CLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 816
           C+ C + F++   L +H ++ HSGEKP+ C  CGK F      R H+  H  +K
Sbjct: 608 CVHCLKTFSTQDILQQHMRT-HSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEK 660

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           K Y C  C + F +   L  H ++ H+GEKP  C  CGK+F    ++ +H+
Sbjct: 632 KPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKHM 681

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 38/88 (43%), Gaps = 5/88 (5%)

Query: 765 YVC--LECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPE 822
           YVC    C R  T    L RH + VH+  KP  C  C K F  +D + QH+       P 
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHMRTHSGEKPY 634

Query: 823 EGS--SNAIATTATLGASKTATTGATPL 848
           + S      AT+++L       TG  PL
Sbjct: 635 KCSHCGKGFATSSSLRIHIRTHTGEKPL 662

>Scas_627.6
          Length = 1207

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 14/77 (18%)

Query: 746 AQAPKFTSDEIIMSETGKVYVCL--ECKRQFTSGHHLTRHKKSVHSGEKPHSCP------ 797
           A AP   S ++ ++E    Y+C   +C + FT   HL+RHK + H  ++   CP      
Sbjct: 26  ASAPVQKSAKLAVTER---YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIFPNT 81

Query: 798 --KCGKKFKRRDHVLQH 812
              C K F R+D +++H
Sbjct: 82  NITCNKTFVRKDLLIRH 98

>Scas_718.67
          Length = 473

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 18/79 (22%)

Query: 756 IIMSETGKVYVCL--------ECKRQFTSGHHLTRHKKSVHSGEKP-HSCPKC------- 799
           I  S T + Y C          C  QF+  + LTRH+ ++H+ +K    C +C       
Sbjct: 370 ITESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNE 429

Query: 800 --GKKFKRRDHVLQHLNKK 816
              K F R D + +H+  K
Sbjct: 430 GYDKTFSRLDALTRHIKSK 448

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 774 FTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812
           FT   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGK 801
           K + C  C R F    HL  H +S H G+KP+ C  CGK
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C  +     H+T H + VH   KP  C  CGKKFKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 763 KVYVCLE--CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH--LNKKIP 818
           + +VC E  C + F    HL  HK S HS  KP +CP C K F     + +H   +K +P
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRHKKTHKDLP 94

Query: 819 CVPEE 823
             P+E
Sbjct: 95  SPPQE 99

>Kwal_14.2206
          Length = 254

 Score = 35.4 bits (80), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 767 CLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           C  C + F+    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHA-LIHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>Kwal_27.11824
          Length = 199

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 762 GKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
            K + C +C+  F     L RH+++ H    P+ C  CGK F R+D + +H +
Sbjct: 116 AKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 4/85 (4%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCVPEEGSSNAI 829
           C  +     H+T H + VH   KP SC  C +KFKR   + +HL   +    +E S    
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHLKVHMEDTMKERSR--- 168

Query: 830 ATTATLGASKTATTGATPLIEQNGT 854
           A   + G  KT     + L E+  T
Sbjct: 169 AAPGSRGVRKTGVNKGSALQEKART 193

>Scas_604.4
          Length = 585

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C  +     H+T H + VH   KP +C KC KKFKR   + +HL
Sbjct: 224 CFTKTVKRDHITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 769 ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +C+ +     H+T H + VH   KP +C  C KKFKR   + +HL
Sbjct: 153 DCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 14/83 (16%)

Query: 746 AQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP-------- 797
           +Q PK   +EI   E    YVC  C  +F    +LTRH K  H+ EK + CP        
Sbjct: 144 SQNPK-DGEEIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPP 201

Query: 798 --KCGKK--FKRRDHVLQHLNKK 816
             +C     F RRD    HL  +
Sbjct: 202 ESRCHTTGGFSRRDTYKTHLKSR 224

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 13/77 (16%)

Query: 758 MSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKR 805
           + +  K +VC  C  +F    +LTRH K  H+ EK + CP          +C     F R
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 806 RDHVLQHLNKKIPCVPE 822
           RD    H+  +    PE
Sbjct: 250 RDTYKTHMKARHLIYPE 266

>ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH] (174376..178806)
            [4431 bp, 1476 aa]
          Length = 1476

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 50/119 (42%), Gaps = 17/119 (14%)

Query: 36   INKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQGIKIKNPIEQE--ISGTHGLFMSNNIE 93
            +N FG   G+ ++       + LD    VE +   K K+P+EQE   +G   +F     +
Sbjct: 1033 LNNFGGLKGLTEMTKVVSIYEKLDGDEDVEMVDDEKFKDPVEQENQETGLDEIFRDEKHD 1092

Query: 94   RSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTNNGKTIEMPSS-TSSATHRKRQHSF 151
            +S  ++ I              P   D NK  D  +G++IE  S  TS  T   R  SF
Sbjct: 1093 QSVKFNDI--------------PRIIDVNKSWDRYDGESIEDTSGNTSHGTDENRPASF 1137

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
            Y C +CK++F     L  H   +H G  P  C  P C KKF  + ++L+H
Sbjct: 215 TYCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>Scas_718.36d
          Length = 330

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812
           Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L+H
Sbjct: 239 YFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNMLRH 287

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 767 CLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLN 814
           CL C R+ T    L  H   +H+GE P  C  P C K+F  R ++ +H+N
Sbjct: 260 CLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 8/50 (16%)

Query: 766 VC-LECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812
           VC  EC+R  T   H+       H+G++P SC  P C K F  R ++L+H
Sbjct: 208 VCGRECRRPSTLKTHML-----THTGQRPFSCRHPGCSKSFNVRSNMLRH 252

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 15/72 (20%)

Query: 755 EIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKP-HSCPKC---------GKKFK 804
           E++ S T +V     C  QF+  + LTRH+ ++H+ ++    C +C          K F 
Sbjct: 408 ELVNSVTNEV-----CGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFS 462

Query: 805 RRDHVLQHLNKK 816
           R D + +H+  K
Sbjct: 463 RLDALTRHIKAK 474

>YOR346W (REV1) [5123] chr15 (981823..984780) Deoxycytidyl
           transferase, involved in mutagenic translesion DNA
           synthesis [2958 bp, 985 aa]
          Length = 985

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%)

Query: 87  FMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTNNGKTIEMPSSTSSATHRK 146
           F+++    S+ +H+  WK   KD  L ++ H   K  D DT     I+     ++  +  
Sbjct: 315 FLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLC 374

Query: 147 RQHSFSKEDFK 157
           R  SFS  DFK
Sbjct: 375 RSSSFSACDFK 385

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 17/86 (19%)

Query: 753 SDEI--IMSETGKV--YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------K 798
           SDE+  I  E+ +   Y+C  C  +F    +LTRH K  H+  K + CP          +
Sbjct: 188 SDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDNSISQELR 246

Query: 799 C--GKKFKRRDHVLQHLNKKIPCVPE 822
           C     F RRD    HL  +    PE
Sbjct: 247 CHTSGGFSRRDTYKTHLKSRHFTYPE 272

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
           K + C +C   F     L RH++  H    P+ C  CGK F R+D + +H +
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFD 252

>Scas_713.11
          Length = 465

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 18/71 (25%)

Query: 764 VYVCLE--------CKRQFTSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKFKR 805
           +Y C+         C  QF+  + L RH+ ++H+ +K    C +C          K F R
Sbjct: 369 IYTCMMLDLITDAPCSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKTFSR 428

Query: 806 RDHVLQHLNKK 816
            D + +HL  K
Sbjct: 429 LDALSRHLKSK 439

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 769 ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +C  +     H+T H + VH   KP  C  C KKFKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           C  +     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 196 CTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL 238

>Scas_717.18
          Length = 354

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 748 APKFTSDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKR 805
            PK TS      +  +++ C  C +  T    L  H   +H+GEKP+ C  P C      
Sbjct: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSSSV 337

Query: 806 RDHVLQH 812
           + ++ +H
Sbjct: 338 KSNITRH 344

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 9/67 (13%)

Query: 755 EIIMSETGKVYVCLE--CKRQFTSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKR 805
           E +  +    YVC    C + FT   HL+RHK +    E        P     C + F R
Sbjct: 6   ETVQQQGKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVR 65

Query: 806 RDHVLQH 812
           RD +++H
Sbjct: 66  RDLLVRH 72

>Scas_660.12
          Length = 367

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKRRDHVLQH 812
           YVC  C+ +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 813 LNKK 816
           L  +
Sbjct: 155 LKAR 158

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 13/70 (18%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKRRDHVLQH 812
           +VC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTH 210

Query: 813 LNKKIPCVPE 822
           L  +    PE
Sbjct: 211 LRSRHFIYPE 220

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 770 CKRQFTSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKFKRRDHVLQHLNKK 816
           C  QF+  + LTRH+ ++H+  K    C +C          K F R D + +H+  K
Sbjct: 450 CGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGYQKTFSRLDALTRHIKSK 506

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 43/116 (37%), Gaps = 20/116 (17%)

Query: 724 EQPSGDGV---LIGXXXXXXXXXXXAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHL 780
           EQ SGD      I            AQ+P F  D         VY C  C   F    +L
Sbjct: 119 EQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS-------AVYRCSYCPSNFKVRGYL 171

Query: 781 TRHKKSVHSGEKPHSCP------KC--GKKFKRRDHVLQHLNKKIPCVPEEGSSNA 828
           TRH K  H   K   CP      +C    +F R+D    HL K I  V   G++ A
Sbjct: 172 TRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL-KSIHFVYPVGTTKA 225

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 756 IIMSETGKV-YVCLE--CKRQFTSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKR 805
           +++ E G+  Y C    C + F+   HL+RHK +    E        P S   CGK F R
Sbjct: 35  MVVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVR 94

Query: 806 RDHVLQH 812
           RD + +H
Sbjct: 95  RDLLNRH 101

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 156 FKNFQKNF--NESDEILKQFNDKERLNFLENYYWKTLNFT 193
            K FQ+NF  NE   ILK   D++ L+FL + YWK  N  
Sbjct: 560 IKEFQENFHRNELKSILKASLDQKILDFLASRYWKDDNLV 599

>Scas_605.17
          Length = 891

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 153 KEDFKNFQKNFN--ESDEILKQFNDKERLNFLENYYWKTLNF 192
           K   K FQ+ FN  E   ILK   D++ L+FL   YWK  NF
Sbjct: 556 KLSIKEFQEKFNRNELKSILKADLDQKVLDFLATRYWKDENF 597

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 769 ECKRQFTSGHHLTRHKKS-------VHSGEKPHSCPKCGKKFKRRDHVLQH 812
           EC + F+   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>Kwal_47.18337
          Length = 536

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 14/78 (17%)

Query: 752 TSDEIIMSETG-KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KCG 800
           T DE   +  G K +VC  C  +F    +LTRH K  H+ EK + CP          +C 
Sbjct: 143 TEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNADAPKDARCH 201

Query: 801 KK--FKRRDHVLQHLNKK 816
               F RRD    HL  +
Sbjct: 202 TTGGFSRRDTYKTHLRSR 219

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 815
           K Y C  CK++F+   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 789 SGEKPHSCPKCGKKFKRRDHVLQH 812
           +GEKP+ C  C K+F R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>Kwal_27.11619
          Length = 568

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 15/52 (28%)

Query: 792 KPHSCPKCGKKF--------KRRDHVLQH--LNKKIPCVPEEGSSNAIATTA 833
           KP+ C  CGK+F        + RDH+  H  +NK+I     +G+S A  TTA
Sbjct: 379 KPNKCSTCGKRFGTSEEEKKQERDHLDWHFRINKRI-----KGTSGANGTTA 425

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 758 MSETGKVYVC--LECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 813
           M +  K YVC    C ++++    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>Kwal_26.9300
          Length = 304

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 792 KPHSCPKCGKKFKRRDHVLQHLNK 815
           KPH CP CG+ F R + +L+H  +
Sbjct: 171 KPHKCPVCGRGFTRHNDLLRHRKR 194

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 763 KVYVCLE--CKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 814
           K Y C E  C ++F    HL  HK + HS  KP +C  C K+F     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>Scas_641.24
          Length = 532

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 812
           ++C  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTH 241

Query: 813 LNKK 816
           L  +
Sbjct: 242 LKAR 245

>CAGL0G07172g complement(678730..681330) some similarities with
           YALI0E14399g Yarrowia lipolytica, hypothetical start
          Length = 866

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 222 LDYLDKEIPGVNDSFLYAGLWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFY 281
           L+Y D   P    ++L   L      WH+ D++LY+I F    A K+W    Q  H + Y
Sbjct: 191 LEYKDGRKPKGVIAYLSHKLHSYETRWHIRDKELYAIVF----ALKKWTHYVQGSHVIIY 246

>Kwal_55.20634
          Length = 419

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 769 ECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813
           +C  +     H+T H + VH   KP +C  C K FKR   + +HL
Sbjct: 98  KCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHL 141

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKRRDHVLQH 812
           ++C  C   F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 160 FICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTH 218

Query: 813 LNKK 816
           L  +
Sbjct: 219 LKAR 222

>Scas_641.19
          Length = 1046

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 80  ISGTHGLFMSNNI---ERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTNNGKTIEMP 136
           +S    + + NN+    RSK   ++Q   L KD  +PQ P  R+K  + D+N    I +P
Sbjct: 19  VSQLRRILVENNVPYHSRSKKSELMQ---LFKDAIVPQIPSLREKYLNVDSNTADIIRIP 75

Query: 137 SSTSSATHRKRQHSFS 152
                    KR+ SFS
Sbjct: 76  ---------KRKKSFS 82

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 759 SETGKVYVCLECKRQFTSGHHLTRHKKS-VHSGEKPHSCPKCGKKFKRRDHVLQH 812
           S+T K   C  C + F    +L+ HK + + S ++PH C  C   F R + +++H
Sbjct: 318 SKTKKKRQCPICHKYFA---NLSTHKSTHLTSQDRPHKCIICQSGFARNNDLIRH 369

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,205,904
Number of extensions: 1348536
Number of successful extensions: 4445
Number of sequences better than 10.0: 225
Number of HSP's gapped: 4363
Number of HSP's successfully gapped: 293
Length of query: 864
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 754
Effective length of database: 12,788,129
Effective search space: 9642249266
Effective search space used: 9642249266
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)