Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_675.2821621611291e-159
YKR014C (YPT52)2342348681e-119
CAGL0G07689g2152208211e-112
Sklu_2238.22072157791e-106
Kwal_14.23942072157771e-106
AAL176C2052157571e-103
KLLA0D02376g2072167221e-97
KLLA0C13728g2082125052e-64
YOR089C (VPS21)2102124938e-63
Kwal_23.29782112134825e-61
CAGL0J08635g2082144721e-59
YNL093W (YPT53)2201824722e-59
Scas_662.262121724677e-59
ACL084C2072144669e-59
AEL187C2081813782e-45
Kwal_14.24842031803754e-45
Sklu_2366.32181793766e-45
Scas_712.412191963723e-44
CAGL0K09394g2211733688e-44
YER031C (YPT31)2232063628e-43
AER434C2192163565e-42
Kwal_56.225552122163565e-42
YGL210W (YPT32)2221683523e-41
KLLA0F01232g2101783513e-41
YLR262C (YPT6)2151763505e-41
Sklu_2293.32141763487e-41
CAGL0C02453g2182213462e-40
YBR264C (YPT10)1991593442e-40
Scas_574.22221763435e-40
AGR257C2201743392e-39
CAGL0I09306g2061733382e-39
KLLA0F20471g2122193373e-39
CAGL0K06017g2192043374e-39
Scas_203.22511833395e-39
Kwal_14.11162042133103e-35
KLLA0D05313g2042133051e-34
Scas_713.52112193052e-34
ABR220W2042133016e-34
KLLA0E12111g2141792941e-32
Kwal_47.190551791662911e-32
CAGL0K12672g2062132921e-32
Sklu_1815.22132142922e-32
Sklu_1136.11821952875e-32
Scas_707.262102122871e-31
Sklu_2144.32042132852e-31
AGL021W2122122852e-31
CAGL0F02123g2152152843e-31
Kwal_23.50582132122843e-31
YFL038C (YPT1)2062122824e-31
Sklu_2373.32081732763e-30
ACR003C2081732764e-30
Scas_656.22182122731e-29
YFL005W (SEC4)2151782731e-29
Kwal_56.224402081732669e-29
Scas_674.52081722624e-28
KLLA0D01265g2071752608e-28
CAGL0E02607g2081272582e-27
YML001W (YPT7)2081732564e-27
YOR185C (GSP2)2201822191e-21
YLR293C (GSP1)2191822181e-21
Kwal_33.140152711682193e-21
CAGL0I00594g2141822154e-21
Sklu_2285.42141822138e-21
Scas_586.62191822112e-20
AGR294C2141822102e-20
KLLA0C05126g2141822103e-20
KLLA0A04499g2141822103e-20
ABR182W2091742083e-20
Scas_691.362121762068e-20
Kwal_56.233612141822069e-20
Kwal_55.219372081762041e-19
Kwal_55.219412091941999e-19
CAGL0I08459g2101771981e-18
KLLA0B10626g2081761981e-18
YPR165W (RHO1)2091761944e-18
ABL139C2942251976e-18
Scas_610.42111741911e-17
Sklu_2151.42071761901e-17
Sklu_2151.32091941901e-17
YKR055W (RHO4)2912201923e-17
Sklu_1816.11881741864e-17
ABR183W2071761875e-17
KLLA0C13816g1871661856e-17
ACR257C2591901861e-16
CAGL0J05632g1881671821e-16
ACL087C1871701821e-16
Scas_444.4*2891861852e-16
Scas_578.71871661803e-16
Kwal_47.169832231741823e-16
YNL090W (RHO2)1921721779e-16
KLLA0D08327g2541891791e-15
KLLA0A05643g2181901771e-15
Sklu_1655.12871911792e-15
Sklu_2007.22611891782e-15
Kwal_33.144522601871772e-15
AER132W2321261744e-15
Scas_547.32231731735e-15
Sklu_1653.32561781746e-15
Scas_417.32911981712e-14
Scas_677.202832281694e-14
CAGL0K08316g3231771696e-14
YOR101W (RAS1)3091701687e-14
Sklu_2345.52191901641e-13
Scas_703.412251221641e-13
CAGL0L11242g2541711632e-13
Scas_697.463241701643e-13
CAGL0G08558g2271821603e-13
Kwal_26.83872921701623e-13
KLLA0B05038g2231771594e-13
YNL098C (RAS2)3221701609e-13
CAGL0G05764g2902191572e-12
CAGL0E03113g3231691582e-12
Kwal_23.29441841671523e-12
YIL118W (RHO3)2311371534e-12
Kwal_14.22442442131526e-12
ADL252W2241901517e-12
Scas_671.352341271509e-12
YML064C (TEM1)2451701501e-11
Kwal_23.48752301951501e-11
KLLA0F03443g2231271491e-11
AGL093W1911991444e-11
Kwal_55.21971421971484e-11
YOR094W (ARF3)1831811434e-11
ADL262W2701881465e-11
CAGL0B04521g3391701475e-11
YNL180C (RHO5)3312111466e-11
Scas_575.102711701456e-11
KLLA0C12001g2591701457e-11
AFR464W2641691431e-10
YGR152C (RSR1)2721911422e-10
Sklu_2320.21641661382e-10
KLLA0A11330g1901731374e-10
CAGL0J11242g3841311397e-10
Kwal_23.31351911991357e-10
KLLA0A04213g1911991358e-10
YLR229C (CDC42)1911991322e-09
YNL304W (YPT11)355711342e-09
CAGL0F05269g1911991313e-09
Scas_721.961911991295e-09
ACL078W1811671285e-09
Kwal_34.161421921641287e-09
KLLA0C13563g1821701278e-09
CAGL0I03916g1811661261e-08
Scas_697.54*1811671242e-08
ADL162W4041301272e-08
YCR027C (RHB1)2091751243e-08
YDL137W (ARF2)1811661233e-08
Scas_624.4*1811661224e-08
Scas_701.42*1811661224e-08
CAGL0J09064g1811661224e-08
CAGL0M03817g4751051211e-07
Sklu_2365.21971721182e-07
YDL192W (ARF1)1811661172e-07
Sklu_2354.104221251202e-07
Kwal_56.244531811661153e-07
Kwal_56.244621811681144e-07
Sklu_1681.21621651135e-07
ADR094W1811661136e-07
KLLA0C12881g373971158e-07
KLLA0F05225g1811661128e-07
Scas_628.212081811093e-06
KLLA0C13387g211961093e-06
Scas_503.25271141104e-06
Scas_567.91991931022e-05
YPL051W (ARL3)198188996e-05
Kwal_27.11872197182988e-05
Kwal_47.18241230125981e-04
AGR221W183170952e-04
Sklu_2202.6183169933e-04
YMR138W (CIN4)191172925e-04
CAGL0E06292g408218928e-04
CAGL0L12826g199184909e-04
KLLA0E24805g183169909e-04
YBR164C (ARL1)183124860.002
CAGL0E05896g189134860.002
CAGL0I00858g197182860.003
CAGL0I10835g183124860.003
Scas_700.11183124850.004
KLLA0F17072g190126840.004
YPL218W (SAR1)190122820.009
AGL261W198111800.017
Kwal_26.681066473780.045
Scas_706.2*190175760.053
Kwal_56.2414914969720.14
AFL114W190134700.27
Sklu_1358.1218133690.41
ADR402W66187710.43
KLLA0B02046g190135680.51
KLLA0F02662g25375690.56
KLLA0A03465g65989680.92
KLLA0C06358g299131661.1
Scas_698.27701102671.3
YAL048C662125661.6
KLLA0E12837g19977632.3
AEL232C309139633.3
Scas_721.9039744624.2
Scas_695.4631870624.8
YCR002C (CDC10)32270615.0
CAGL0G06754g32470615.6
Kwal_14.80369369617.1
YMR023C (MSS1)52623617.2
Scas_625.5114145617.6
KLLA0F12848g33770608.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_675.28
         (216 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_675.28                                                           439   e-159
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   338   e-119
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   320   e-112
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        304   e-106
Kwal_14.2394                                                          303   e-106
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   296   e-103
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   282   1e-97
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   199   2e-64
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   194   8e-63
Kwal_23.2978                                                          190   5e-61
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   186   1e-59
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   186   2e-59
Scas_662.26                                                           184   7e-59
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   184   9e-59
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   150   2e-45
Kwal_14.2484                                                          149   4e-45
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               149   6e-45
Scas_712.41                                                           147   3e-44
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   146   8e-44
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   144   8e-43
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   141   5e-42
Kwal_56.22555                                                         141   5e-42
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   140   3e-41
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   139   3e-41
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   139   5e-41
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           138   7e-41
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   137   2e-40
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   137   2e-40
Scas_574.2                                                            136   5e-40
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   135   2e-39
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   134   2e-39
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   134   3e-39
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   134   4e-39
Scas_203.2                                                            135   5e-39
Kwal_14.1116                                                          124   3e-35
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   122   1e-34
Scas_713.5                                                            122   2e-34
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   120   6e-34
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   117   1e-32
Kwal_47.19055                                                         116   1e-32
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   117   1e-32
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        117   2e-32
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           115   5e-32
Scas_707.26                                                           115   1e-31
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           114   2e-31
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   114   2e-31
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   114   3e-31
Kwal_23.5058                                                          114   3e-31
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   113   4e-31
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         110   3e-30
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   110   4e-30
Scas_656.2                                                            109   1e-29
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   109   1e-29
Kwal_56.22440                                                         107   9e-29
Scas_674.5                                                            105   4e-28
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   104   8e-28
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   103   2e-27
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   103   4e-27
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    89   1e-21
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    89   1e-21
Kwal_33.14015                                                          89   3e-21
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    87   4e-21
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         87   8e-21
Scas_586.6                                                             86   2e-20
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    86   2e-20
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    86   3e-20
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    86   3e-20
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    85   3e-20
Scas_691.36                                                            84   8e-20
Kwal_56.23361                                                          84   9e-20
Kwal_55.21937                                                          83   1e-19
Kwal_55.21941                                                          81   9e-19
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    81   1e-18
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    81   1e-18
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    79   4e-18
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    80   6e-18
Scas_610.4                                                             78   1e-17
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                78   1e-17
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         78   1e-17
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    79   3e-17
Sklu_1816.1 YNL090W, Contig c1816 115-681                              76   4e-17
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    77   5e-17
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    76   6e-17
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    76   1e-16
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    75   1e-16
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    75   1e-16
Scas_444.4*                                                            76   2e-16
Scas_578.7                                                             74   3e-16
Kwal_47.16983                                                          75   3e-16
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    73   9e-16
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    74   1e-15
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    73   1e-15
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          74   2e-15
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          73   2e-15
Kwal_33.14452                                                          73   2e-15
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    72   4e-15
Scas_547.3                                                             71   5e-15
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            72   6e-15
Scas_417.3                                                             70   2e-14
Scas_677.20                                                            70   4e-14
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    70   6e-14
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    69   7e-14
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           68   1e-13
Scas_703.41                                                            68   1e-13
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    67   2e-13
Scas_697.46                                                            68   3e-13
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    66   3e-13
Kwal_26.8387                                                           67   3e-13
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    66   4e-13
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    66   9e-13
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    65   2e-12
CAGL0E03113g complement(289164..290135) some similarities with s...    65   2e-12
Kwal_23.2944                                                           63   3e-12
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    64   4e-12
Kwal_14.2244                                                           63   6e-12
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    63   7e-12
Scas_671.35                                                            62   9e-12
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    62   1e-11
Kwal_23.4875                                                           62   1e-11
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    62   1e-11
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    60   4e-11
Kwal_55.21971                                                          62   4e-11
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    60   4e-11
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    61   5e-11
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    61   5e-11
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    61   6e-11
Scas_575.10                                                            60   6e-11
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    60   7e-11
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    60   1e-10
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    59   2e-10
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            58   2e-10
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    57   4e-10
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    58   7e-10
Kwal_23.3135                                                           57   7e-10
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    57   8e-10
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    55   2e-09
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    56   2e-09
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    55   3e-09
Scas_721.96                                                            54   5e-09
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    54   5e-09
Kwal_34.16142                                                          54   7e-09
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    54   8e-09
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    53   1e-08
Scas_697.54*                                                           52   2e-08
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    54   2e-08
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    52   3e-08
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    52   3e-08
Scas_624.4*                                                            52   4e-08
Scas_701.42*                                                           52   4e-08
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    52   4e-08
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    51   1e-07
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          50   2e-07
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    50   2e-07
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         51   2e-07
Kwal_56.24453                                                          49   3e-07
Kwal_56.24462                                                          49   4e-07
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            48   5e-07
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    48   6e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    49   8e-07
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    48   8e-07
Scas_628.21                                                            47   3e-06
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    47   3e-06
Scas_503.2                                                             47   4e-06
Scas_567.9                                                             44   2e-05
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    43   6e-05
Kwal_27.11872                                                          42   8e-05
Kwal_47.18241                                                          42   1e-04
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    41   2e-04
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            40   3e-04
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    40   5e-04
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    40   8e-04
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    39   9e-04
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    39   9e-04
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    38   0.002
CAGL0E05896g join(complement(585178..585202),complement(584348.....    38   0.002
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    38   0.003
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    38   0.003
Scas_700.11                                                            37   0.004
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    37   0.004
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    36   0.009
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    35   0.017
Kwal_26.6810                                                           35   0.045
Scas_706.2*                                                            34   0.053
Kwal_56.24149                                                          32   0.14 
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    32   0.27 
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             31   0.41 
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    32   0.43 
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    31   0.51 
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    31   0.56 
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    31   0.92 
KLLA0C06358g complement(563583..564482) highly similar to sp|Q00...    30   1.1  
Scas_698.27                                                            30   1.3  
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    30   1.6  
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    29   2.3  
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...    29   3.3  
Scas_721.90                                                            28   4.2  
Scas_695.46                                                            28   4.8  
YCR002C (CDC10) [537] chr3 complement(117377..118345) Septin, co...    28   5.0  
CAGL0G06754g complement(645915..646889) highly similar to sp|P25...    28   5.6  
Kwal_14.803                                                            28   7.1  
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    28   7.2  
Scas_625.5                                                             28   7.6  
KLLA0F12848g 1184231..1185244 highly similar to sp|P25342 Saccha...    28   8.6  

>Scas_675.28
          Length = 216

 Score =  439 bits (1129), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS 216
           DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS
Sbjct: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS 216

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  338 bits (868), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/234 (72%), Positives = 193/234 (82%), Gaps = 18/234 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEE--DVVI 58
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDELRESTIGAAFLSQ+I I   +  E  DVVI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVI 118
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ+DSL KAR+WV+ELKNKVGD+DLVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 119 FLVGNKLDLC-------------EG---EEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQ 162
           +L+GNK+DLC             EG   E+ +RA+ T EAK YA+EQ LLF EVSAKTG+
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 163 GVKEVFRSIGEKLYASKKDEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS 216
           GVKE+F+ IGEKLY  KKDEIL+K+NR++G   N  VDIN QRPSTND T+CCS
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTSCCS 234

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  320 bits (821), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 185/220 (84%), Gaps = 9/220 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDELRESTIGAAFLSQT+KIK  +  EDVVIKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK--DGNEDVVIKF 58

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ DSL KA+SWV+EL+NKVGDE+LVI+L
Sbjct: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYL 118

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNK+D+ E +E  R ++T E   YA+ Q LLF EVSAKTG GVK++F+ IGE+LY++KK
Sbjct: 119 VGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKK 178

Query: 181 DEILAKKNRELGNRVN----NSVDINAQRPSTNDTTTCCS 216
             +   KN++   R +    N+VDI  QRPSTNDT++CCS
Sbjct: 179 ASL---KNKDQSRRTDSVSSNTVDIQTQRPSTNDTSSCCS 215

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  304 bits (779), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 174/215 (80%), Gaps = 9/215 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+K      D V+KF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLK---DYNDTVVKF 57

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNAN ALVVYD+TQ DSLVKA++WV+ELK+KVGDEDLVI L
Sbjct: 58  EIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICL 117

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNKLDLCE E   R VD  +A++YA ++ LLF EVSAKTG+GV  +F+ IGEKLY  KK
Sbjct: 118 VGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
           D +      E  ++  + V++  QRP+TND T+CC
Sbjct: 178 DSL------EAASQTRHVVNVELQRPTTNDATSCC 206

>Kwal_14.2394
          Length = 207

 Score =  303 bits (777), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/215 (70%), Positives = 170/215 (79%), Gaps = 9/215 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+   E+ EDV IKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL---EKHEDVTIKF 57

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ  SLVKA+SWVEELKNKVGD+DLVI L
Sbjct: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICL 117

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNKLDLC  EE  R V+  +A+ YA+EQ LLF EVSAKTG GV  +F+ IGE +Y  K 
Sbjct: 118 VGNKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKG 177

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
               A        +   + ++  QRPSTND+T+CC
Sbjct: 178 AATAASP------QARKTPNVKLQRPSTNDSTSCC 206

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  296 bits (757), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 146/215 (67%), Positives = 171/215 (79%), Gaps = 11/215 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLS+TIK+      +D +IKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLA---DHDDAMIKF 57

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ+DSL KA+SWV ELK+KVGDEDLVIFL
Sbjct: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFL 117

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNKLDL + +   R +D+ EA+AYAE   L+F EVSAKTG G+ +VF+ IG KLY  ++
Sbjct: 118 VGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
           + + A+          +S  I  QRP+TND T+CC
Sbjct: 178 ESLAAQP--------QHSSSIQLQRPTTNDATSCC 204

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  282 bits (722), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 171/216 (79%), Gaps = 9/216 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+  E  E+  V+KF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQ--VLKF 58

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+T+ DSL KA+ WV+ELK KV D+ L+I L
Sbjct: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICL 118

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNKLDL    E    VD ++A+ +A+E NLLF +VSAKTG+ V +VF+ IGE+LY   K
Sbjct: 119 VGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNK 178

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS 216
           D+I   K      + NN+ +I+ QRPSTND+ +CCS
Sbjct: 179 DKIQESK------KPNNN-NISLQRPSTNDSQSCCS 207

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  199 bits (505), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 139/212 (65%), Gaps = 11/212 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +       D  IKFEIW
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMA------DHTIKFEIW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER+ SLAPMYYRNA AALVVYD+T+  S +KAR WV+EL  +   + +VI LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKGIVIALVGN 120

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+DL E EED R V   EA+  ++E+NLLF E SAKTG  V EVF +IGEK+   K D  
Sbjct: 121 KMDLLESEED-RKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSD-- 177

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
                  L    +  +D+N    ++N  +  C
Sbjct: 178 -GSNTDGLRGTEDGRIDLNKPDDTSNPNSCGC 208

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  194 bits (493), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 139/212 (65%), Gaps = 12/212 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + I       +  +KFEIW
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTIN------EHTVKFEIW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER+ SLAPMYYRNA AALVVYD+T+  S +KAR WV+EL  +   +D++I LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALVGN 120

Query: 124 KLDLC-EGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDE 182
           K+D+  EG E  R V   E +  AEE+ LLF E SAKTG+ V +VF  IGEK+     +E
Sbjct: 121 KIDMLQEGGE--RKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEE 178

Query: 183 ILAKKNRELGNRVNNSVDINAQRPSTNDTTTC 214
             +  N    N  N  VD+NA    T+  + C
Sbjct: 179 QNSASNERESN--NQRVDLNAANDGTSANSAC 208

>Kwal_23.2978
          Length = 211

 Score =  190 bits (482), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 138/213 (64%), Gaps = 10/213 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +       D  IKFEIW
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMG------DHTIKFEIW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER+ SLAPMYYRNA AALVVYD+T+  S +KAR WV+EL+ +   +D+VI LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALVGN 120

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           KLD+ E   + R V   EA+  A ++ LLF E SAKTG  V EVF  IG+K+      + 
Sbjct: 121 KLDIVESGGE-RKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQ 179

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCCS 216
            A+    L  R+N+   ++ +    N   + C+
Sbjct: 180 QAQGPSGL--RINDDARVDLRAAQGNSAQSNCN 210

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  186 bits (472), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 104/214 (48%), Positives = 143/214 (66%), Gaps = 10/214 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           +   KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + I          +KF
Sbjct: 5   ITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEH------TVKF 58

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EIWDTAGQER+ SLAPMYYRNA AALVVYD+T+  S +KAR WV+EL+ +   +D++I L
Sbjct: 59  EIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIAL 117

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           VGNK+D+ E   + R+V   EA+  AEE+NLLF E SAK+G+ + +VF +IGEK+     
Sbjct: 118 VGNKIDVLENGTE-RSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKVPLKTA 176

Query: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTC 214
           ++     N     RV+ +  +N   P+ N + +C
Sbjct: 177 NQANVPNNANENQRVDLTSVVN--NPAANSSCSC 208

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  186 bits (472), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (70%), Gaps = 9/182 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ I        +  VIKFE
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT------RDGKVIKFE 64

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           IWDTAGQER+  LAPMYYRNA AALVV+D+T + S  KA++WVEEL  KVG  D+VI LV
Sbjct: 65  IWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIALV 123

Query: 122 GNKLDLC--EGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           GNK+DL   + E + RA+     +   E +NLL+ E SAKTG+ + ++F+++GEK+   +
Sbjct: 124 GNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPE 183

Query: 180 KD 181
           ++
Sbjct: 184 QN 185

>Scas_662.26
          Length = 212

 Score =  184 bits (467), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 98/172 (56%), Positives = 124/172 (72%), Gaps = 7/172 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + I       D  +KFEIW
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIN------DNTVKFEIW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER+ SLAPMYYRNA AAL+VYD+T+  S +KAR W++EL  +  ++D++I LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALVGN 120

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKL 175
           K+D+ E  ED R V   E +  AEE+ LLF E SAKTG  V E F +IGEK+
Sbjct: 121 KVDVLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKI 172

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  184 bits (466), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 113/214 (52%), Positives = 143/214 (66%), Gaps = 16/214 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + ++       IKFEIW
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDSK------TIKFEIW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER+ SLAPMYYRNA AALVVYD+T+  S +KAR WV+EL  +   + +VI LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVGN 120

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           KLDL E  E  R V   EA+  AEE+ LLF E SAKTG  + EVF +IGEK+  +K  E 
Sbjct: 121 KLDLLENGE-ARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQ 179

Query: 184 LAKKNRELGNRVNNS-VDINAQRPSTNDTTTCCS 216
            A      G  V+N+ +D+NA   S+N     C+
Sbjct: 180 PAS-----GPSVDNARLDLNAV--SSNQHANSCN 206

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  150 bits (378), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 119/181 (65%), Gaps = 22/181 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIK-----AEEQEEDVV 57
           Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +++++ +       + +E   
Sbjct: 8   QVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEVRS 66

Query: 58  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---E 114
           + FEIWDTAGQERY+SLAPMYYRN + ALVVYD+T++ S   ARSW++EL   +G+    
Sbjct: 67  VTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRN 126

Query: 115 DLVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEK 174
           D+V+ +VGNK+DL  G +  + + ++             T VSAKTG+G++E+F  I + 
Sbjct: 127 DVVVRIVGNKIDLHAGGQLEQPLPSA-------------TFVSAKTGEGIEELFMDIAKH 173

Query: 175 L 175
           +
Sbjct: 174 V 174

>Kwal_14.2484
          Length = 203

 Score =  149 bits (375), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (67%), Gaps = 21/180 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + KLVLLG+SSVGKS++V RF   SF +   +TIGAAF ++ I  + E   ++V  KFEI
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEV--KFEI 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKV-GDE--DLVIF 119
           WDTAGQERY++L PMYYRN + A VV+D+T++ + +KA SWV+ELK+ + G+E  ++VI 
Sbjct: 66  WDTAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIK 125

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           L+GNK+DL + E   R V               +T VSAKTG+GV ++F S+  ++ +SK
Sbjct: 126 LIGNKIDLLD-EVPPRKVG--------------WTPVSAKTGEGVADLFESVAREVPSSK 170

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  149 bits (376), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 118/179 (65%), Gaps = 18/179 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEE----DVVI 58
           + KLVLLG+SSVGKSSIV RF   +F     +TIGAAF ++T+ +++   E     D  I
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDED--- 115
           K EIWDTAGQERY+SLAPMYYRN + AL+V+D+T KDS+ +A+SW++EL   + + +   
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 116 --LVIFLVGNKLDL-CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
             ++I +VGNK+DL  E  E       ++   Y ++Q   +  VSAKTG G+ E+F +I
Sbjct: 127 RGILIKIVGNKIDLNPEARE-------TQNLPYIQDQGYNWFPVSAKTGDGIDELFDTI 178

>Scas_712.41
          Length = 219

 Score =  147 bits (372), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 124/196 (63%), Gaps = 16/196 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI+++ ++      IK +IW
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKK------IKAQIW 67

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERY+++   YYR A  AL+VYD+++  +      W++EL++   D+++ + L+GN
Sbjct: 68  DTAGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLIGN 126

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL      LRAV T+EAK +A E  LLFTE SA   + V + FR +   +Y     ++
Sbjct: 127 KSDLAH----LRAVPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIY-----QM 177

Query: 184 LAKKNRELGNRVNNSV 199
           ++K   +LG+  NN+ 
Sbjct: 178 VSKHQVDLGDSGNNAA 193

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  146 bits (368), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 109/173 (63%), Gaps = 11/173 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TIK+      ED  IK +IW
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKV------EDKKIKAQIW 68

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERY+++   YYR A  AL+VYD+++  +      W+ ELK    D+++ I L+GN
Sbjct: 69  DTAGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGN 127

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           K DL    E LRAV T EA+ +A E  L FTE SA   + V   FR + E++Y
Sbjct: 128 KSDL----EHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFRELIEQIY 176

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  144 bits (362), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 121/206 (58%), Gaps = 16/206 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++T++I  +       IK +
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKR------IKAQ 65

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           IWDTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+++ + L+
Sbjct: 66  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLI 124

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKD 181
           GNK DL      LRAV T E+K +A+E  LLFTE SA   + V + F  +   +Y     
Sbjct: 125 GNKSDLAH----LRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIY----- 175

Query: 182 EILAKKNRELGNRVNNSVDINAQRPS 207
           + ++K   +LG+   N     A  P+
Sbjct: 176 QKVSKHQMDLGDSSANGNANGASAPN 201

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  141 bits (356), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 121/216 (56%), Gaps = 15/216 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI+++ ++      +K +IW
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKK------VKAQIW 68

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    DE++ + L+GN
Sbjct: 69  DTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DENVAVGLIGN 127

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYAS-KKDE 182
           K DL      LRAV T EAK +A+   +LFTE SA   + V   FR +   +Y    K++
Sbjct: 128 KSDLAH----LRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIYQMVSKNQ 183

Query: 183 ILAKKNRELGNRVNNSVDINAQRPSTND---TTTCC 215
           +   +N   G          A  PS      T  CC
Sbjct: 184 VDLSENNGSGTVPRGPTISLAPAPSEKSKKKTNNCC 219

>Kwal_56.22555
          Length = 212

 Score =  141 bits (356), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 128/216 (59%), Gaps = 17/216 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL------DDKTIRL 63

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R+++ A+VVYD+T K S      WVE++K++ G+E++V+ +
Sbjct: 64  QLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           VGNK DL     D R V T E +  A+  N  +F E S K G  VK +FR I + L    
Sbjct: 124 VGNKNDLS----DERQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTL---- 175

Query: 180 KDEILAKKNRELGNRVNNSVD-INAQRPSTNDTTTC 214
             E        LG +  N  D I+    S  + ++C
Sbjct: 176 -PEFQKADEDPLGEQAKNKPDVIDITTASEQEQSSC 210

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  140 bits (352), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 105/168 (62%), Gaps = 11/168 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI++      E+  IK +IW
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEV------ENKKIKAQIW 67

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+++ + L+GN
Sbjct: 68  DTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGN 126

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           K DL      LRAV T EAK +A E  +LFTE SA     V + FR +
Sbjct: 127 KSDLAH----LRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFREL 170

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  139 bits (351), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 18/178 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLVLLG+SSVGKS+IV RF    F  +   TIGAAF ++ ++    E      + FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIFLV 121
           TAGQERY+SLAPMYYRN + AL+V+D+TQ  S  KA+SW++EL N + D   + + + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           GNK+DL + EE L+  + +E              VSAKTG+G+ E+F  IG+ +   K
Sbjct: 130 GNKIDLVD-EETLQNWNDAEL-------------VSAKTGEGIDELFLKIGKDIPIDK 173

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  139 bits (350), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 114/176 (64%), Gaps = 11/176 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL------DDKTIRL 61

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R++  A++VYD+T++ S      W+E++KN+ GDE++++ +
Sbjct: 62  QLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCI 121

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKL 175
           VGNK DL     D R + T E +  A+     +F E S K G  VK +F+ I + L
Sbjct: 122 VGNKSDL----SDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSL 173

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  138 bits (348), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 115/176 (65%), Gaps = 11/176 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL------DDKTIRL 63

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R+++ A+VVYD+T K S      W+E++K++ G+E++++ +
Sbjct: 64  QLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKL 175
           VGNK DL     D R V T E +  A+  N  +F E S K G  VK +F+ I + L
Sbjct: 124 VGNKNDLV----DERQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSL 175

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  137 bits (346), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 124/221 (56%), Gaps = 25/221 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI +  ++      IK +IW
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKK------IKAQIW 67

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+++ + L+GN
Sbjct: 68  DTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENA-DDNVAVGLIGN 126

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGV----KEVFRSIGEKLYASK 179
           K DL      LRAV T EAK +A E  LLFTE SA     V    KE+  +I +K+  SK
Sbjct: 127 KSDLAH----LRAVPTEEAKQFASENQLLFTETSALNSDNVDLAFKELITAIHQKV--SK 180

Query: 180 KDEILAKKNRELGNRVNNSVDINAQRPSTND-----TTTCC 215
               L+  N+        ++ +    P+ N+     +  CC
Sbjct: 181 HQVELSNANKPGAGPNGPTISLT---PAPNEKKKSSSNNCC 218

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  137 bits (344), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (63%), Gaps = 10/159 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++TI++ + +   +  I  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQERYKSL PMYYR+AN AL+V++L    SL  A++W ++L+++     ++I  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 124 KLDL-CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTG 161
           K DL CE         + E    AE Q L +  VSAKTG
Sbjct: 123 KYDLVCEEH-------SGEVTIPAELQGLPYVAVSAKTG 154

>Scas_574.2
          Length = 222

 Score =  136 bits (343), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 113/176 (64%), Gaps = 11/176 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL------DDKTIRL 61

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R++  A+VVYD+T+K S      W+E++KN+ GD+++++ +
Sbjct: 62  QLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCI 121

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKL 175
           VGNK DL     D R V   E +  A+     +F E S K G  VK +F+ I + L
Sbjct: 122 VGNKSDLS----DERQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSL 173

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  135 bits (339), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 112/174 (64%), Gaps = 11/174 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ ++
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL------DDRTIRLQL 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WDTAGQER++SL P Y R+++ A+VVYD+T K S      WVE+++N+ G+E+L++ +VG
Sbjct: 66  WDTAGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVG 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKL 175
           NK DL     D R V   E +  A+  N  +F E S K G  V  +F+ I + L
Sbjct: 126 NKSDLV----DERKVTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRIAKLL 175

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  134 bits (338), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 19/173 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRE-STIGAAFLSQTIKIKAEEQEEDVV-IKFE 61
            K+VLLG+S+VGKS+IV RF    +  LR  +TIGAA++++ ++     ++ DV  ++ E
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKY--LRNNATIGAAYVTKDLEYI---RDGDVYQVRLE 65

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKV---GDEDLVI 118
           IWDTAGQERY+SL PMYYRN + A+VV+D++   SL  A  W++EL   V   G E + I
Sbjct: 66  IWDTAGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINI 125

Query: 119 FLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
            LVGNK+DLC  EE       S      EEQ   F  VSAK+G+G++E+F  I
Sbjct: 126 VLVGNKMDLCSDEE------RSTLPQRVEEQ---FQAVSAKSGEGIEELFDHI 169

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  134 bits (337), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 127/219 (57%), Gaps = 19/219 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL------DDKTIRL 62

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R+++ A+VVYD+T + S      W+E++K + G+E++++ +
Sbjct: 63  QLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVI 122

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           VGNK DL E     R V T E +  +   N  LF E S K G  VK +F+ I + L    
Sbjct: 123 VGNKSDLVEE----RQVSTEEGERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLL---- 174

Query: 180 KDEILAKKNRELGNRVNNSVD--INAQRPS-TNDTTTCC 215
             E    ++  L N  N+     IN   P  +  +  CC
Sbjct: 175 -PEFQDAQSTPLDNDTNDKKPGVINLAAPDESQQSNGCC 212

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  134 bits (337), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 121/204 (59%), Gaps = 13/204 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ +      +D  I+ 
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL------DDKTIRL 62

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           ++WDTAGQER++SL P Y R++  A+VVYD+T++ S      W+E++KN+ G E++++ +
Sbjct: 63  QLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCV 122

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRSIGEKL--YA 177
           VGNK DL     D R V   E +  A++    +F + S K G  VK +F+ I + L  + 
Sbjct: 123 VGNKSDLA----DERQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSLPEFQ 178

Query: 178 SKKDEILAKKNRELGNRVNNSVDI 201
                 L       GNR +N   +
Sbjct: 179 DSDANPLENTGGAAGNRNSNKAGV 202

>Scas_203.2
          Length = 251

 Score =  135 bits (339), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (61%), Gaps = 21/183 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K VLLG+SSVG++SIV RF      + R   IGAAFL++ I+   E+   +V    EI
Sbjct: 47  RLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEV--DLEI 104

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDE---DLVIF 119
           WDTAGQERY+SLAP+YYRN + AL+V+D+T  ++  KARSWV+EL++ + +E   ++ ++
Sbjct: 105 WDTAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLY 164

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNL---LFTEVSAKTGQGVKEVFRSIGEKLY 176
           L+GNK DL             E ++ A+   L    F EVSAK  +G++E+F  I   + 
Sbjct: 165 LIGNKCDL-------------EHESIAKTAILDMCTFKEVSAKRDEGIQELFEEIARGIP 211

Query: 177 ASK 179
             K
Sbjct: 212 TDK 214

>Kwal_14.1116
          Length = 204

 Score =  124 bits (310), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 125/213 (58%), Gaps = 18/213 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A+  ++VYD+T  DS    + W++E+ ++     ++  +VGN
Sbjct: 63  DTAGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL    +D R V+   AK +A+   + F E SA     V+E F ++ +++      E 
Sbjct: 122 KSDL----QDKRMVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMAKQI-----KES 172

Query: 184 LAKKNRELGNRVNNSVDINAQRPS-TNDTTTCC 215
           +A+++R+ G + ++  ++N +  S +N ++ CC
Sbjct: 173 MAQQHRDTGKK-DDKANVNLKGQSLSNSSSGCC 204

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  122 bits (305), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 122/213 (57%), Gaps = 18/213 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A+  ++VYD+T ++S    ++W++E+ ++ G   ++  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL     D + VDT  AK +A+   + F E SA     V+E F  + +++      E 
Sbjct: 122 KNDLT----DKKVVDTEVAKEFADSIGIPFIETSALDSSNVEEAFLIMTKQI-----KES 172

Query: 184 LAKKNRELGNRVNNSVDINAQRPS-TNDTTTCC 215
           +AK+ ++ G R  +  ++N +  S T     CC
Sbjct: 173 VAKQQKDNG-RAEDKSNVNLKGQSLTGSNGGCC 204

>Scas_713.5
          Length = 211

 Score =  122 bits (305), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 120/219 (54%), Gaps = 23/219 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR ++  ++VYD+T +DS    + W++E+ ++     ++  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVF----RSIGEKLYASK 179
           K DL     D R V+   AK +A+   + F E SA     V+E F    R I E +   K
Sbjct: 122 KCDL----TDKRVVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQIKESMSQQK 177

Query: 180 KDEILA---KKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
            ++  A    KN + GN VN      A +  TN  ++CC
Sbjct: 178 MEDGGANGGNKNPDGGNNVN-----LAGQSLTNGGSSCC 211

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  120 bits (301), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 122/213 (57%), Gaps = 18/213 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A+  ++VYD+T ++S    ++W++E+ ++ G   +V  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL    +D + VD   A+ +A+  N+   E SA     V+E F ++  ++      E 
Sbjct: 122 KNDL----KDKKVVDFEVAREFADSLNIPVLETSALDSSNVEEAFLTMARQI-----KET 172

Query: 184 LAKKNRELGNRVNNS-VDINAQRPSTNDTTTCC 215
           ++ + +E G + + S V++  Q  + N    CC
Sbjct: 173 MSHQQKESGKKDDKSGVNLKGQSLA-NSGGGCC 204

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  117 bits (294), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 102/179 (56%), Gaps = 13/179 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F  +T+ I  +       +K ++W
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKR------VKLQLW 74

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   +++YD+T + +    R W   + N+   ED+V+ LVGN
Sbjct: 75  DTAGQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTV-NQHASEDVVMLLVGN 133

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDE 182
           K D+     D R V   + +A A+E  + F E SAK    V E+F ++  KL   K D+
Sbjct: 134 KKDM-----DTRTVSYEQGEALAKELGIPFIEASAKDDTNVSEIFFTLA-KLIQEKIDD 186

>Kwal_47.19055
          Length = 179

 Score =  116 bits (291), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 99/166 (59%), Gaps = 16/166 (9%)

Query: 33  ESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLT 92
           +STIG  F ++TI+++ ++      IK +IWDTAGQERY+++   YYR A  AL+VYD++
Sbjct: 4   KSTIGVEFATRTIEVEGKK------IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDIS 57

Query: 93  QKDSLVKARSWVEELKNKVGDEDLVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLL 152
           +  S      W+ EL+    DE++ + L+GNK DL      LRAV T EAK +A+E  LL
Sbjct: 58  KSSSYENCNHWLTELREN-ADENVAVGLIGNKSDLAH----LRAVPTDEAKNFAQENQLL 112

Query: 153 FTEVSAKTGQGVKEVFRSIGEKLYASKKDEILAKKNRELGNRVNNS 198
           FTE SA   + V + FR +   +Y     ++++K   +L    NN+
Sbjct: 113 FTETSALNSENVDQAFRELISAIY-----QMVSKHQVDLNEYGNNA 153

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  117 bits (292), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 119/213 (55%), Gaps = 16/213 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR ++  ++VYD+T ++S    + W++E+ ++     ++  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL     D R V+   AK +AE   + F E SA     V+E F ++  ++    K+ +
Sbjct: 122 KCDLA----DKRVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQI----KESM 173

Query: 184 LAKKNRELGNRVNNSVDINAQRPS-TNDTTTCC 215
             +   E   + N+  ++N +  S T   ++CC
Sbjct: 174 TQQNMNESQQKKNDKGNVNLKGQSLTQSGSSCC 206

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  117 bits (292), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 116/214 (54%), Gaps = 23/214 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ I  ++      IK ++W
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK------IKLQLW 74

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    + W+  +     DE   + LVGN
Sbjct: 75  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDE-AQLLLVGN 133

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASK--KD 181
           K D+     D RAV   + +A ++E  L F E SAK    V E+F ++  KL   K   D
Sbjct: 134 KSDM-----DTRAVTYEQGEALSKELGLPFVEASAKNDDNVNEIFFTLA-KLIQEKIDND 187

Query: 182 EILAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
           +++   N++       SV+IN+    +   + CC
Sbjct: 188 KLVGNTNKD------GSVNINSNGGGSK--SNCC 213

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  115 bits (287), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 28/195 (14%)

Query: 33  ESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLT 92
           +STIG  F ++TI+++ ++      IK +IWDTAGQERY+++   YYR A  AL+VYD++
Sbjct: 4   KSTIGVEFATRTIEVEGKK------IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDIS 57

Query: 93  QKDSLVKARSWVEELKNKVGDEDLVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLL 152
           + +S      W+ EL+    DE++ + L+GNK DL      LRAV T EAK +A+E  LL
Sbjct: 58  KSNSYENCNHWLTELRENA-DENVAVGLIGNKSDLAH----LRAVPTDEAKNFAQENQLL 112

Query: 153 FTEVSAKTGQGVKEVFRSIGEKLYASKKDEILAKKNRELGNRVNNSVDINAQR------- 205
           FTE SA   + V   FR +   +Y     ++++K   +L    ++S    A R       
Sbjct: 113 FTETSALNSENVDLAFRELITAIY-----QMVSKHQVDLNEYGSSSGSGAAPRGPTISLT 167

Query: 206 PSTNDTT-----TCC 215
           P+ N+T       CC
Sbjct: 168 PAPNETNRKKSQNCC 182

>Scas_707.26
          Length = 210

 Score =  115 bits (287), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 117/212 (55%), Gaps = 18/212 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ I  ++      +K ++W
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK------VKLQLW 70

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    + W + +     DE   + LVGN
Sbjct: 71  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDE-AQLLLVGN 129

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K D+     D R V   + ++ A+E  L F E SAK    V E+F ++ + +    +++I
Sbjct: 130 KSDM-----DTRVVTYEQGESLAKELGLPFIESSAKNDDNVNEIFFTLAKLI----QEKI 180

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
            + K    GN  + ++ INA+   +   + CC
Sbjct: 181 DSNKLAGPGNGKDANISINAKDGGSK--SNCC 210

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  114 bits (285), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 120/213 (56%), Gaps = 18/213 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T+ +  +       +K +IW
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A+  ++VYD+T ++S    ++W++E+ ++ G   ++  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL     D + V+   AK +A+   +   E SA     V+E F ++  ++      E 
Sbjct: 122 KNDLT----DKKVVEYEVAKEFADSLQIPVLETSALDSSNVEEAFLTMARQI-----KES 172

Query: 184 LAKKNRELGNRVNNS-VDINAQRPSTNDTTTCC 215
           ++++ R+ G +   + V++  Q   T  ++ CC
Sbjct: 173 MSQQQRDNGKKEEKAGVNLKGQSL-TGTSSGCC 204

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  114 bits (285), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 113/212 (53%), Gaps = 19/212 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  + + I  ++      IK ++W
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKK------IKLQLW 73

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    R W   + N+  +E+  + LVGN
Sbjct: 74  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTV-NQHANEEAQLLLVGN 132

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K D+     D RAV   + ++ A+E  + F E SAK  + V ++F ++  KL   K D  
Sbjct: 133 KKDM-----DTRAVTYEQGESLAKELGVPFIEASAKDDENVSDIFFTLA-KLIQEKID-- 184

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
               N +L N       +N    S   ++ CC
Sbjct: 185 ----NDKLVNNSGREGSVNISSGSNMPSSNCC 212

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  114 bits (284), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 116/215 (53%), Gaps = 24/215 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ I  ++      +K ++W
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK------VKLQLW 74

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    + W + +     DE   + LVGN
Sbjct: 75  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDE-AQLLLVGN 133

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVF----RSIGEKLYASK 179
           K D+     D R V   + +A A+E  L F E SAK    V E+F    R I EK+ ++K
Sbjct: 134 KSDM-----DTRVVTYEQGEALAKELGLPFIESSAKNDDNVNEIFFTLARLIQEKIDSNK 188

Query: 180 KDEILAKKNRELGNRVNNSVDINAQRPSTNDTTTC 214
                + K+   GN     + INA +  ++ +  C
Sbjct: 189 LSGPNSGKD---GN-----ISINANKGDSSKSNCC 215

>Kwal_23.5058
          Length = 213

 Score =  114 bits (284), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 110/212 (51%), Gaps = 19/212 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +T+ I  ++      +K ++W
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK------VKLQLW 74

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    + W   +     DE   + LVGN
Sbjct: 75  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHANDE-AQLLLVGN 133

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K D+     D RAV T + ++ A+E  + F E SAK    V ++F  +  KL   K D  
Sbjct: 134 KSDM-----DTRAVSTDQGESLAKELGIPFVEASAKDDTNVNDIFFQLA-KLIQEKIDS- 186

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
                + +GN   +   +N      N  + CC
Sbjct: 187 ----EKLVGNTGRDG-SVNVGAGGNNAKSNCC 213

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  113 bits (282), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 119/212 (56%), Gaps = 14/212 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T+++  +       +K +IW
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGK------TVKLQIW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR ++  ++VYD+T ++S    + W++E+ ++     ++  LVGN
Sbjct: 63  DTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGN 121

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL    +D R V+   AK +A+   + F E SA     V++ F ++  ++  S   + 
Sbjct: 122 KCDL----KDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
           L +  ++  ++ N  V++  Q   TN    CC
Sbjct: 178 LNETTQKKEDKGN--VNLKGQ-SLTNTGGGCC 206

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  110 bits (276), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 12/173 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     +ED V   ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-----DEDKVATMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172
           +GNK+D+   EE  + V+T  A+  A+   N+     SAK    V+  F  I 
Sbjct: 124 LGNKIDV---EESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIA 173

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  110 bits (276), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (56%), Gaps = 12/173 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     + D V   ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-----DGDKVATMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172
           +GNK+D+   EE  + V T  ++  A+   N+ F   SAK    V + F  I 
Sbjct: 124 LGNKIDV---EESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIA 173

>Scas_656.2
          Length = 218

 Score =  109 bits (273), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 111/212 (52%), Gaps = 20/212 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F  +T+ I+  +      IK ++W
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRK------IKLQLW 80

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    R W   + N+  +E + + LVGN
Sbjct: 81  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTV-NEHANEQVQLLLVGN 139

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K DL       R V   + +  A E  L F E SAK    V ++F  +  KL   K D  
Sbjct: 140 KSDLGN-----RQVTKEQGEELARELGLPFMEASAKNDDNVNDLFLQLA-KLIQEKID-- 191

Query: 184 LAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215
               N E+G       ++N  +     T++CC
Sbjct: 192 ----NDEMGEPRTAKKNVNI-KSKDGKTSSCC 218

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  109 bits (273), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 101/178 (56%), Gaps = 13/178 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +T+ I  ++      +K ++W
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK------VKLQLW 74

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQER++++   YYR A   ++VYD+T + +    + W + +     DE  ++ LVGN
Sbjct: 75  DTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-LVGN 133

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKD 181
           K D+     + R V   + +A A+E  + F E SAK    V E+F ++  KL   K D
Sbjct: 134 KSDM-----ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLA-KLIQEKID 185

>Kwal_56.22440
          Length = 208

 Score =  107 bits (266), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 95/173 (54%), Gaps = 12/173 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ + +     + D V   ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM-----DGDKVATMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172
           +GNKLD+   EE  + V    A+  A+   N+     SAK    V   F  I 
Sbjct: 124 LGNKLDV---EESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIA 173

>Scas_674.5
          Length = 208

 Score =  105 bits (262), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 94/172 (54%), Gaps = 10/172 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + I     ++D V   ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI-----DDDKVATMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIG 172
           +GNK+D+ E ++ + A    E         L  T  SAK    +   F  I 
Sbjct: 124 LGNKVDIDETKKVVSANAAQELAKSLGNTPLFMT--SAKDSINIDNAFEEIA 173

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  104 bits (260), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 98/175 (56%), Gaps = 16/175 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +      +D V   ++W
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVN-----DDKVATMQVW 62

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQN---LLFTEVSAKTGQGVKEVFRSIG 172
           + NK+D+   EE  + V +  A+  A+      L FT  SAK    V++ F  I 
Sbjct: 123 LANKVDV---EESKKVVSSRSAQEQAKSLGNVPLFFT--SAKDSINVQDAFEEIA 172

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  103 bits (258), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 81/127 (63%), Gaps = 8/127 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     ++D V+  ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-----DDDKVVTMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 123

Query: 121 VGNKLDL 127
           +GNK+D+
Sbjct: 124 LGNKVDI 130

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  103 bits (256), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 93/173 (53%), Gaps = 12/173 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +       D V   ++W
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDG-----DKVATMQVW 63

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120
           DTAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     +
Sbjct: 64  DTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVI 123

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172
           +GNK+D    EE  + V    A+  A+   ++     SAK    V   F  I 
Sbjct: 124 LGNKID---AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIA 173

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 89.0 bits (219), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 95/182 (52%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E      IKF++W
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE------IKFDVW 67

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA  A++++D+T + +     +W  +L      E++ I L GN
Sbjct: 68  DTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 125

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + E 
Sbjct: 126 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEF 179

Query: 184 LA 185
           +A
Sbjct: 180 VA 181

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 95/182 (52%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E      IKF++W
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE------IKFDVW 66

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA  A++++D+T + +     +W  +L      E++ I L GN
Sbjct: 67  DTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 124

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + E 
Sbjct: 125 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEF 178

Query: 184 LA 185
           +A
Sbjct: 179 VA 180

>Kwal_33.14015
          Length = 271

 Score = 89.0 bits (219), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 90/168 (53%), Gaps = 10/168 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
             K+V++GD +VGK+ ++  + +  F E     I   F +   K+K  +   + V++  +
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPE---EYIPTVFENYVTKMKGPD---NTVVELAL 118

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y + +  +V Y +  K SL+  +  W+ E+++   D    I LV
Sbjct: 119 WDTAGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--ILLV 176

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVF 168
           G K DL   +   + VD  EA  +A E NLL   + S+K+ Q V+E+F
Sbjct: 177 GLKSDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELF 224

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 87.4 bits (215), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      IKF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGE------IKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + E 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 86.7 bits (213), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      IKF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE------IKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + E 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>Scas_586.6
          Length = 219

 Score = 85.9 bits (211), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +      E      IKF+ W
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGE------IKFDCW 66

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 67  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 124

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + E 
Sbjct: 125 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEF 178

Query: 184 LA 185
           +A
Sbjct: 179 VA 180

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      IKF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE------IKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + + 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      IKF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE------IKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + + 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      IKF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE------IKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + + 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 90/174 (51%), Gaps = 19/174 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  + I          ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVAD-VDIDGRR------VELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  WV E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLVGC 122

Query: 124 KLDLCEGEEDL--------RAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVF 168
           K+DL    + L        R V  +E  A A +   + + E SA+TGQGVKEVF
Sbjct: 123 KVDLRNDPQVLQQLQAEGQRPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVF 176

>Scas_691.36
          Length = 212

 Score = 84.0 bits (206), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 95/176 (53%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   ++       A+ + +   ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYV-------ADVEVDGRRVELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  W+ E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 124 KLDL---CEGEEDLRA-----VDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRS 170
           K+DL    +  E LRA     V T+E ++ AE+     + E SAKTG GV+EVF +
Sbjct: 123 KVDLRNDPQAIEALRADEQQPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFEA 178

>Kwal_56.23361
          Length = 214

 Score = 84.0 bits (206), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 93/182 (51%), Gaps = 14/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           FKLVL+GD   GK++ V R +   F++   +TIG             E      +KF++W
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGE------LKFDVW 61

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           DTAGQE++  L   YY NA   ++++D+T + +     +W  +L      E++ I L GN
Sbjct: 62  DTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGN 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+D+ E +   + +       +  ++NL + ++SAK+    ++ F  +  KL  + + + 
Sbjct: 120 KVDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDF 173

Query: 184 LA 185
           +A
Sbjct: 174 VA 175

>Kwal_55.21937
          Length = 208

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 94/176 (53%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   ++       A+ Q +   ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYV-------ADVQVDGRQVELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  W+ E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILVGC 122

Query: 124 KLDLCEGE---EDLRA-----VDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVFRS 170
           K+DL +     E LRA     V   EA++ A++     + E SAKTG GV+EVF +
Sbjct: 123 KVDLRDNPQTVEALRAIGQQPVTGPEAQSVADKIGASAYYECSAKTGYGVREVFEA 178

>Kwal_55.21941
          Length = 209

 Score = 81.3 bits (199), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 26/194 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F ++   T+   ++       A+ + +   ++  +WD
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYV-------ADVEVDGRRVELALWD 66

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL      W+ E+ +    + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 124 KLDL---CEGEEDLRA-----VDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRSIGEK 174
           K+DL    +  E+LRA     V    A+  AE+   + + E SAKTG GV+EVF      
Sbjct: 125 KVDLRNDSQVIENLRANGHEPVSQGAAQEVAEQIGAVEYIECSAKTGYGVREVFE----- 179

Query: 175 LYASKKDEILAKKN 188
             A+ +  ++ K+N
Sbjct: 180 --AATRASLMGKQN 191

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 21/177 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   ++       A+ + +   ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYV-------ADVEVDGRRVELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  W+ E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 124 KLDL---CEGEEDLRAVDTSEAKAYAEEQNLL-------FTEVSAKTGQGVKEVFRS 170
           K+DL    +  E LRA +  +  A A+ QN+        + E SAKTG GV+EVF +
Sbjct: 123 KVDLRNDPQTLEQLRA-EGLQPVATADGQNVADQIGATGYYECSAKTGYGVREVFEA 178

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 94/176 (53%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F ++   T+   F +    ++ + +     ++  +WD
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTV---FDNYVADVEVDGRR----VELALWD 66

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ Y +   DSL      W+ E+ +    + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 124 KLDL---CEGEEDLRA-----VDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRS 170
           K DL    +  E+LRA     V  ++A+  A++   + + E SAKTG GV+EVF +
Sbjct: 125 KADLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFEA 180

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 93/176 (52%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   ++       A+ + +   ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYV-------ADVEVDGRRVELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  W+ E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 124 KLDL---CEGEEDLR-----AVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRS 170
           K+DL    +  E LR      V + E ++ A++     + E SAKTG GV+EVF +
Sbjct: 123 KVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEA 178

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 80.5 bits (197), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 114/225 (50%), Gaps = 26/225 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIK--AEEQEEDVVI 58
           M   K V++GD +VGK+S++  +  +SF +    T+   + S TI ++  A    E  + 
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNY-STTIAVQDPASSTGEQQLF 75

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLV 117
           K  +WDTAGQE Y  L P+ Y   +  L+ + + +  S    R  W  E+K+    E++ 
Sbjct: 76  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENME 135

Query: 118 IF---------LVGNKLDLC--EGEED-LRAVDT-----SEAKAYAEEQNLL-FTEVSAK 159
           +F         LVG K DL   + EED LR ++T     +E +   ++   + + E SA 
Sbjct: 136 LFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAA 195

Query: 160 TGQGVKEVF-RSIGEKLYASKKDEILAKKNRELGNRVNNSVDINA 203
           T +GV+EVF R++   +Y   +   L  +++ +   VN+ + +++
Sbjct: 196 TQEGVREVFERAVKYVVYEPDR---LMNRSKNMSILVNSPLPLDS 237

>Scas_610.4
          Length = 211

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 92/174 (52%), Gaps = 19/174 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   ++       A+ + +   ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYV-------ADVEVDGRRVELALWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   +  W+ E+ +    + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 124 KLDL--------CEGEEDLRAVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVF 168
           K+DL           EE  + V +++ ++ A++     + E SAKTG GV+EVF
Sbjct: 123 KVDLRNDPQTIEALREEGQQPVSSADGQSVADQIGATGYYECSAKTGFGVREVF 176

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 91/176 (51%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  +++          ++  +WD
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTD-VEVDGRH------VELTLWD 64

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P  Y ++N  L+ + +   DSL   +  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILVGC 122

Query: 124 KLDLCEGEEDL--------RAVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRS 170
           K+DL +  + +        R V T++ +  A+    + + E SAK+G GV+EVF +
Sbjct: 123 KVDLRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFEA 178

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 26/194 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F ++   T+   ++       A+ + +   ++  +WD
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYV-------ADVEVDGRRVELALWD 66

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ + +   DSL      W+ E+ +    + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 124 KLDL---CEGEEDLR-----AVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRSIGEK 174
           K+DL    +  E LR      V  + A+  A++   + + E SAKTG GV+EVF      
Sbjct: 125 KVDLRNDPQVVESLRTNGQEPVSQASAQEVADQIGAVEYIECSAKTGFGVREVFE----- 179

Query: 175 LYASKKDEILAKKN 188
             A+ +  ++ K+N
Sbjct: 180 --AATRASLMGKQN 191

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 78.6 bits (192), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 101/220 (45%), Gaps = 19/220 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
             K+V++GD +VGK+ ++  +V+ +F      TI   +++        E     +I+  +
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNI------EGPNGQIIELAL 125

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y NA+  +V Y +  K SL      W  E+K+        I LV
Sbjct: 126 WDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IMLV 183

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180
           G K DL E +     V+ S A++ A+        + SA+  + + EVF +    L +   
Sbjct: 184 GLKSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLS--- 240

Query: 181 DEILAKKNRELGNRVNNSVDINAQR----PSTNDTTTCCS 216
           D + A   RE  + + N    N  R     ST DT+   S
Sbjct: 241 DSLYAP--REPTHTIKNPFKRNTTRSDIDSSTGDTSVSIS 278

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 76.3 bits (186), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 90/174 (51%), Gaps = 18/174 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           +++ KLV++GD + GK+S+++ F    F E    T+   +++         + + + ++ 
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDC-------RVDGIKVQL 57

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIF 119
            +WDTAGQE Y+ L P  Y  AN  L+ + +   +SL+ AR+ W EE         +V  
Sbjct: 58  ALWDTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV-- 115

Query: 120 LVGNKLDL----CEGEEDL-RAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVF 168
           LVG K DL      GEE + R      A+A   ++   + E SA TG+GV ++F
Sbjct: 116 LVGLKKDLRKSVGNGEEVVTREAAEQVARAIGAKR---YMECSALTGEGVDDIF 166

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 76.6 bits (187), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (51%), Gaps = 19/176 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+ ++  F K  F ++   T+   ++       A+ + +   ++  +WD
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYV-------ADVEVDGRRVELALWD 65

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y  L P+ Y ++N  L+ Y +   DSL      W+ E+      + + I LVG 
Sbjct: 66  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILVGC 123

Query: 124 KLDL---CEGEEDLR-----AVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKEVFRS 170
           K DL    +  E LR      V  ++A+  A++   + + E SAKTG GV+EVF +
Sbjct: 124 KADLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFEA 179

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 86/166 (51%), Gaps = 11/166 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+S+++ F    F E    T+   +++         + + + ++  +WD
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDC-------RVDGIKVQLTLWD 61

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y+ L P  Y  A+  L+ + +   +SLV AR+ W EE+     +  +V  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGL 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVF 168
           K DL   + + + V   +A+  A       + E SA TG+ V +VF
Sbjct: 120 KKDLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVF 165

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 94/190 (49%), Gaps = 15/190 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+V++GD + GK+S++  + +  F E    TI   +++        E     VI+  +
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNI------EGPRGKVIELAL 105

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y + +  +V Y    + SL  A   W  E+++      ++  LV
Sbjct: 106 WDTAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LV 163

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVFRS-IGEKLYASK 179
           G K DL   +   R VD ++A+  A +    +  + SAKT Q +++VF + I   LY   
Sbjct: 164 GLKSDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALY--- 220

Query: 180 KDEILAKKNR 189
            DE+ A   R
Sbjct: 221 -DELRAPPQR 229

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+S+++ F    F E    T+   +++         + + + +   +WD
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC-------RVDGIKVSLALWD 61

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y+ L P  Y  A+  L+ + +   +SL  AR+ W EE      D  ++  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGL 119

Query: 124 KLDLCEG-EEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVF 168
           K DL +  +E +  V+  +A+  A+      + E SA TG+GV +VF
Sbjct: 120 KEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVF 166

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 85/170 (50%), Gaps = 19/170 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+S++H F    F E    T+   +++         + + + ++  +WD
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDC-------RVDGIKVQLALWD 61

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SW-VEELKNKVGDEDLVIFLVG 122
           TAGQE Y+ L PM Y  A+  L+ + +    SL  AR  W VE L+      +  I LVG
Sbjct: 62  TAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYC---PNAPIILVG 118

Query: 123 NKLDLCEGEEDLRAVDTSEA----KAYAEEQNLLFTEVSAKTGQGVKEVF 168
            K DL         V  S+A    +A   ++   + E SA TG+GV +VF
Sbjct: 119 LKKDLRRPGTQCAMVAPSQAQEVVRAIGAKK---YMECSALTGEGVDDVF 165

>Scas_444.4*
          Length = 289

 Score = 75.9 bits (185), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 92/186 (49%), Gaps = 16/186 (8%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
              K+V++GD  VGK+ ++  +V+  F       I   F +     +  + E   V++  
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQREFPT---GDIPTVFENYVTDFEGPDGE---VVELA 115

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLVIFL 120
           +WDTA QE Y  L P+ Y + +  LV Y +    SL    RSW+ E+K+      ++  L
Sbjct: 116 LWDTAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--L 173

Query: 121 VGNKLDLCEGEEDLRA-VDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVF----RSI-GE 173
           VG K DL +  E+    VD  EA+  AE+   L   + SAKT Q V++VF    R++   
Sbjct: 174 VGLKSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVFTVAIRTVLAG 233

Query: 174 KLYASK 179
            LYA K
Sbjct: 234 SLYAGK 239

>Scas_578.7
          Length = 187

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 84/166 (50%), Gaps = 11/166 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+S+++ F    F +    T+   +++         + + + +   +WD
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDC-------RVDGIKVSLTLWD 61

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y+ L P  Y  A+  L+ + +   +SL  AR+ W EE      +    I LVG 
Sbjct: 62  TAGQEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAP--IILVGL 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNL-LFTEVSAKTGQGVKEVF 168
           K DL + ++ +  V   +A+  A       + E SA TG+GV +VF
Sbjct: 120 KKDLRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVF 165

>Kwal_47.16983
          Length = 223

 Score = 74.7 bits (182), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 89/174 (51%), Gaps = 9/174 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ I + + E      I F I 
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSAE------ILFYIM 72

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           D  GQ  + ++ P+    A A + ++DLT+ ++L   + W  +      +E  V  LVG 
Sbjct: 73  DLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATG--FNEQAVPLLVGT 130

Query: 124 KLDL-CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           K DL    + + +A  + ++  YA+  +      S      V+++F+ +  KLY
Sbjct: 131 KYDLFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLY 184

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 72.8 bits (177), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 18/172 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KLV++GD + GK+S+++ F    F E    T+   +++         + + + +   +WD
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC-------RVDGIKVSLTLWD 61

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLVGN 123
           TAGQE Y+ L P  Y  A+  L+ + +   +SL+ AR+ W +E      D  +V  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGL 119

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLL-------FTEVSAKTGQGVKEVF 168
           K DL   E   +   T E     + + +        + E SA TG+GV +VF
Sbjct: 120 KKDL-RQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVF 170

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 73.6 bits (179), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 89/189 (47%), Gaps = 22/189 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAE--EQEEDVVI 58
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI +        E  + 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDED-- 115
           K  +WDTAGQE Y  L P+ Y   +  L+ + + + +S       W  E+K+    E+  
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 116 -------LVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQ-----NLL----FTEVSAK 159
                  L I LVG K DL + + +   +  S +   +++Q     N L    + E SA 
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQIQELVNKLGLMGYVECSAA 179

Query: 160 TGQGVKEVF 168
           T  GV+EVF
Sbjct: 180 TQVGVREVF 188

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 94/190 (49%), Gaps = 15/190 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
             K+V++GD +VGK+S++  + +  F E    TI   +++        E     +++  +
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTIFENYVTNL------EGPNGKIVELAL 84

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y + +  ++ Y +  K S       W+ E+K+     D+ I +V
Sbjct: 85  WDTAGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFC--PDVPIMIV 142

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVF-RSIGEKLYASK 179
           G K DL   +     VD  +A+  A+     +  + S+K+ Q V+EVF  +I   LY   
Sbjct: 143 GLKSDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALY--- 199

Query: 180 KDEILAKKNR 189
            DE+  KK +
Sbjct: 200 -DELKPKKKK 208

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 91/191 (47%), Gaps = 15/191 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
             K+V++GD +VGK+ ++  + +  F      TI   ++S+       +   + VI+  +
Sbjct: 77  HLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSKV------QGPRNKVIELAL 130

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y + +  +V Y +  K S    +  W  E+K+   D    + LV
Sbjct: 131 WDTAGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAP--VMLV 188

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVFR-----SIGEKL 175
           G K DL   +   + VD  +A   A++       + SAK+   V EVF      ++ ++L
Sbjct: 189 GLKSDLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVFNLAMTTALYDEL 248

Query: 176 YASKKDEILAK 186
           Y ++   I  K
Sbjct: 249 YGARDSSIFRK 259

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 88/189 (46%), Gaps = 22/189 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKI--KAEEQEEDVVI 58
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI +   ++   E  V 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLV 117
           K  +WDTAGQE Y  L P+ Y   +  ++ + + +  S       W  E+++    E++ 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 118 IF---------LVGNKLDLCEGEEDLRA--------VDTSEAKAYAEEQNLL-FTEVSAK 159
           +F         LVG K DL E E +L          VD  E      +   + + E SA 
Sbjct: 120 LFSSCGKFPILLVGTKADLREDEHELDRLRELNSDFVDRHEIDHAVSKCGFMGYVECSAA 179

Query: 160 TGQGVKEVF 168
           T  GV+EVF
Sbjct: 180 TQFGVREVF 188

>Kwal_33.14452
          Length = 260

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 89/187 (47%), Gaps = 20/187 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+S++  +  ++F +    T+   + + TI +   +  E  V + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-TTTIALNDGDSAEPQVFRL 59

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIF 119
            +WDTAGQE Y  L P+ Y   +  L+ + + + +S    +  W  E+++    E+L +F
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 120 ---------LVGNKLDLC--EGEEDLRA------VDTSEAKAYAEEQNLL-FTEVSAKTG 161
                    LVG K DL   E E+D  A      V   +      +  L+ + E SA T 
Sbjct: 120 RVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGYVECSAATQ 179

Query: 162 QGVKEVF 168
            GV +VF
Sbjct: 180 VGVADVF 186

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 71/126 (56%), Gaps = 8/126 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I + +     DV+  F 
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGS----TDVI--FS 67

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           I D  GQ  + ++ P+    A A + ++DLT+ ++L   R W  + +    +E  +  LV
Sbjct: 68  IMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARG--FNETAIPLLV 125

Query: 122 GNKLDL 127
           G K DL
Sbjct: 126 GTKYDL 131

>Scas_547.3
          Length = 223

 Score = 71.2 bits (173), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 92/173 (53%), Gaps = 17/173 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + ++IK+        I F 
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN------IVFS 76

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           + D  GQ+ + ++ P+   N++  + ++DLT+ +SL   ++W  +      + D V  LV
Sbjct: 77  LMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGL--NHDAVCILV 134

Query: 122 GNKLDL-----CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFR 169
           G K DL      E +E +    TS   A A +  L+F+  S+     ++++F+
Sbjct: 135 GTKYDLFIDLPTEYQEQIS--RTSMKYAQAMDSPLIFS--SSIASINIQKIFK 183

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 71.6 bits (174), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 13/178 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I + +     DVV  F 
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGS----TDVV--FS 111

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           I D  GQ  + ++ P+    A + + ++DLT+ ++L   + W  + +    +E  +  LV
Sbjct: 112 IMDLGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIALLV 169

Query: 122 GNKLDL---CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           G K DL    + E   +   TS   A A +  L+F   S      ++++F+ I  K +
Sbjct: 170 GTKYDLFITMDSEYQEQISRTSMKYAQAMDSPLVFCSTSNSI--NIQKIFKVIIAKAF 225

>Scas_417.3
          Length = 291

 Score = 70.5 bits (171), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 90/198 (45%), Gaps = 31/198 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIK---------AEE 51
           M Q K V++GD +VGK+S++  +  ++F +    T+   + S TI ++         A E
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTISLRDPFLSRESLANE 59

Query: 52  QEEDVV--IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVK-ARSWVEELK 108
            E D +   K  +WDTAGQE Y  L P+ Y   +  L+ + + +  S       W+ E+K
Sbjct: 60  NENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIK 119

Query: 109 NKVGDED---------LVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQ---------N 150
                E          L I L+G K DL + E   + +  + ++    +Q          
Sbjct: 120 QNANVESSELFLQFGKLPIMLIGTKADLRDDEAVQKKLQETNSQFITRDQIDQVVDKYGF 179

Query: 151 LLFTEVSAKTGQGVKEVF 168
           L + E SA T  GV+EVF
Sbjct: 180 LGYVECSAATQMGVREVF 197

>Scas_677.20
          Length = 283

 Score = 69.7 bits (169), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 105/228 (46%), Gaps = 23/228 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIK--AEEQEEDVVI 58
           M   K  ++GD  VGK+ ++  +  ++F      T+   + S TI +    + +EE    
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLV 117
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + +    SL   +S WV E+KN   +++L 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 118 IFLVGNKLD--LCEGEEDLRAVDTSEAKAYAEE--QNLL-------FTEVSAKTGQGVKE 166
           +F   N+    L   + D R  D  + K    E  Q+++       + E SA +  G+K+
Sbjct: 120 VFQSRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALSQMGIKD 179

Query: 167 VFRS------IGEKLYASKKDEILAKKNRELGNRVNNSVDINAQRPST 208
           VF         G+ +   ++  + A+K R      N ++D+     ST
Sbjct: 180 VFEEAVKAVVYGDGIETPERGAMAAQKTRT--TSTNTALDVPVSGVST 225

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 69.7 bits (169), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 10/177 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    I+  + +   +I+  +
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQGPKGQ---IIELAL 136

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLV 121
           WDTAGQE Y  L P+ Y  A+  ++ Y +    SL      W  E+++        + LV
Sbjct: 137 WDTAGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTP--VMLV 194

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQN-LLFTEVSAKTGQGVKEVFRSIGEKLYA 177
           G K DL E E     VD +EA + A++       + SAK    V  VF +   +L A
Sbjct: 195 GLKSDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVFYAAINELLA 251

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 69.3 bits (168), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 92/170 (54%), Gaps = 13/170 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++K+V++G   VGKS++  +F++  F +  + TI  ++  Q +        +D V   +I
Sbjct: 10  EYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVI-------DDKVSILDI 62

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IFLV 121
            DTAGQE Y ++   Y R     L+VY +T ++S  +  S+ ++++ +V D D + + +V
Sbjct: 63  LDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVVVV 121

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           GNKLDL    E+ R V   +    A++ N  F E SAK    V E F S+
Sbjct: 122 GNKLDL----ENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSL 167

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 93/190 (48%), Gaps = 13/190 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+T+K+        V+   EI D
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKLG------KVMYTLEICD 79

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVG-DEDLVIFLVGN 123
           TAGQ+ +  +           LVVY +  + S        +++ +++G DE++ + + GN
Sbjct: 80  TAGQDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGN 139

Query: 124 KLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDEI 183
           K+DLC    + R V   E +  A+     F+E SAK    V++V       L   K + +
Sbjct: 140 KIDLCPDGGNNRQVTREEGQQLAKSLGAGFSECSAKLNWNVEDVM-----MLLLKKIEGV 194

Query: 184 LAKKNRELGN 193
             + +R +G+
Sbjct: 195 STRGSRSIGS 204

>Scas_703.41
          Length = 225

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 70/122 (57%), Gaps = 10/122 (8%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAG 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + +K+ + +      I F + D  G
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTD------IVFSLMDLGG 78

Query: 68  QERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVI-FLVGNKLD 126
           Q+ + ++ P+    ++  + ++DLT+ ++L   + W  ++K   G  D+ I  LVG K D
Sbjct: 79  QKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTKYD 135

Query: 127 LC 128
           L 
Sbjct: 136 LL 137

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 89/171 (52%), Gaps = 11/171 (6%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAG 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + + I++ +      I F + D  G
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTD------IVFSLMDLGG 86

Query: 68  QERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVI-FLVGNKLD 126
           Q  + ++ P+    ++  ++++DLT+ ++L   + W    +  +G  D  I  LVG K D
Sbjct: 87  QREFINMLPIATLGSSVIILLFDLTRPETLNSIKEW---YRQALGLNDSAIPILVGTKYD 143

Query: 127 L-CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           L  + EE+ +   +  +  YA+  +      S      ++++F+    K++
Sbjct: 144 LFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIF 194

>Scas_697.46
          Length = 324

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++KLV++G   VGKS++  + +   F +  + TI  ++  Q +        +D V   ++
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVVI-------DDKVTVLDV 62

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IFLV 121
            DTAGQE Y ++   Y R     L+VY +T K+S  +  ++ ++++ +V D D + + +V
Sbjct: 63  LDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQ-RVKDSDYIPVVIV 121

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           GNK DL    ED R V        A++ N  F E SAK    V+E F ++
Sbjct: 122 GNKSDL----EDERQVPYQSGVNLAKQMNAPFLETSAKQAINVEEAFYTL 167

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 27/182 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           K+V+LGD + GK+S+++ F +  F E+ E T+   ++            ++  I   +WD
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-------DNRHITLSLWD 74

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFLVGN 123
           TAGQE +  L  + Y + +  ++ + +  +DSL   ++ WV E+ +     +LV  LV  
Sbjct: 75  TAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVAL 132

Query: 124 KLDLCEGEEDL----------------RAVDTSEAKAYAEEQNLL-FTEVSAKTGQGVKE 166
           K DL   E ++                  +   E  A A++   L + E SAK  +GV E
Sbjct: 133 KCDLRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGVNE 192

Query: 167 VF 168
            F
Sbjct: 193 AF 194

>Kwal_26.8387
          Length = 292

 Score = 67.0 bits (162), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 13/170 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +        +D V   +I
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI-------DDKVSILDI 68

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IFLV 121
            DTAGQE Y ++   Y R     L+VY +T + S  +  ++ +++  +V D D V +FLV
Sbjct: 69  LDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQIL-RVKDADYVPVFLV 127

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           GNK DL    ED R V   E  + A++ N  F E SAK    V++ F  +
Sbjct: 128 GNKSDL----EDERQVAYEEGVSLAKQFNAPFMETSAKQAINVEDSFYGL 173

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 92/177 (51%), Gaps = 11/177 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + + + +     DV+  F 
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGS----TDVI--FS 68

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVI-FL 120
           I D  GQ  + ++ P+    A A + ++DLT+ ++L   + W  + +   G  D  I  L
Sbjct: 69  IMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQAR---GFNDTAISIL 125

Query: 121 VGNKLDL-CEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           VG K DL  + + + +   +  A  YA+         S ++   V+++F+ +  K +
Sbjct: 126 VGTKYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAF 182

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 66.2 bits (160), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 13/170 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++KLV++G   VGKS++  +  +  F +  + TI  ++  Q +        +D V   +I
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVI-------DDEVSILDI 62

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IFLV 121
            DTAGQE Y ++   Y RN    L+VY +T K SL +  ++ +++  +V D D V I +V
Sbjct: 63  LDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDTDYVPIVVV 121

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           GNK DL    E+ + V   +    A++ N  F E SAK    V+E F ++
Sbjct: 122 GNKSDL----ENEKQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAFYTL 167

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 98/219 (44%), Gaps = 23/219 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K VL+GDS VGK++ +  +   SF      T+   +L+ TI    +++E       
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT-TI----QDKETGYTFHT 55

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDED---- 115
             WDT+G +++  L P+ Y   +  L  +      S    +  W+ ELK  +   D    
Sbjct: 56  TFWDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSST 115

Query: 116 LVIFLVGNKLDLCEG-----------EEDLRAVDTSEAKAYAEEQNLL-FTEVSAKTGQG 163
           + I LV  K DL +            E D   +  S       ++NLL F + S+KTG G
Sbjct: 116 VPILLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYG 175

Query: 164 VKEVFRSIGEKLYASKKDEILAKKNRELGNRVNNSVDIN 202
           +++V  ++  K   +K+ E+ +  +R++      + D++
Sbjct: 176 LQDVIDNVA-KYVGAKERELRSLSSRDVPELYTKTSDVD 213

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 85/169 (50%), Gaps = 12/169 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +TI+I      ++ V   
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTIEI------DNKVFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EI DTAG  ++ ++  +Y +     L+VY +T +DSL +     E++      + + + L
Sbjct: 54  EILDTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPMVL 113

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVF 168
           VGNK DL     D R +   E    + +   + F E SA     V EVF
Sbjct: 114 VGNKADLV----DDRIIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVF 158

>Kwal_23.2944
          Length = 184

 Score = 63.2 bits (152), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 82/167 (49%), Gaps = 17/167 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+++LG  + GK++I+++      ++++ S     F  +T+  +         +KF +
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN--------VKFNM 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQ+R + L   Y+    A + V D    + L +A+   EEL + +GD   E++V+ 
Sbjct: 66  WDVGGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVVLL 122

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKE 166
           ++ NK DL          D  E KA+ + Q       +A TGQG+ E
Sbjct: 123 VLANKQDLKGAMNPQEISDYLELKAHLDSQLWCVIGSNALTGQGLVE 169

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 63.5 bits (153), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 72/137 (52%), Gaps = 10/137 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++   I + ++       I   
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYI-HDIFVDSKH------ITLS 67

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFL 120
           +WDTAGQE +  L  + Y +    ++ + +  +DSL   ++ WV E+ +    E + + L
Sbjct: 68  LWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC--EGVKLVL 125

Query: 121 VGNKLDLCEGEEDLRAV 137
           V  K DL   E +  A+
Sbjct: 126 VALKCDLRNNENESNAI 142

>Kwal_14.2244
          Length = 244

 Score = 63.2 bits (152), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 107/213 (50%), Gaps = 21/213 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I      ++ V   
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTMEI------DNKVFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSL---VKARSWVEELKNKVGDEDLV 117
           EI DTAG  ++ ++  +Y ++    L+VY +T + SL   ++ R  V  +K+   +  + 
Sbjct: 54  EILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKD---NSRVP 110

Query: 118 IFLVGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           + LVGNK DL    +D R +   E    + +   + F E SA     V EVF  +  ++ 
Sbjct: 111 MVLVGNKADL----QDERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQII 166

Query: 177 ASKKDEILAKKNRELGNRVNNSVDINAQRPSTN 209
            ++  E  A  N  LG+   N+  ++A  P T+
Sbjct: 167 RNEI-EAQASSNVGLGHLSRNNTGLSA--PGTS 196

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 32/190 (16%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   F +    I  + Q     I   
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTV---FENYIHDIFVDNQH----ITLS 66

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFL 120
           +WDTAGQE +  L  + Y + +  ++ + +  +DSL   ++ WV E+ +    E + + L
Sbjct: 67  LWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHC--EGVKLVL 124

Query: 121 VGNKLDLCEGEE---------------------DLRAVDTSEAKAYAEEQNLL-FTEVSA 158
           V  K DL   +E                         +   E  A A++   L + E SA
Sbjct: 125 VALKCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIPYDEGLAMAKQIGALRYLECSA 184

Query: 159 KTGQGVKEVF 168
           K  +GV E F
Sbjct: 185 KMNRGVNEAF 194

>Scas_671.35
          Length = 234

 Score = 62.4 bits (150), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 66/127 (51%), Gaps = 10/127 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++            ++  I   
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-------DNKHITLS 67

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFL 120
           +WDTAGQE +  L  + Y + +  ++ + +  +DSL   +  WV E+ +    E + + L
Sbjct: 68  LWDTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHC--EGVKLVL 125

Query: 121 VGNKLDL 127
           V  K DL
Sbjct: 126 VALKCDL 132

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 86/170 (50%), Gaps = 9/170 (5%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAG 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL + + I++ +      I F I D  G
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTD------IIFSIMDLGG 78

Query: 68  QERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNKLD- 126
           Q  + ++ P+    ++  + ++DLT+ ++L   + W  +      ++  +  LVG K D 
Sbjct: 79  QREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGL--NDSAIPILVGTKYDL 136

Query: 127 LCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLY 176
           L + + + +   +  +  YA+  N      S      ++++F+    K++
Sbjct: 137 LIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIF 186

>Kwal_23.4875
          Length = 230

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 90/195 (46%), Gaps = 38/195 (19%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   F +    I  + Q     I   
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTV---FENYIHDIFVDNQH----ITLS 66

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFL 120
           +WDTAGQE +  L  + Y + +  ++ + +  +DSL   +  WV E+ +    E + + L
Sbjct: 67  LWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHC--EGVKLVL 124

Query: 121 VGNKLDLCEGEEDLRAVDTS--------------------------EAKAYAEEQNLL-F 153
           V  K DL    E+  A+D++                          E  A A++   L +
Sbjct: 125 VALKCDLRSNNEEF-ALDSAITPGNIQQQQQQQQSSLQSNGLISYEEGLAMAKKIGALRY 183

Query: 154 TEVSAKTGQGVKEVF 168
            E SAK  +GV E F
Sbjct: 184 LECSAKMNRGVNEAF 198

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 68/127 (53%), Gaps = 10/127 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E TI   F +    I  + Q     I   
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTI---FENYIHDIFVDNQH----ISLS 65

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARS-WVEELKNKVGDEDLVIFL 120
           +WDTAGQE +  L  + Y + +  ++ + +  +DSL   ++ WV E+ +    E + + L
Sbjct: 66  LWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHC--EGVKLVL 123

Query: 121 VGNKLDL 127
           V  K DL
Sbjct: 124 VALKCDL 130

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 91/199 (45%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +       +I 
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCLI- 112

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
            VG ++DL E +        + LR +   + + +A E + + + E SA T +G+K VF  
Sbjct: 113 -VGTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>Kwal_55.21971
          Length = 421

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (55%), Gaps = 9/97 (9%)

Query: 34  STIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDLT 92
           STIG    +  + I      ++   K  +WDTAGQERY+ ++ P  Y+ +N  L+ YD+ 
Sbjct: 202 STIGVDIRTNLVNI------DNRYFKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDIC 255

Query: 93  QKDSLVKARS-WVEELKNKVGDED-LVIFLVGNKLDL 127
            + S       W++E+ N   D+  L I+LVGNK+DL
Sbjct: 256 SRKSFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDL 292

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 86/181 (47%), Gaps = 17/181 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+++LG    GK++I+++      ++++ ST    F  +T+  K         +KF +
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYKN--------VKFNM 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQ+R + L   Y+    A + V D + ++ + +A+   EEL + +G+   E++V+ 
Sbjct: 66  WDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVVLL 122

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASK 179
           +  NK DL +  +     D  E +   + Q       +A +GQG+ E    I       K
Sbjct: 123 VWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNNTNVPK 182

Query: 180 K 180
           K
Sbjct: 183 K 183

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 92/188 (48%), Gaps = 14/188 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q + I  +      V   +I
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVV-IDGQ------VSILDI 62

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
            DTAGQE Y ++   Y R     L+VY +T + S  +  ++ +++      E + IF+VG
Sbjct: 63  LDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQILRVKDVEYVPIFVVG 122

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKDE 182
           NK DL EGE   R V   E    A   N  F E SAK    V+E F  +   +   + D 
Sbjct: 123 NKSDL-EGE---RQVSFEEGAELARHFNASFLETSAKQAINVEESFYGLARLV---RDDG 175

Query: 183 ILAKKNRE 190
           I A K  E
Sbjct: 176 IHAGKRLE 183

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  Q +        +D V   +I
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVVI-------DDKVTILDI 60

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD-EDLVIFLV 121
            DTAGQE Y ++   Y R     L+VY +T + S  +  ++ ++++ +V D E + + +V
Sbjct: 61  LDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQ-RVKDVEYIPVVVV 119

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSI 171
           GNK DL    E  R V   E  + A++ N  F E SAK    V++ F ++
Sbjct: 120 GNKSDL----ETERQVSFEEGASLAKQLNAPFLETSAKQAINVEDAFYTL 165

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 60.8 bits (146), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 85/211 (40%), Gaps = 44/211 (20%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDV---- 56
           M   K V++GD +VGK+S++  +  +SF      T+   + S TI I        +    
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNY-STTIAIPNGTASSPLELDN 59

Query: 57  --------------------VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDS 96
                               + K  +WDTAGQE Y  L P+ Y   +  L+ + +++  S
Sbjct: 60  GNDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHAS 119

Query: 97  LVK-ARSWVEELKNKVGDE---------DLVIFLVGNKLDLCEGEEDLRAVDTSEAKAYA 146
                  W+ ELK     E            I LVG K DL +     + +  + +   +
Sbjct: 120 FANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVS 179

Query: 147 EEQ---------NLLFTEVSAKTGQGVKEVF 168
           +E+          + +TE SA T  GV+EVF
Sbjct: 180 QEEIDELVQRCGFMGYTECSAATQAGVREVF 210

>Scas_575.10
          Length = 271

 Score = 60.5 bits (145), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 87/170 (51%), Gaps = 14/170 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI+I      ++ V   
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTIEI------DNKVFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IF 119
           EI DTAG  ++ ++  +Y ++    L+VY +T   SL +     E++  ++ D D V + 
Sbjct: 54  EILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL-RIKDTDRVPMV 112

Query: 120 LVGNKLDLCEGEEDLRAVDTSEA-KAYAEEQNLLFTEVSAKTGQGVKEVF 168
           LVGNK DL E     R +   E  +  ++   + F E SA     V EVF
Sbjct: 113 LVGNKADLTED----RVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVF 158

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 60.5 bits (145), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 89/170 (52%), Gaps = 14/170 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I      ++ V   
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY-RKTMEI------DNKVFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IF 119
           EI DTAG  ++ ++  +Y ++    L+VY ++ + SL +     E++  ++ D D V I 
Sbjct: 54  EILDTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVL-RIKDSDRVPIV 112

Query: 120 LVGNKLDLCEGEEDLRAVDTSEA-KAYAEEQNLLFTEVSAKTGQGVKEVF 168
           LVGNK DL    +D R +   E  +  ++   + F E SA     V EVF
Sbjct: 113 LVGNKADL----QDERVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVF 158

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%), Gaps = 12/169 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++       +   + +D     
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSY-------RKSMEIDDKAFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120
           EI DTAG  ++ ++  +Y ++    L+VY +T + SL +     E++      + + + L
Sbjct: 54  EILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVL 113

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVF 168
           VGNK DL    ++ RA+   E    +     + F E SA     V EVF
Sbjct: 114 VGNKADL----QNERAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVF 158

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 97/191 (50%), Gaps = 14/191 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI+I      ++ V   
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEI------DNKVFDL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IF 119
           EI DTAG  ++ ++  +Y ++    L+VY +T + SL +     E++  ++ D D V + 
Sbjct: 54  EILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL-RIKDSDRVPMV 112

Query: 120 LVGNKLDLCEGEEDLRAVDTSEA-KAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYAS 178
           L+GNK DL     + R +   E  +  ++   + F E SA     V EVF  +  ++  +
Sbjct: 113 LIGNKADLI----NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRN 168

Query: 179 KKDEILAKKNR 189
           + + +  K  R
Sbjct: 169 EMESVAVKDAR 179

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 78/166 (46%), Gaps = 17/166 (10%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            K+++LG  + GK++I+++      ++++ S     F  +T+  K         +KF +W
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYKN--------VKFNMW 49

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIFL 120
           D  GQER + L   Y+    A + V D   KD L +A+   EE  + VG+   E +V+ +
Sbjct: 50  DVGGQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVLLV 106

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKE 166
           + NK DL    +     D  E     + Q       +A TGQG+ E
Sbjct: 107 LANKQDLKGALKPQEISDFLELDQNLKNQLWCVVGSNALTGQGLVE 152

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 84/173 (48%), Gaps = 12/173 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF--EI 62
           K+++LG  +VGK++++ +  +  F E    TI   F+ + +  K    E    +KF  +I
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPNGTE----LKFNLDI 62

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
            DT+GQ+ +  +           +++Y +  + S        +++ + +G  +L + LVG
Sbjct: 63  VDTSGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVG 122

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKL 175
           NK+DL       R V   E +  A+     F E+  K G G++  F+++ +K+
Sbjct: 123 NKIDLD------RQVSYKEGEELAKRLKCGFVEICVKQGSGIEMPFKTLIQKI 169

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 59/131 (45%), Gaps = 19/131 (14%)

Query: 57  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVK-ARSWVEELKNKVGDE- 114
           + K  +WDTAGQE Y  L P+ YR  +  L+ + +++  S       W  ELK   G E 
Sbjct: 116 IFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIES 175

Query: 115 -DL-------VIFLVGNKLDLCEGE--------EDLRAVDTSEAKAYAEEQNLL-FTEVS 157
            DL        I LVG K DL + E        ++L  V   E     E+   + + E S
Sbjct: 176 GDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVECS 235

Query: 158 AKTGQGVKEVF 168
           A T   V++VF
Sbjct: 236 AATQNNVRQVF 246

>Kwal_23.3135
          Length = 191

 Score = 56.6 bits (135), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 90/199 (45%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +       +I 
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI- 112

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
            VG ++DL + +        + LR +   + +  A E + + + E SA T +G+K VF  
Sbjct: 113 -VGTQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 90/199 (45%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +       +I 
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI- 112

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
            VG ++DL + +        + LR +   + +  A E + + + E SA T +G+K VF  
Sbjct: 113 -VGTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 90/199 (45%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +      +   
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHC--PGVPCL 111

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
           +VG ++DL + +        + LR + + +    A E + + + E SA T +G+K VF  
Sbjct: 112 VVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 62  IWDTAGQERYK-SLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGDEDLV-- 117
           +WDTAGQERY+ ++ P  Y+  NA ++ YD+T   S       W+ +       +DL+  
Sbjct: 164 LWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKA 223

Query: 118 -IFLVGNKLDL 127
             FLVGNK+DL
Sbjct: 224 RFFLVGNKIDL 234

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 90/199 (45%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +      +   
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHC--PGVPCL 111

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
           +VG ++DL + +        + LR +   + +  A E + + + E SA T +G+K VF  
Sbjct: 112 VVGTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>Scas_721.96
          Length = 191

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           M   K V +GD +VGK+ ++  +  + F      T+   + + T+ I  E          
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPY------TL 53

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKAR-SWVEELKNKVGDEDLVIF 119
            ++DTAGQE Y  L P+ Y + +  LV + +    S    +  W  E+ +       +I 
Sbjct: 54  GLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI- 112

Query: 120 LVGNKLDLCEGE--------EDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRS 170
            VG ++DL            + LR +   + +  A E + + + E SA T +G+K VF  
Sbjct: 113 -VGTQIDLRSDPIIIEKLQRQRLRPISPEQGERLARELKAVKYVECSALTQRGLKNVF-- 169

Query: 171 IGEKLYASKKDEILAKKNR 189
             E + A+ +  ++ K  +
Sbjct: 170 -DEAIVAALEPPVIKKSKK 187

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 79/167 (47%), Gaps = 17/167 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+++LG  + GK++I+++      ++++ S     F  +T+  +         +KF +
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN--------VKFNM 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQER + L   Y+    A + V D   +  L +A+   EEL + +G+   E++V+ 
Sbjct: 66  WDVGGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVVLL 122

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKE 166
           ++ NK DL    +     D  +       Q       +A TGQG+ E
Sbjct: 123 VLANKQDLRGALKPQEVSDYLQLGDNLNNQLWCVVGSNALTGQGLVE 169

>Kwal_34.16142
          Length = 192

 Score = 53.9 bits (128), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q +  +            EI D
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIVLGRT-------TYTLEICD 65

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNK 124
           TAGQ+ +  +            +VY    + S        +++ ++VG E +   ++GNK
Sbjct: 66  TAGQDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNK 125

Query: 125 LDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVF 168
           +DL +   +   V   E +  A      F E SAK   GV+E  
Sbjct: 126 IDLRDSGINGGKVRRQEGEELAARLGAGFVECSAKLNIGVEEAM 169

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (50%), Gaps = 23/170 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+++LG  + GK++I+++      ++++ S     F  +T+  K         +KF +
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN--------VKFNM 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQ R + L   Y+   +A + V D   K+ L +A+   EEL + +G+   E +V+ 
Sbjct: 66  WDVGGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVVLL 122

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEV--SAKTGQGVKE 166
           ++ NK DL      L   + S+     E  +N L++ +  +A TGQG+ E
Sbjct: 123 VLANKQDLPGA---LSPNEVSDFLQLGENLKNQLWSVIGSNALTGQGLIE 169

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    + V  +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A TG+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQATCATTGEGLYE 168

>Scas_697.54*
          Length = 181

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 17/167 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + K+++LG  + GK++I+++      ++++ ST    F  +T+  K         +KF +
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYKN--------VKFNM 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQER + L   Y+    A + V D + ++ L +A+   EEL + + +   E +V+ 
Sbjct: 66  WDVGGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVVLL 122

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKE 166
           +  NK DL    +        E     + Q       +A TGQG+ E
Sbjct: 123 VWANKQDLKGAMKPQDVSSFLELDKNLKNQLWCVIGSNALTGQGLVE 169

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 13/130 (10%)

Query: 33  ESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDL 91
           +STIG    +  + I  +      + K  +WDTAGQERY+ ++ P  Y+     ++ YD+
Sbjct: 165 KSTIGVDIKTSFVDIDRQ------LFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDI 218

Query: 92  TQKDSLVKA-RSWVEELKNKVGDEDLVIFLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQN 150
             +++       W+ E       E    +LVGNK+DL +     R V  ++  A+A+E  
Sbjct: 219 CSRETFPDCLEHWLPEALEHCQVEHTRFYLVGNKVDLYK----QRQVTHADVLAFADEAK 274

Query: 151 LLFT-EVSAK 159
             +  E+S K
Sbjct: 275 RRYGFEISGK 284

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 15/175 (8%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F ++ I  K+ +         E
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIPYKSHD------CTLE 67

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           I DTAGQ+    L           ++ Y +  + S        ++L +++G ++L + LV
Sbjct: 68  ILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILV 127

Query: 122 GNKLDLCEGEEDL-RAVDTSEAKAYA-------EEQNLLFTEVSAKTGQGVKEVF 168
           G K DL    + + R V  +E +  A       +     F E SA+    V+E F
Sbjct: 128 GTKADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETF 182

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    + V  +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYE 168

>Scas_624.4*
          Length = 181

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    + V  +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYE 168

>Scas_701.42*
          Length = 181

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    + V  +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYE 168

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 75/166 (45%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    + V  +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYE 168

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 11/105 (10%)

Query: 33  ESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDL 91
           ++TIG    +  I I      ++ +    +WDTAGQERY+ ++ P  Y+ +NA ++ YD+
Sbjct: 237 KTTIGVDIKTNIINI------DNRIFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDI 290

Query: 92  TQKDSLVKA-RSWVEELKNKVGDEDL---VIFLVGNKLDLCEGEE 132
           T K S   +   W+ E        D      + +GNK DL +  E
Sbjct: 291 TDKCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQRE 335

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 20/172 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD---SFDELRESTIGAAFLSQTIKIKAEEQEEDVVIK 59
           QF +++LG  + GK++ +    K+       L + T        TI +      +D V+K
Sbjct: 17  QFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKITPTVGQNVATIPV------QDCVLK 70

Query: 60  FEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDED---L 116
           F  WD  GQE  +SL   YY  A+  + V D T +D L + +   E L++ V DED   +
Sbjct: 71  F--WDVGGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK---ETLRSIVMDEDVEGV 125

Query: 117 VIFLVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKE 166
            + ++ NK D  +  E  D++ +    A+      + +   +SA TG+GV +
Sbjct: 126 PVLMLANKQDREDRMEVQDIKEIFNKIAEHLGARDSRVLP-ISALTGEGVTD 176

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ+R +SL   YYRN    + V D   +  + +AR  ++ + N+    +    +  
Sbjct: 66  WDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKAYAEEQN--LLFTEVSAKTGQGVKE 166
           NK DL E    + A + +E       +N         A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYE 168

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 21/125 (16%)

Query: 18  SIVHRFVKDSFDELRES------------TIGAAFLSQTIKIKAEEQEEDVVIKFEIWDT 65
           S  H+ +K+  D  ++S            TIG    +  I I      ++   K  +WDT
Sbjct: 180 STSHQMIKEEPDNQKDSQDPDEIVIDTKTTIGIDIKTSLINI------DNRFFKVIMWDT 233

Query: 66  AGQERYK-SLAPMYYRNANAALVVYDLTQKDSLVKA-RSWVEELKNKVGD-EDLVIFLVG 122
           AGQERY+ ++ P  Y+ +N  ++ YD+  + S       W+ E      D      +LVG
Sbjct: 234 AGQERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLGKTRFYLVG 293

Query: 123 NKLDL 127
           NK+DL
Sbjct: 294 NKIDL 298

>Kwal_56.24453
          Length = 181

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 79/166 (47%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ++ + L   Y+RN    + V D   +  + +AR  ++ + N+    + V+ +  
Sbjct: 66  WDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKA-YAEEQNLLFTEVS-AKTGQGVKE 166
           NK DL E    + A + +E    ++  Q   F + + A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRQRPWFIQAACATSGEGLYE 168

>Kwal_56.24462
          Length = 181

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 81/168 (48%), Gaps = 20/168 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKN--KVGDEDLVIFL 120
           WD  GQ++ + L   YYRN    + V D   +  + +AR  ++ + N  ++ +  L++F 
Sbjct: 66  WDVGGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNASLLVF- 124

Query: 121 VGNKLDLCEGEEDLRAVDTSEAKA-YAEEQNLLFTEVS-AKTGQGVKE 166
             NK DL E    + A + +E    ++  Q   F + + A +G+G+ E
Sbjct: 125 -ANKQDLPEA---MSAAEITEKLGLHSIRQRPWFIQATCATSGEGLYE 168

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 74/165 (44%), Gaps = 16/165 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
            +++++G    GK++I+++       E+  +     F  +T++ K         I F +W
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETVEYKN--------ISFTVW 49

Query: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGN 123
           D  GQ++ + L   Y+RN    + V D   +  + +AR  ++ + N+    + V+ +  N
Sbjct: 50  DVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFAN 109

Query: 124 KLDLCEGEEDLRAVDTSEAKAYA--EEQNLLFTEVSAKTGQGVKE 166
           K DL E    + A + +E        +   +     A +G+G+ E
Sbjct: 110 KQDLPEA---MSAAEITEKLGLHSIRQHPWIIQATCAASGEGLYE 151

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 79/166 (47%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ++ + L   Y+RN    + V D   +  + +AR  ++ + N+    + V+ +  
Sbjct: 66  WDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKA-YAEEQNLLFTEVS-AKTGQGVKE 166
           NK DL E    + A + +E    ++  Q   + + + A +G+G+ E
Sbjct: 126 NKQDLPEA---MSAAEITEKLGLHSIRQRPWYIQATCATSGEGLYE 168

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 9/97 (9%)

Query: 34  STIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDLT 92
           STIG    +  + I      ++   +  +WDTAGQERY+ ++    Y+ +N  ++ YD+ 
Sbjct: 159 STIGIDIKTNLVNI------DNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDIC 212

Query: 93  QKDSLVKARSW--VEELKNKVGDEDLVIFLVGNKLDL 127
             +S +   ++  VE ++N         +LVGNKLDL
Sbjct: 213 DFNSFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDL 249

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 79/166 (47%), Gaps = 16/166 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + +++++G    GK++++++       E+  +     F  +T++ K         I F +
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN--------ISFTV 65

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ++ + L   Y+RN    + V D   +  + +AR  ++ + N+    + V+ +  
Sbjct: 66  WDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFA 125

Query: 123 NKLDLCEGEEDLRAVDTSEAKA-YAEEQNLLFTEVS-AKTGQGVKE 166
           NK DL E    + A + +E    ++  Q   + + + A +G+G+ E
Sbjct: 126 NKQDLPEA---MPAAEITEKLGLHSIRQRPWYIQATCATSGEGLYE 168

>Scas_628.21
          Length = 208

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 81/181 (44%), Gaps = 14/181 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFE 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F ++ I  K +          E
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF-TKLIDFKNQH------FTLE 65

Query: 62  IWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV 121
           I DTAGQ+    L           ++ Y +    +        ++L +++  +D+ + +V
Sbjct: 66  IVDTAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIV 125

Query: 122 GNKLDLCEGEEDLRAVDTSEAKAYA-----EEQNLL--FTEVSAKTGQGVKEVFRSIGEK 174
           GNK+DL    ++   V   E K  A      ++N+   F E SAK    V   F+ + ++
Sbjct: 126 GNKIDLRNDLDNRTVVTKQEGKKLANLIRSSDKNIKAGFIECSAKDDTNVGTTFQKLLKQ 185

Query: 175 L 175
           +
Sbjct: 186 M 186

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 74  LAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV-IFLVGNKLDLCEGEE 132
           +   Y R     L+VY +T K S  +  ++ +++  +V D D V +F++GNK DL    E
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDL----E 55

Query: 133 DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVF 168
           D R V   E +  A++ +  F E SAK    V+E F
Sbjct: 56  DERQVSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>Scas_503.2
          Length = 527

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 17/114 (14%)

Query: 25  KDSFDELRE------STIGAAFLSQTIKIKAEEQEEDVVIKFEIWDTAGQERYKS-LAPM 77
           K SFD+  E       TIG    S  + I+ ++           WD AGQ+R+K+ +   
Sbjct: 236 KASFDDREEMIIDTRPTIGIDIKSTLVNIQGKK------YNCIFWDPAGQDRFKNVMMDS 289

Query: 78  YYRNANAALVVYDLTQKDSLVK-ARSWVEELKNKVGDEDLV---IFLVGNKLDL 127
            Y+ +NA ++ YD+    S     R W+ E    V   DL     +LVGNKLDL
Sbjct: 290 LYKISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEIKFYLVGNKLDL 343

>Scas_567.9
          Length = 199

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 89/193 (46%), Gaps = 32/193 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDELRESTIGAAFLSQTIKIKAEEQEEDV 56
           Q+ +++LG  + GK++ +    K+        D++   T+G      TI ++  ++    
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNV--ATISVENNKK---- 69

Query: 57  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD--- 113
           ++KF  WD  GQE  +S+   YY   +  + V D T        RS ++E    +G    
Sbjct: 70  LLKF--WDVGGQENLRSMWSEYYSQCHGIIFVVDSTD-------RSRIDECSKTLGKIVM 120

Query: 114 ----EDLVIFLVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEV 167
               E + I ++ NK D+ E  E  D++ +    A+  +   + +   VSA TG+GVK+ 
Sbjct: 121 DDEVEGVPILMLANKQDMPERMEVQDIKEIFNQIAEHLSARDSRVLP-VSALTGEGVKDA 179

Query: 168 FRSIGEKLYASKK 180
              +  +L  +KK
Sbjct: 180 IDWMTLRLERNKK 192

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 93/188 (49%), Gaps = 23/188 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD---SFDELR--ESTIGAAFLSQTIKIKAEEQEEDVV 57
           Q+ +++LG  + GK++ +    K+   +F  L   + T+G      TI + +++     +
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNV--ATIPVDSKQ-----I 69

Query: 58  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDL- 116
           +KF  WD  GQE  +S+   YY   +  + + D + ++ L +  +    L++ V DE++ 
Sbjct: 70  LKF--WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEEIE 124

Query: 117 --VIFLVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIG 172
              I ++ NK D  +  E  D++ V    A+  +   + +   +SA TG+GVK+    + 
Sbjct: 125 GVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLP-ISALTGEGVKDAIEWMI 183

Query: 173 EKLYASKK 180
            +L  +KK
Sbjct: 184 VRLERNKK 191

>Kwal_27.11872
          Length = 197

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 83/182 (45%), Gaps = 14/182 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           Q+ +++LG  + GK++ +    ++     +        + Q +   A     + ++KF  
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNV---ATVPVGNCLLKF-- 71

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDED---LVIF 119
           WD  GQE  ++L P YY+ A+  + V D   ++ L +     + L+  V DED   + + 
Sbjct: 72  WDVGGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIPVL 128

Query: 120 LVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYA 177
           ++ NK D  +  E  D++ V    A+      + +   +SA   +GVKE    I  +L  
Sbjct: 129 MLANKQDREDRMEVQDIKEVFNKIAEHLGARDSRVLP-ISALNKEGVKEAAEWILVRLRR 187

Query: 178 SK 179
           +K
Sbjct: 188 NK 189

>Kwal_47.18241
          Length = 230

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 10/125 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           Q  +V++G  + GK+S+    +   F++    T+G      T+ +              I
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI----------VRI 53

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           +D AGQ R++ L   Y+  A+  + V DL  + +  + +  V ++      + + + ++G
Sbjct: 54  FDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILG 113

Query: 123 NKLDL 127
           NK+DL
Sbjct: 114 NKIDL 118

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 24/170 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  +         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QVGEVVTTKPTIGFNVETLTYRN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSL-VKARSWVEELKNKVGDEDL---VI 118
           WD  GQ   +     YY N  A + V D T KD + V AR    EL   + +E+L    +
Sbjct: 67  WDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVAAR----ELHTMLQEEELQDAAL 122

Query: 119 FLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKT--GQGVKE 166
            +  NK D    +    A++ S     AE ++  ++ V+A    G+G+ E
Sbjct: 123 LVFANKQDQPGAQS---ALEVSRELRLAELKDRSWSIVAASALRGEGITE 169

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 75/169 (44%), Gaps = 22/169 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDL---VIF 119
           WD  GQ   +     YY N  A + V D T KD +  A    +EL   + +E+L    + 
Sbjct: 67  WDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTAS---KELHMMLQEEELQDAALL 123

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEV--SAKTGQGVKE 166
           +  NK D       L A + S+  +  E ++  ++ V  SA  G+G+ E
Sbjct: 124 VFANKQDQPGA---LSASEVSKELSLVELKDRSWSIVASSAIKGEGINE 169

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 79/172 (45%), Gaps = 21/172 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVK--DSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           + + ++LG  + GKS+IV++ +   +  ++    T+G    S  IK        DV I  
Sbjct: 16  EIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIK--------DVTI-- 65

Query: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQK----DSLVKARSWVEELKNKVGDEDL 116
            +WD  GQ   +     Y+    A +   D++      ++L + +  +   +N++G E  
Sbjct: 66  SLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECA 125

Query: 117 VIFLVGNKLDLCEGEEDLR----AVDTSEAKAYAEEQNLLFTEVSAKTGQGV 164
           VI +V NK+DL E + +L      V++     +  +  +   + S  TG+G+
Sbjct: 126 VI-VVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGI 176

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 97/218 (44%), Gaps = 34/218 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKI--------KAEEQEED 55
           F++++LGD  VGK+S++ +++ D++    E+T       + I          K    E+D
Sbjct: 21  FRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEKD 80

Query: 56  VV-----------------IKFEIWDTAGQ---ERYKS-LAPMYYRNANAALVVYDLTQK 94
           V+                 IK EI D       E Y + L  +  + ++A ++ +D   +
Sbjct: 81  VIDFNLDNSHRFQYTNKDLIKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGKSQ 140

Query: 95  DSLVKARSWVEELKNKVGDEDLVIFLVGNKLD-LCEGEEDLRAVDTSEAKAYAEEQNLLF 153
            +    R +   +K+ +G+E + + +   K+D L E + +   +    A+   + +N  F
Sbjct: 141 TTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLMEDKVEFNELINFLAELDLDYENDYF 200

Query: 154 TEVSAKTGQGVKEVFRSIGEKLYASKKDEILAKKNREL 191
            E S+K    VKE+  S+   LY  + ++ + KK   L
Sbjct: 201 -ETSSKHNINVKELLFSL---LYRIETNKEMKKKEEAL 234

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 81/184 (44%), Gaps = 12/184 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           Q+ +++LG  + GK++ +    K+     +     A  + Q +     +    + +KF  
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKIAPTVGQNVATIPVDNNRSI-LKF-- 73

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD---EDLVIF 119
           WD  GQ   +++   YY   +  + V D T +  + +     E L+  V D   E + I 
Sbjct: 74  WDVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGIPIL 130

Query: 120 LVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYA 177
           ++ NK D  E  E  D++ +    A+  +   + +   V A TG+G+K+    +  +L  
Sbjct: 131 MLANKQDKPERMEVQDIKEIFNRIAEHMSARDSRVLP-VCALTGEGIKDSIEWMILRLQR 189

Query: 178 SKKD 181
           +K D
Sbjct: 190 NKND 193

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 22/169 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVITTKPTIGFNVETLNYKN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDL---VIF 119
           WD  GQ   +     YY N  A + V D T KD +  A    +EL   + +E+L    + 
Sbjct: 67  WDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMNIAS---KELHLMLQEEELQDSALL 123

Query: 120 LVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEV--SAKTGQGVKE 166
           +  NK D       L A + S+    AE ++  ++ V  SA  G+G+ E
Sbjct: 124 VFANKQDQPGA---LSASEVSKELNLAELKDRSWSIVASSAIKGEGITE 169

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 11/124 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLSYKN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ   +     YY +  A + V D T KD +  A   +  +  +   +D  + +  
Sbjct: 67  WDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFA 126

Query: 123 NKLD 126
           NK D
Sbjct: 127 NKQD 130

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+ LG  + GK++++H    D            A L  T    +EE      IKF  +D
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKNDRL----------ATLQPTWHPTSEELAIGN-IKFTTFD 72

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNK 124
             G  + + L   Y+   N  + + D    D   +AR  ++ L N    +D+   ++GNK
Sbjct: 73  LGGHVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNK 132

Query: 125 LDLCEG--EEDLRA 136
           +D      E +LR+
Sbjct: 133 IDAANAVSEAELRS 146

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 20/182 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + + ++LG  + GKS+IV+  + +S ++    T    F  Q   I  E  ++    K  +
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGF--QIHSIVVESAQDGKTYKVNL 72

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQK----DSLVKARSWVEELKNKVGDEDLVI 118
           WD  GQ   +     Y+   +  L   D+       +S  + R  V + ++++G +  ++
Sbjct: 73  WDIGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVMQDRDRIGYQCKLV 132

Query: 119 FLVGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYAS 178
             + NK+DL E + DL      E  A+  EQ +   E     GQ V E   SIG  +  S
Sbjct: 133 VAI-NKIDLVE-QADL------EHYAHDIEQKI---EHILHHGQSVGE--SSIGHYVLCS 179

Query: 179 KK 180
            K
Sbjct: 180 GK 181

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 11/124 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ   +     YY +  A + V D T KD +  A   +  +  +   +D  + +  
Sbjct: 67  WDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFA 126

Query: 123 NKLD 126
           NK D
Sbjct: 127 NKQD 130

>Scas_700.11
          Length = 183

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 11/124 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K         +K  +
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN--------LKLNV 66

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
           WD  GQ   +     YY +  A + V D T KD +  A   +  +  +   +D  + +  
Sbjct: 67  WDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASKELHLMLQEEELQDAALLVFA 126

Query: 123 NKLD 126
           NK D
Sbjct: 127 NKQD 130

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 68/126 (53%), Gaps = 14/126 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           +++LLG  + GK++++++ + +  D++ + TIG  F  +T+K+  +          ++WD
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIG--FQIKTLKLSNK--------VLQMWD 66

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL--KNKVGDEDLVIFLVG 122
             GQ+  +     Y+   +  + V D+   + L+++ + +EE+  +N   +    +F++ 
Sbjct: 67  IGGQKTLRPFWFNYFEKTDYLIWVIDILD-NRLMESLTLLEEIVQENDRINLQFEVFILL 125

Query: 123 NKLDLC 128
           NK+DL 
Sbjct: 126 NKIDLL 131

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+ LG  + GK++++H    D            A L  T    +EE      IKF  +D
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRL----------ATLQPTWHPTSEELAIGN-IKFTTFD 73

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNK 124
             G  + + L   Y+   N  + + D    +   +AR  ++ L N    +D+   ++GNK
Sbjct: 74  LGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNK 133

Query: 125 LD 126
           +D
Sbjct: 134 ID 135

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 57  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDL 116
           ++KF  WD  GQE  +++   YY   +  + + D T ++ L +    +  +    G E +
Sbjct: 69  LLKF--WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQECCDSLRSIVTDDGVEGV 126

Query: 117 VIFLVGNKLDLCEGEE--DLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVK 165
            I ++ NK D  +  E  D++ V    A  + E ++     +SA TG+G++
Sbjct: 127 PILMLANKQDREDKMELHDIKQVFNKLA-LHLEARDSRVLPISALTGEGIQ 176

>Kwal_26.6810
          Length = 664

 Score = 34.7 bits (78), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF-----DELRESTIGAAFLSQTIKIKAEEQEEDVV 57
          Q K+V+ GD  VGK+S++   +KD F     D L   TI   F S  +  K     + V+
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPVCPK-----KSVL 59

Query: 58 IKFEIWDTAGQER 70
          +    +D  G +R
Sbjct: 60 VDTTSYDLPGLQR 72

>Scas_706.2*
          Length = 190

 Score = 33.9 bits (76), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 71/175 (40%), Gaps = 17/175 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+ LG  + GK++++H    D            A L  T    +EE      IKF  +D
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRL----------ATLQPTWHPTSEELAIGN-IKFTTFD 73

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNK 124
             G  + + L   Y+   N  + + D    +   +A   ++ L      +D+   ++GNK
Sbjct: 74  LGGHIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNK 133

Query: 125 LDLCEG--EEDLR-AVDTSEAKAYAEEQNLLFTEV---SAKTGQGVKEVFRSIGE 173
           +D      E +LR A+  +    Y   QN    E+   S  T  G  E F+ + +
Sbjct: 134 IDAPTAVSEAELRNALGLNNTTNYGGAQNQRPVELFMCSVVTRNGYLEAFQWLSQ 188

>Kwal_56.24149
          Length = 149

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%)

Query: 58  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLV 117
           IKF  +D  G  + + L   Y+   N  + + D    + L +AR  ++ L N    +D+ 
Sbjct: 26  IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFNIAELKDVP 85

Query: 118 IFLVGNKLD 126
             ++GNK+D
Sbjct: 86  FVILGNKID 94

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 31.6 bits (70), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+ LG  + GK++++H    D    L+ +       S+ + I +        IKF  +D
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPT---SEELAIGS--------IKFTTFD 73

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVGNK 124
             G  + + L   Y+   N  + + D    +   +AR  ++ L      + +   ++GNK
Sbjct: 74  LGGHIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNK 133

Query: 125 LDLCEG--EEDLRA 136
           +D      E +LRA
Sbjct: 134 IDAPSAVSETELRA 147

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 31.2 bits (69), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
           + + ++LG  + GKS++V   ++   ++    T    F   TI+              ++
Sbjct: 42  ELRSLVLGLDNSGKSTVVDWLLERG-EKRSRITPTVGFRIHTIEYAGHN--------VQL 92

Query: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIF 119
           WD  GQ   +     Y+   +  L V D+T +    ++ + +E+L   ++++G    +I 
Sbjct: 93  WDIGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKMIV 152

Query: 120 LVGNKLDLCEGEE 132
           L+ NK+DL + +E
Sbjct: 153 LL-NKMDLIDEDE 164

>ADR402W [2142] [Homologous to ScYAL048C - SH]
          complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
          + ++V+ GD  VGKSS++   VKD F    +  + A  + +         +  +++  + 
Sbjct: 5  RIRIVVCGDKGVGKSSLIACLVKDQFIPNLQDALPAVTIPRDFSASPYSPQNTILVDTKN 64

Query: 63 WDTAGQERYKSLAPMYYRNANAALVVY 89
           D AG ++         +NA+   +VY
Sbjct: 65 SDLAGLQK-------ELKNADVIWLVY 84

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60
           F   +LG  + GKSS++  F+   F E    TI       ++++K  +Q   ++ +F
Sbjct: 446 FNCYILGKPNSGKSSLLESFLGRPFSETYSPTIRPKIAVNSLELKGGKQYYLILQEF 502

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 30.8 bits (68), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 15/135 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+ LG  + GK++++H    D            A L  T    +EE      IKF  +D
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRL----------ATLQPTWHPTSEELAIGN-IKFTTFD 73

Query: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLV-GN 123
             G  + + L   Y+   N  + + D    +   +AR  ++ L  ++ + D V F V GN
Sbjct: 74  LGGHLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALF-QIKELDNVPFAVLGN 132

Query: 124 KLDLCEG--EEDLRA 136
           K+D      E +LRA
Sbjct: 133 KIDSPSAVSETELRA 147

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 14/75 (18%)

Query: 60  FEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGD------ 113
            +++D AGQ R++ L    ++  +  + + DL+         +W E+ KNK+ D      
Sbjct: 71  LKVYDLAGQTRFQKLWDRCFQQVDLLVFMIDLSD------LTNW-EQAKNKLHDVIIATN 123

Query: 114 -EDLVIFLVGNKLDL 127
            E + I ++GNK+DL
Sbjct: 124 LEHVPILILGNKVDL 138

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
          Saccharomyces cerevisiae YAL048c vacuolar aspartic
          proteasse singleton, start by similarity
          Length = 659

 Score = 30.8 bits (68), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62
          + ++V+ GDS VGK+S++   VKD F    +  +    + +         E  VV+    
Sbjct: 5  RIRIVVCGDSGVGKTSLIACLVKDQFISWLQDVLPPITIPKDFSSSRYSPENTVVV---- 60

Query: 63 WDTAGQERYKSLAPMY--YRNANAALVVY 89
           DT   +    LA ++   +NA+   +VY
Sbjct: 61 -DTGNSD----LATLHKELKNADVIWLVY 84

 Score = 27.7 bits (60), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQ 52
           +LG  + GKSS++  F+  SF E    TI       ++++K  +Q
Sbjct: 451 MLGKGNSGKSSLLESFLGRSFSEAYSPTIRPKISVNSLELKGGKQ 495

>KLLA0C06358g complement(563583..564482) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein singleton, start by similarity
          Length = 299

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64
           KL+L+G S  GKSS+    +  ++       +GA     TI ++         +   +WD
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 65  TAGQE-----RYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKN-KVGDEDLVI 118
             GQ+      +       ++     + V+D+  KD L     +   LK  K    D  I
Sbjct: 62  CGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKYSPDAKI 121

Query: 119 FLVGNKLDLCE 129
           F++ +K+DL +
Sbjct: 122 FVLVHKMDLVQ 132

>Scas_698.27
          Length = 701

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 15/102 (14%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDS----FDELR-------ESTIGAA--FLSQTI--KIK 48
              V+LG+ S GKS+I+ R ++DS     DE+R       +S + A   +LS+ +  K+ 
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 49  AEEQEEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYD 90
           +    +  V +F  +D  G  ++ S +    R    A++  D
Sbjct: 331 STFSLDKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTID 372

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63
           F   ++G    GKSS++  F+  SF E    TI       ++++K  +Q       + I 
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQ------YYLIL 502

Query: 64  DTAGQERYKSLAPM-YYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122
              G++ Y  L      +  +   + YD +  +S     S +++  +    +DL +  V 
Sbjct: 503 QELGEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL---QDLPLVFVA 559

Query: 123 NKLDL 127
           +K DL
Sbjct: 560 SKADL 564

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 12/77 (15%)

Query: 61  EIW---DTAGQERYKSLAPMYYRNANAALVVY--DLTQKDSLVKARSWVEELK----NKV 111
            IW   D +GQE ++ L   Y+   N   +VY  D +  D L ++   + EL+    N  
Sbjct: 68  HIWKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDSDRLQES---INELQARYVNTP 124

Query: 112 GDEDLVIFLVGNKLDLC 128
              D+ I +V NK D C
Sbjct: 125 AAVDIPIAVVLNKTDQC 141

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 54/139 (38%), Gaps = 28/139 (20%)

Query: 5   KLVLLGDSSVGKSSIV-----HRFVKDSFDEL----RESTIGAAFLSQTIKIKAEEQEED 55
           ++ ++G  + GK+++      H F  D+   L    R +TIG   L              
Sbjct: 70  QIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLL-------------- 115

Query: 56  VVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDED 115
                +++D AGQ R++ L        +  + V DL+   +   A+  ++ +        
Sbjct: 116 -----QVYDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARR 170

Query: 116 LVIFLVGNKLDLCEGEEDL 134
             + ++GNK DL      L
Sbjct: 171 TPVLIIGNKADLVAPPPIL 189

>Scas_721.90
          Length = 397

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 24/44 (54%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTI 45
          +QF L+LLG++ +GK++ ++       +   ++ +    LS  I
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNI 70

>Scas_695.46
          Length = 318

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHR-FVKDSFDELRESTIGAAFLSQTIKIKAEEQ---EEDVV 57
            QF ++++G S +GKS++++  F     D    + I    +S+T ++K       E+ V 
Sbjct: 33  FQFNIMVVGHSGLGKSTLINTLFASHLIDSATGNDISKLPISKTTEMKISTHQLIEDRVN 92

Query: 58  IKFEIWDTAG 67
           +   I DT G
Sbjct: 93  LNVNIIDTPG 102

>YCR002C (CDC10) [537] chr3 complement(117377..118345) Septin,
           component of 10 nm filaments of mother-bud neck,
           involved in cytokinesis [969 bp, 322 aa]
          Length = 322

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHR-FVKDSFDELRESTIGAAFLSQTIKIKAEEQ---EEDVV 57
            QF ++++G S +GKS++++  F     D      I A  +++T ++K       E+ V 
Sbjct: 31  FQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKISTHTLVEDRVR 90

Query: 58  IKFEIWDTAG 67
           +   + DT G
Sbjct: 91  LNINVIDTPG 100

>CAGL0G06754g complement(645915..646889) highly similar to sp|P25342
           Saccharomyces cerevisiae YCR002c CDC10 cell division
           control protein, hypothetical start
          Length = 324

 Score = 28.1 bits (61), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHR-FVKDSFDELRESTIGAAFLSQTIKIKAEEQ---EEDVV 57
            QF ++++G S +GKS++++  F     D      I    +++T ++K       E+ V 
Sbjct: 32  FQFNIMVVGHSGLGKSTLINTLFSSHLIDPATGEDISKQPITKTTEMKVSSHTLIEDRVR 91

Query: 58  IKFEIWDTAG 67
           +   I DT G
Sbjct: 92  LNINIIDTPG 101

>Kwal_14.803
          Length = 693

 Score = 28.1 bits (61), Expect = 7.1,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 95  DSLVKARSWVEELKNKVGDEDLVIFLVGN---KLDLCEGEEDLRAVDTSEAKAYAEEQNL 151
           D   KA   VE+L+NK    D   + +G+   +LDL   E   + V  +  K  AEE ++
Sbjct: 530 DEFDKANLVVEDLQNK----DARAYQIGDLPEQLDLSSLESSGQNVKKNAVKTAAEEFSV 585

Query: 152 LFTEVSAKT 160
           L +E   KT
Sbjct: 586 LESEEKGKT 594

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKD 26
            KLVLLG  +VGKSS+V+    D
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTND 297

>Scas_625.5
          Length = 1141

 Score = 28.1 bits (61), Expect = 7.6,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDE-LRESTIGAAFLSQTIKIKAEE 51
           LL + S+G+ SI H F K+S  + L +ST   A L+  + +KA++
Sbjct: 815 LLTEISMGRKSINHYFTKNSSKQWLWKSTSSDAVLADPVILKAQQ 859

>KLLA0F12848g 1184231..1185244 highly similar to sp|P25342
           Saccharomyces cerevisiae YCR002c CDC10 cell division
           control protein, start by similarity
          Length = 337

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHR-FVKDSFDELRESTIGAAFLSQTIKIKAEEQ---EEDVV 57
            QF ++++G S +GKS++++  F     D      I    +S+T +IK       E+ V 
Sbjct: 44  FQFNVMVVGHSGLGKSTLINTLFASHLVDSSTGKDITQEPISKTTEIKVSTHSLLEDRVR 103

Query: 58  IKFEIWDTAG 67
           +   + DT G
Sbjct: 104 LNVNVIDTPG 113

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,815,163
Number of extensions: 287908
Number of successful extensions: 1315
Number of sequences better than 10.0: 227
Number of HSP's gapped: 1077
Number of HSP's successfully gapped: 230
Length of query: 216
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 119
Effective length of database: 13,238,163
Effective search space: 1575341397
Effective search space used: 1575341397
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)