Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_681.1824824812011e-169
CAGL0L11902g2512116598e-87
KLLA0C17754g2272156343e-83
YER170W (ADK2)2252046324e-83
AGR115C2512306076e-79
Kwal_56.234892252285994e-78
Sklu_2123.22282273902e-46
AGR187W2772103811e-44
Scas_721.822212043734e-44
KLLA0F13376g2272043631e-42
CAGL0K11418g2222093622e-42
Kwal_27.116072272043562e-41
YDR226W (ADK1)2222263543e-41
ACR170C2891951855e-16
Scas_685.92001941799e-16
Kwal_14.8682822051775e-15
YKL024C (URA6)2041941614e-13
Sklu_2380.52892281635e-13
CAGL0L09867g2601941591e-12
KLLA0E08030g3022121592e-12
Sklu_2366.546664661.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_681.18
         (248 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_681.18                                                           467   e-169
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...   258   8e-87
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...   248   3e-83
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...   248   4e-83
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...   238   6e-79
Kwal_56.23489                                                         235   4e-78
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                           154   2e-46
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...   151   1e-44
Scas_721.82                                                           148   4e-44
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...   144   1e-42
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...   144   2e-42
Kwal_27.11607                                                         141   2e-41
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...   140   3e-41
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...    76   5e-16
Scas_685.9                                                             74   9e-16
Kwal_14.868                                                            73   5e-15
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...    67   4e-13
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                          67   5e-13
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...    66   1e-12
KLLA0E08030g complement(724562..725470) some similarities with s...    66   2e-12
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       30   1.9  

>Scas_681.18
          Length = 248

 Score =  467 bits (1201), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/248 (93%), Positives = 232/248 (93%)

Query: 1   MLSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60
           MLSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF
Sbjct: 1   MLSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120
           IAQG                QEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL
Sbjct: 61  IAQGKLIPDDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120

Query: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180
           NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT
Sbjct: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180

Query: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGIQIRPPSTE 240
           FKKRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGIQIRPPSTE
Sbjct: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGIQIRPPSTE 240

Query: 241 SPGVEALK 248
           SPGVEALK
Sbjct: 241 SPGVEALK 248

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score =  258 bits (659), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 159/211 (75%), Gaps = 2/211 (0%)

Query: 18  SGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXXXXXXXXXXXXX 77
           SGKGTQ S+L+++LP +  +SSGDILR E+++ T+LG LA+++IAQG             
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHELKSGTELGVLAAKYIAQGKLIPDKVITQVLI 78

Query: 78  XXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDVPTEVILERI 137
               ++ WL    +SSW+LDGFPRT  QA   D TL + N  LNLVVELDVP EVILERI
Sbjct: 79  AHLSKEKWL--NPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERI 136

Query: 138 ENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEYHETLGPLKE 197
           +NRY+H+ SGR+YNLQ+NPP+V GKDD+TGEPLVKRSDD+   FKKR++EY +TLGP+KE
Sbjct: 137 DNRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKE 196

Query: 198 YYQSQGLLQTISGETSDIIFPKLLNMIHKRF 228
           +Y  QG+L TISG+TSDIIFPKL  +I++ F
Sbjct: 197 HYAKQGILATISGDTSDIIFPKLCALINQHF 227

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score =  248 bits (634), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 161/215 (74%), Gaps = 2/215 (0%)

Query: 14  GAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXXXXXXXXX 73
           GAPGSGKGTQ S+L++   ++  ISSGD+LR++I+  T LG  AS +I +G         
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72

Query: 74  XXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDVPTEVI 133
                  + + WL     ++W+LDGFPRT+ QA+  D++L +++ +LNLVVELDVP EVI
Sbjct: 73  GVVCDELKSRGWL--NPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130

Query: 134 LERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEYHETLG 193
           LERIENRYVH+PSGR+YNLQ+NPP+V GKDDITGEPL KR DD+A  F KRL++Y++T+ 
Sbjct: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190

Query: 194 PLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRF 228
           PLKE+Y  QG+L TISG TSDII+PKL+++I ++F
Sbjct: 191 PLKEHYLKQGILSTISGNTSDIIYPKLVSLILQKF 225

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score =  248 bits (632), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 120/204 (58%), Positives = 149/204 (73%), Gaps = 2/204 (0%)

Query: 14  GAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXXXXXXXXX 73
           GAPGSGKGTQ SRL++ +P ++ ISSGDILRQEI++E+ LG+ A+ +IAQG         
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLIT 80

Query: 74  XXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDVPTEVI 133
                      WL  +  + W+LDGFPRT  QA   DE L +++ +LNLVVELDVP   I
Sbjct: 81  RLITFRLSALGWL--KPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTI 138

Query: 134 LERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEYHETLG 193
           LERIENRYVH+PSGR+YNLQ+NPP+VPG DDITGEPL KR DD+A  FKKRL+EY +T  
Sbjct: 139 LERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNE 198

Query: 194 PLKEYYQSQGLLQTISGETSDIIF 217
           PLK+YY+  G+  T+SGETSDIIF
Sbjct: 199 PLKDYYKKSGIFGTVSGETSDIIF 222

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score =  238 bits (607), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 156/230 (67%), Gaps = 2/230 (0%)

Query: 1   MLSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60
           +++   ++RL+ LGAPG+GKGTQ+ RL+Q  P +  ++SGD+LR+EI A + LG+ A+  
Sbjct: 24  VMAGAGAIRLLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAH 83

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120
           IA G                  + WL G   +SW+LDGFPRT+ QAQ+ D  L++ +  L
Sbjct: 84  IAAGRLLPDALVSSAILDELARRRWLHG--GASWLLDGFPRTVAQAQELDAALERADAAL 141

Query: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180
            LVVE+ VP +VIL+RI+ R+VH+PSGR+YNL +NPP   G+DD+TGEPL +R DD+   
Sbjct: 142 TLVVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEV 201

Query: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHT 230
           F KR+QEY  T GPLKE+Y  QG+L+T+ G TSDI+FP+L  ++  +  T
Sbjct: 202 FYKRMQEYAATAGPLKEHYARQGILRTVRGPTSDIVFPQLERLVQAQLGT 251

>Kwal_56.23489
          Length = 225

 Score =  235 bits (599), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 152/228 (66%), Gaps = 10/228 (4%)

Query: 7   SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXX 66
           ++R++ LGAPGSGKGTQ S+L+     +  ISSGD+LRQEIQ +T LG LAS++I+QG  
Sbjct: 3   ALRILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKKTHLGSLASEYISQGKL 62

Query: 67  XXXXXXXXXXXXXXQEQNWLAGRSKSSWVLD----GFPRTITQAQKFDETLDKYNKNLNL 122
                            N L  R   S        GFPRT+ QA+     L  +   LNL
Sbjct: 63  LPDSLVTELVT------NELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNL 116

Query: 123 VVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFK 182
           VVELDVP+ VILERIENRYVH+PSGR+YNL +NPP V GKDD+TGEPL KR DD+A  F 
Sbjct: 117 VVELDVPSSVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFG 176

Query: 183 KRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHT 230
           KRL+ Y +T+ PLK++Y   G+L  +SGETSDIIFP+LL+++ K+  T
Sbjct: 177 KRLENYAQTVEPLKQFYADLGILHKVSGETSDIIFPQLLDLVSKKMRT 224

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score =  154 bits (390), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 131/227 (57%), Gaps = 7/227 (3%)

Query: 2   LSKLP-SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60
           LS +P S+R+V +G PG+GKGTQ   L +     + +++GD+LR ++  +T LG  A + 
Sbjct: 6   LSHVPESIRMVLIGPPGAGKGTQAPNLKERFCACH-LATGDMLRSQVAKKTALGLEAKKI 64

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120
           + QG                +E+       K+ ++LDGFPRTI QA+K DE L +  K L
Sbjct: 65  MDQGGLVSDDIMVNMI----KEELATNPECKNGFILDGFPRTIPQAEKLDEMLAEQGKPL 120

Query: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180
              +EL +  E+++ RI  R VH  SGR Y+  FNPP+V  KDD+TGEPLV+RSDD+A  
Sbjct: 121 ERAIELKIDDELLVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADA 180

Query: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTI-SGETSDIIFPKLLNMIHK 226
            KKRL  YH+   P+ ++Y+  G+   + + +    ++  +L  + K
Sbjct: 181 LKKRLNAYHQQTEPIVDFYKKTGIWSGVDASQAPSTVWSDILKCLGK 227

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score =  151 bits (381), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 120/210 (57%), Gaps = 6/210 (2%)

Query: 2   LSKLP-SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60
           +S +P ++R+V +G PG+GKGTQ  +L +    V  +++GD+LR ++  +T LG  A + 
Sbjct: 56  MSHVPEAIRMVLIGPPGAGKGTQAPKLKEKF-CVCHLATGDMLRSQVAKQTALGVQAKKI 114

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120
           + QG                +     A    + ++LDGFPRTI QAQK DE L    K L
Sbjct: 115 MDQGGLVSDEIMVNMIKDELRSNPECA----NGFILDGFPRTIPQAQKLDEMLVAQGKPL 170

Query: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180
           +  VEL +  E+++ RI  R VH  SGR Y+  FNPP+V   DD+TG+PLV+RSDD+A  
Sbjct: 171 DRAVELKIDDELLVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADA 230

Query: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTISG 210
            KKRL  YH    P+ ++Y+  G+   +  
Sbjct: 231 LKKRLDAYHAQTEPIVDFYKKTGIWAGVDA 260

>Scas_721.82
          Length = 221

 Score =  148 bits (373), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 7   SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXX 66
           S+R+V +G PG+GKGTQ   L++     + +S+GD+LR +I   T+LGQ A + + QG  
Sbjct: 5   SIRMVLIGPPGAGKGTQAPNLVEKFHACH-LSTGDMLRSQIAKNTELGQEAKKIMDQGGL 63

Query: 67  XXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVEL 126
                                   K+ ++LDGFPRTI QA+K D+ L +    L   VEL
Sbjct: 64  VSDEIMVNMIKDELTNNP----ACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAVEL 119

Query: 127 DVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQ 186
            V  ++++ RI  R +H  SGR Y+  FNPP+V   DD+TGEPL++RSDD+A   KKRL 
Sbjct: 120 QVDDDLLVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLA 179

Query: 187 EYHETLGPLKEYYQSQGLLQTISG 210
            YH    P+ ++Y+  G+   +  
Sbjct: 180 GYHAQTEPIVDFYKKTGIWSGVDA 203

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score =  144 bits (363), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 2   LSKLP-SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQF 60
           LS +P S+R+V +G PG+GKGTQ   L +     + +++GD+LR ++  +T LG  A + 
Sbjct: 5   LSHVPESIRMVLIGPPGAGKGTQAPNLTERFCACH-LATGDMLRSQVAKQTPLGIEAKKI 63

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120
           +  G                          K  ++LDGFPRTI QA+K DE L +  + L
Sbjct: 64  MDDGKLVSDEIMINMIKDELTNNQ----DCKKGFILDGFPRTIPQAEKLDEMLAQQGRPL 119

Query: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180
              VEL +  E+++ RI  R VH  SGR Y+  FNPP+   KDDITGE LV+RSDD+   
Sbjct: 120 EKAVELKIDDELLVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEA 179

Query: 181 FKKRLQEYHETLGPLKEYYQSQGL 204
            KKRL  YH+   P+ ++Y+  G+
Sbjct: 180 LKKRLTSYHKQTEPIVDFYKKTGI 203

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score =  144 bits (362), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 5/209 (2%)

Query: 2   LSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFI 61
           +S   S+R+V +G PG+GKGTQ   L++     + +++GD+LR +I   T+LG  A + +
Sbjct: 1   MSSSDSIRMVLIGPPGAGKGTQAPNLVERFHAAH-LATGDMLRSQISKGTELGLQAKKIM 59

Query: 62  AQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLN 121
            QG                          K+ ++LDGFPRTI QA+K D  L +    L 
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNNP----ACKNGFILDGFPRTIPQAEKLDNMLKERGTPLE 115

Query: 122 LVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATF 181
             VEL +  E+++ RI  R +H  SGR Y+  FNPP+   KDD+TGEPLV+RSDD+    
Sbjct: 116 KAVELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDAL 175

Query: 182 KKRLQEYHETLGPLKEYYQSQGLLQTISG 210
           KKRL  YH+   P+ ++Y+  G+   +  
Sbjct: 176 KKRLGAYHDQTEPIVDFYKKTGIWADVDA 204

>Kwal_27.11607
          Length = 227

 Score =  141 bits (356), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 7   SMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGXX 66
           S+R+V +G PG+GKGTQ   L +     + +++GD+LR ++  +T+LG  A + + QG  
Sbjct: 11  SVRMVLIGPPGAGKGTQAPNLKERFCACH-LATGDMLRSQVAQKTELGLEAKKIMDQGGL 69

Query: 67  XXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVEL 126
                         + +       KS ++LDGFPRTI QA+K D+ L +  + L   +EL
Sbjct: 70  VSDDIMVKMI----KHELITNPECKSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIEL 125

Query: 127 DVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQ 186
            +  E+++ RI  R VH  SGR Y+  FNPP+    DD+TGE LV+RSDD+A   KKRL 
Sbjct: 126 KIDDELLVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKRLG 185

Query: 187 EYHETLGPLKEYYQSQGLLQTISG 210
            YH+   P+ ++Y+  G+   +  
Sbjct: 186 AYHQQTEPIVDFYKKTGIWSGVDA 209

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score =  140 bits (354), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 123/226 (54%), Gaps = 6/226 (2%)

Query: 2   LSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFI 61
           +S   S+R+V +G PG+GKGTQ   L +     + +++GD+LR +I   T+LG  A + +
Sbjct: 1   MSSSESIRMVLIGPPGAGKGTQAPNLQERFHAAH-LATGDMLRSQIAKGTQLGLEAKKIM 59

Query: 62  AQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLN 121
            QG                          K+ ++LDGFPRTI QA+K D+ L +    L 
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNNP----ACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLE 115

Query: 122 LVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATF 181
             +EL V  E+++ RI  R +H  SGR Y+  FNPP+   KDD+TGE LV+RSDD+A   
Sbjct: 116 KAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADAL 175

Query: 182 KKRLQEYHETLGPLKEYYQSQGLLQTI-SGETSDIIFPKLLNMIHK 226
           KKRL  YH    P+ ++Y+  G+   + + +    ++  +LN + K
Sbjct: 176 KKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGK 221

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score = 75.9 bits (185), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 37/195 (18%)

Query: 10  LVF-LGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEI-QAETKLGQLASQFIAQGXXX 67
           +VF LG PGSGKGTQ SRL++ +  V+ + +GD+LR E  +  ++ G+L    I +G   
Sbjct: 100 VVFVLGGPGSGKGTQCSRLVERMQFVH-VGAGDLLRDEQNRPGSQYGELIKHHIKEGLIV 158

Query: 68  XXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELD 127
                         E+++ AGR K  +++DGFPR + QA  F++T+         V+  D
Sbjct: 159 PQEVTVALLRRAI-EEHYRAGRRK--FLVDGFPRKMDQAFTFEKTVVPS----KFVLFFD 211

Query: 128 VPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQE 187
            P  V+LER+  R                         +G     RSDD+  + KKR + 
Sbjct: 212 CPERVMLERLLTR----------------------GQTSG-----RSDDNIESIKKRFRT 244

Query: 188 YHETLGPLKEYYQSQ 202
           Y ET  P+ E++  Q
Sbjct: 245 YVETSMPVVEHFAQQ 259

>Scas_685.9
          Length = 200

 Score = 73.6 bits (179), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 91/194 (46%), Gaps = 36/194 (18%)

Query: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGXXXX 68
           +  LG PG+GKGTQ ++L+     V+ +S+GD+LR E   E ++ G L   +I +G    
Sbjct: 14  IFVLGGPGAGKGTQCAKLVADYGFVH-LSAGDLLRAEQNREGSEFGTLIKHYITEGLIVP 72

Query: 69  XXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128
                       QE N+  G  K  +++DGFPR + QA  F+E +         ++  D 
Sbjct: 73  QEITLALLKNAIQE-NYDKGMKK--FLVDGFPRKMDQALSFEEQI----VPSKFILFFDC 125

Query: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188
           P +V+LER+ +R     SGR+                         DD+  + KKR + +
Sbjct: 126 PEDVMLERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTF 158

Query: 189 HETLGPLKEYYQSQ 202
            ET  P+ +Y++ Q
Sbjct: 159 EETSMPVVKYFEDQ 172

>Kwal_14.868
          Length = 282

 Score = 72.8 bits (177), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 95/205 (46%), Gaps = 36/205 (17%)

Query: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGXXXX 68
           +  LG PG+GKGTQ + L++    V+ +S+GD+LR E   E +K G L   +I +G    
Sbjct: 96  IFVLGGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVP 154

Query: 69  XXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128
                       Q+ N+  G  +  +++DGFPR + QA  F+E +      L      D 
Sbjct: 155 QEVTVALLQQAIQD-NYDQGHKR--FLVDGFPRKMDQAITFEEQIVPSKFTLF----FDC 207

Query: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188
           P +V+L+R+  R                    GK          RSDD+  + KKR + +
Sbjct: 208 PEKVMLQRLLER--------------------GKTS-------GRSDDNVESIKKRFKTF 240

Query: 189 HETLGPLKEYYQSQGLLQTISGETS 213
            ET  P+ EY++ Q  + ++S + S
Sbjct: 241 IETSMPVVEYFEKQDKVVSVSCDHS 265

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score = 66.6 bits (161), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 36/194 (18%)

Query: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEI-QAETKLGQLASQFIAQGXXXX 68
           +  LG PG+GKGTQ  +L++    V+ +S+GD+LR E  +A ++ G+L    I +G    
Sbjct: 19  IFVLGGPGAGKGTQCEKLVKDYSFVH-LSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVP 77

Query: 69  XXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128
                        + N  A + K  +++DGFPR + QA  F+  + +       ++  D 
Sbjct: 78  QEITLALLRNAISD-NVKANKHK--FLIDGFPRKMDQAISFERDIVES----KFILFFDC 130

Query: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188
           P +++LER+  R                    GK   +G     RSDD+  + KKR   +
Sbjct: 131 PEDIMLERLLER--------------------GK--TSG-----RSDDNIESIKKRFNTF 163

Query: 189 HETLGPLKEYYQSQ 202
            ET  P+ EY++++
Sbjct: 164 KETSMPVIEYFETK 177

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 106/228 (46%), Gaps = 44/228 (19%)

Query: 10  LVF-LGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGXXX 67
           +VF LG PG+GKGTQ ++L++    V+ +S+GD+LR E   + ++ G L   +I +G   
Sbjct: 101 VVFVLGGPGAGKGTQCTKLVKDYGFVH-LSAGDLLRAEQNRKGSEYGALIKHYIKEGLIV 159

Query: 68  XXXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELD 127
                        +E N+  G+ +  +++DGFPR + QA  F++ +          +  D
Sbjct: 160 PQEVTVALLQNAIRE-NFEDGKKR--FLVDGFPRKMDQAITFEKQIVPS----KFTLFFD 212

Query: 128 VPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQE 187
            P  V+LER+  R                    GK          R+DD+  + KKR + 
Sbjct: 213 CPETVMLERLLER--------------------GKTS-------GRTDDNIESIKKRFRT 245

Query: 188 YHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGIQIR 235
           + ET  P+ EY++ Q  +  +S +         ++ ++K+  T ++ +
Sbjct: 246 FIETSMPVVEYFEKQNKVIKVSCDQP-------IDEVYKKVQTAVEAK 286

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 89/194 (45%), Gaps = 36/194 (18%)

Query: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGXXXX 68
           +  LG PG+GKGTQ ++L+     V+ +S+GD+LR E   E ++ G+L   +I +G    
Sbjct: 73  IFVLGGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVP 131

Query: 69  XXXXXXXXXXXXQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128
                       +E N+    +K  +++DGFPR + QA  F++ +          +  + 
Sbjct: 132 QEITLSLLQKAIKE-NYEKNYTK--FLVDGFPRKMDQALSFEKQIVPS----KFTLFFEC 184

Query: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188
           P +V+LER+  R                    GK          R+DD+  + KKR + +
Sbjct: 185 PEQVMLERLLER--------------------GKTS-------GRADDNIESIKKRFRTF 217

Query: 189 HETLGPLKEYYQSQ 202
            ET  P+  Y+ SQ
Sbjct: 218 EETSMPVVRYFDSQ 231

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 95/212 (44%), Gaps = 42/212 (19%)

Query: 2   LSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQF 60
            SK   + +  LG PG+GKGTQ ++L++    V+ +S+GD+LR E   E ++ G+L  + 
Sbjct: 107 FSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVH-LSAGDLLRAEQAREGSQYGELIKKC 165

Query: 61  IAQGXXXXXXXXXXXXXXXXQEQNWLAGRSKSS---WVLDGFPRTITQAQKFDETLDKYN 117
           I  G                  +N +     SS   +++DGFPR + QA  F+E +    
Sbjct: 166 IKDGEIVPQEVTVALL------KNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPST 219

Query: 118 KNLNLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDS 177
             L      D P +++LER+  R     SGRI                         DD+
Sbjct: 220 MTLF----FDCPEKIMLERLLQR--GKTSGRI-------------------------DDN 248

Query: 178 AATFKKRLQEYHETLGPLKEYYQSQGLLQTIS 209
             + +KR + + ET  P+ EY++ Q  +  +S
Sbjct: 249 IESIQKRFKTFVETSVPVVEYFEKQNKVVKVS 280

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 173 RSDDSAATFKKRLQEYHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGI 232
           R D S   F++   EYHE+  P    +    L +  S +  D+I P L N +     +GI
Sbjct: 328 RKDLSTLQFQENRNEYHESFLP---QFNPSKLTKFYSVDEMDVILPCLENAL---VASGI 381

Query: 233 QIRP 236
           +++P
Sbjct: 382 RVKP 385

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,576,540
Number of extensions: 312834
Number of successful extensions: 1233
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1203
Number of HSP's successfully gapped: 26
Length of query: 248
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 149
Effective length of database: 13,168,927
Effective search space: 1962170123
Effective search space used: 1962170123
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)