Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_675.272902908601e-116
CAGL0G07667g2581446127e-79
YKR013W (PRY2)3291406031e-76
YJL079C (PRY1)2991355843e-74
KLLA0D02442g3681395773e-72
Scas_711.372671445432e-68
Kwal_14.24103731405364e-66
YJL078C (PRY3)8811385611e-65
Sklu_956.13191265247e-65
CAGL0F05137g2271464281e-51
AAL179W3601444372e-51
Kwal_14.24092381354021e-47
KLLA0D02420g2121383956e-47
AAL178W2051373825e-45
KLLA0C01496g4561563052e-31
AFR700W4341612822e-28
Kwal_33.131927991432543e-24
Kwal_55.2194526162634.0
YPR167C (MET16)26162625.2
CAGL0M05225g38141626.2
KLLA0B10692g26485618.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_675.27
         (290 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_675.27                                                           335   e-116
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   240   7e-79
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   236   1e-76
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   229   3e-74
KLLA0D02442g complement(207613..208719) some similarities with s...   226   3e-72
Scas_711.37                                                           213   2e-68
Kwal_14.2410                                                          211   4e-66
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   220   1e-65
Sklu_956.1 YJL079C, Contig c956 998-1957                              206   7e-65
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   169   1e-51
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   172   2e-51
Kwal_14.2409                                                          159   1e-47
KLLA0D02420g complement(206544..207182) some similarities with s...   156   6e-47
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   151   5e-45
KLLA0C01496g complement(113533..114903) some similarities with s...   122   2e-31
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   113   2e-28
Kwal_33.13192                                                         102   3e-24
Kwal_55.21945                                                          29   4.0  
YPR167C (MET16) [5582] chr16 complement(876841..877626) 3'-Phosp...    28   5.2  
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    28   6.2  
KLLA0B10692g complement(939675..940469) highly similar to sp|P18...    28   8.3  

>Scas_675.27
          Length = 290

 Score =  335 bits (860), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 181/290 (62%)

Query: 1   MKFAQKVXXXXXXXXXXXXXXXXXXXXXXXGVTVRAIVYVKXXXXXXXXXXXXXNXXXXX 60
           MKFAQKV                       GVTVRAIVYVK             N     
Sbjct: 1   MKFAQKVILLTAAASIASAAPAPAQVTVTQGVTVRAIVYVKDGQTQTDLTTLGQNAAPTT 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXIQEDVVLSGAASQQQXXXXXXXXXXXXXXXXXXX 120
                                     IQEDVVLSGAASQQQ                   
Sbjct: 61  VAAAAAAVTTTAAPASAKVAVQAAAAIQEDVVLSGAASQQQAATVTLAPAAVSTTSTPVA 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXSDDSNLSEFASSVLNEHNAKRALHQNTPALSWSDDLA 180
                                  SDDSNLSEFASSVLNEHNAKRALHQNTPALSWSDDLA
Sbjct: 121 AAAAATTTTPAAAAATTAAAAASSDDSNLSEFASSVLNEHNAKRALHQNTPALSWSDDLA 180

Query: 181 SYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGH 240
           SYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGH
Sbjct: 181 SYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGH 240

Query: 241 FTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPAGNFIGEFAENVEPLA 290
           FTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPAGNFIGEFAENVEPLA
Sbjct: 241 FTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPAGNFIGEFAENVEPLA 290

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  240 bits (612), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 109/144 (75%), Positives = 125/144 (86%), Gaps = 1/144 (0%)

Query: 146 DSNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGE 205
           DSNLS+FA S+LNEHN KRALHQ+T  L+WSD+LA YAQNYA+ YDCSGNLVHSGGPYGE
Sbjct: 115 DSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGE 174

Query: 206 NLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWG 265
           NLA+GY  VGSVDAWY+EI  Y+Y+NPGFSE+ GHFTQVVWKSST+VGC +K C    WG
Sbjct: 175 NLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGV-WG 233

Query: 266 SYVICSYNPAGNFIGEFAENVEPL 289
            YVICSY+PAGNF+GEFA+NV PL
Sbjct: 234 DYVICSYDPAGNFLGEFAQNVAPL 257

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  236 bits (603), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (87%), Gaps = 1/140 (0%)

Query: 151 EFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALG 210
           +F++S++NEHN KRALH++T +L+WSD LA+YAQNYAD+YDCSGNLVHSGGPYGENLALG
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250

Query: 211 YDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVIC 270
           Y   GSVDAWYNEI+SYDYSNPGFSE+AGHFTQVVWK +++VGCG+K C    WG Y+IC
Sbjct: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGE-WGDYIIC 309

Query: 271 SYNPAGNFIGEFAENVEPLA 290
           SY  AGN IGEFA+NV PLA
Sbjct: 310 SYKAAGNVIGEFADNVMPLA 329

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  229 bits (584), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 106/135 (78%), Positives = 117/135 (86%), Gaps = 1/135 (0%)

Query: 156 VLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVG 215
           VL EHN KRALH++TPALSWSD LASYAQ+YAD YDCSG L HSGGPYGENLALGYD   
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 216 SVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPA 275
           +VDAWYNEIS+YD+SNPGFS N GHFTQVVWKS+TQVGCGIK C    WG YVICSY+PA
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGG-AWGDYVICSYDPA 284

Query: 276 GNFIGEFAENVEPLA 290
           GN+ GE+A+NVEPLA
Sbjct: 285 GNYEGEYADNVEPLA 299

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  226 bits (577), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 101/139 (72%), Positives = 118/139 (84%), Gaps = 1/139 (0%)

Query: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211
           FASS+L+EHNAKRALH++TP LSWSD+LASYAQNYAD YDCSG+L HSGGPYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271
              G+VDAWY+EI  Y +SNP +S + GHFTQVVWKS+T+VGCGIK C    WG Y+ICS
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGV-WGDYIICS 349

Query: 272 YNPAGNFIGEFAENVEPLA 290
           Y+PAGN +G FA NVEPLA
Sbjct: 350 YDPAGNMLGTFASNVEPLA 368

>Scas_711.37
          Length = 267

 Score =  213 bits (543), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 117/144 (81%), Gaps = 2/144 (1%)

Query: 147 SNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYAD-AYDCSGNLVHSGGPYGE 205
           ++LS+F SS+L EHN KRALH+NT  L+WS++LA YAQ YAD  Y+C G L+HSGGPYGE
Sbjct: 123 TDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGE 182

Query: 206 NLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWG 265
           NLA GY  +GSVDAWYNEIS YDYSNPGFSE+ GHFTQ+VWK ++QVGC IK C+   WG
Sbjct: 183 NLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCN-NAWG 241

Query: 266 SYVICSYNPAGNFIGEFAENVEPL 289
           +Y+ICSYN AGNF GE+  NV PL
Sbjct: 242 TYLICSYNSAGNFDGEYEANVLPL 265

>Kwal_14.2410
          Length = 373

 Score =  211 bits (536), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 113/140 (80%), Gaps = 1/140 (0%)

Query: 150 SEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLAL 209
           S+FAS++L  HN KR+LH++T  LSWSD+LASYAQ+YAD YDCSG+L HSGGPYGENLA+
Sbjct: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAV 293

Query: 210 GYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVI 269
           GY   GSVDAWY EI  YD+SNP +S + GHFTQVVWK S+ +GCGIK C   G G YVI
Sbjct: 294 GYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGG-GTGDYVI 352

Query: 270 CSYNPAGNFIGEFAENVEPL 289
           CSY  AGNF+GEFAENV+ L
Sbjct: 353 CSYKTAGNFLGEFAENVKGL 372

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  220 bits (561), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (0%)

Query: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211
           F S VLNEHN  RALH +T  L+WSD LA+YAQNYAD YDCSG L HS GPYGENLALGY
Sbjct: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84

Query: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271
              G+VDAWY EIS Y+YSNPGFSE+ GHFTQVVWKS+ ++GCG K C  T W +Y++CS
Sbjct: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYC-GTTWNNYIVCS 143

Query: 272 YNPAGNFIGEFAENVEPL 289
           YNP GN++GEFAE VEPL
Sbjct: 144 YNPPGNYLGEFAEEVEPL 161

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  206 bits (524), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (86%), Gaps = 1/126 (0%)

Query: 148 NLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENL 207
           +LS+FASS+L+EHN KRALH++T AL+WS+ LA YAQ YAD+YDCSG+L HSGGPYGENL
Sbjct: 168 DLSDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENL 227

Query: 208 ALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSY 267
           ALGY A G+VDAWY EISSYD+SNP +S + GHFTQVVWKS+++VGCGIK C    WGSY
Sbjct: 228 ALGYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCD-NSWGSY 286

Query: 268 VICSYN 273
           VICSYN
Sbjct: 287 VICSYN 292

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  169 bits (428), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 104/146 (71%), Gaps = 4/146 (2%)

Query: 147 SNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGG---PY 203
           SNLSE+   +L++HN KR LH++T +L W+D+LA  AQ+YAD YDCSGNL H+       
Sbjct: 82  SNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAI 141

Query: 204 GENLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATG 263
           GENLA+GYD + ++DAWY+EI  YDYSNP       HFTQ+VWK +  VGC  K C    
Sbjct: 142 GENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDL 201

Query: 264 WGSYVICSYNPAGNFIGEFAENVEPL 289
           + +Y++C Y+PAGN+ GEFA+NV+PL
Sbjct: 202 Y-NYIVCEYDPAGNWAGEFADNVKPL 226

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  172 bits (437), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 104/144 (72%), Gaps = 2/144 (1%)

Query: 148 NLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENL 207
           N + F   +L  HN++R LH++T  L+WS++LA +A+++A+ YDCSG LVHS  PYGENL
Sbjct: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENL 277

Query: 208 ALGYDAV-GSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGS 266
           A+GY     +V AWY+EIS Y YS+P FS + GHF+Q+VWK +  +GC +K C  +  G 
Sbjct: 278 AVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGS-VGD 336

Query: 267 YVICSYNPAGNFIGEFAENVEPLA 290
           Y+ICSY+PAGNF+  F ENV P+A
Sbjct: 337 YLICSYDPAGNFLRRFGENVAPIA 360

>Kwal_14.2409
          Length = 238

 Score =  159 bits (402), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 2/135 (1%)

Query: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211
           F S +L  HN  R LH + PAL WS DL  +AQ YA+ Y+C+G L+HSG PYGENLALG+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271
           +   +  AWY+E+  Y+Y  PGFSE  GHFTQ+VWKSS  +GC   DC    +G Y ICS
Sbjct: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDC-GDYYGQYTICS 220

Query: 272 YNPAGNFIGEFAENV 286
           Y+P GN  G++ +NV
Sbjct: 221 YDPPGNVAGQYQDNV 235

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  156 bits (395), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 98/138 (71%), Gaps = 2/138 (1%)

Query: 151 EFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALG 210
           +F + +L+ HN+ R  HQ   +L W+ +LAS AQN+A++Y C+G L HS  PYGENLALG
Sbjct: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133

Query: 211 YDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVIC 270
           Y+   +V AWYNE+  YD++NP F+ N GHFTQ+VWK+++++GC    C    +G Y +C
Sbjct: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQY-YGQYTVC 192

Query: 271 SYNPAGNFIGEFAENVEP 288
            Y+P GN IG+F+ENV P
Sbjct: 193 EYDPPGNVIGKFSENVLP 210

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  151 bits (382), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 2/137 (1%)

Query: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211
           FAS+VL+ HN  R  H   P L W+  L ++AQ+YA+   C+G+LVHSG P+GENLALGY
Sbjct: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129

Query: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271
               +V AWY+EI+ YD+S PGFS   GHFTQ+VW+S+T VGC    C    +G Y+IC 
Sbjct: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPC-YGLYIICQ 188

Query: 272 YNPAGNFIGEFAENVEP 288
           Y+P GN   ++  NV P
Sbjct: 189 YDPPGNVADQYVANVLP 205

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  122 bits (305), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (61%), Gaps = 24/156 (15%)

Query: 155 SVLNEHNAKRALHQNTPALSWSDDLASYAQNY------ADAYDCSGNLVHSGGPYGENLA 208
           SVLN HN  RA HQ+T  L W+++LA+YA +Y      +D   C+  L HSGGPYGENLA
Sbjct: 300 SVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLA 359

Query: 209 LGY--DAVGSVDAWYNEISSYDYSN-PGFSEN---AGHFTQVVWKSSTQVGCGIKDCSAT 262
            G   D    V  WY+EI+ YDY+N  G S N    GHFTQ+VW +ST VGC +  CS+ 
Sbjct: 360 AGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSS- 418

Query: 263 GWGS-YVICSYNPAGN--FIG------EFAENVEPL 289
             GS Y+IC Y+PAGN   +G       + +NV+PL
Sbjct: 419 --GSVYLICEYSPAGNVKVVGGNDAYVLYKQNVKPL 452

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  113 bits (282), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 87/161 (54%), Gaps = 24/161 (14%)

Query: 153 ASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAY------DCSGNLVHSGGPYGEN 206
           AS ++  HNAKR LH++T  L W++ L+ +A +Y           C+  L HS GPYGEN
Sbjct: 271 ASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGEN 330

Query: 207 LALGYDAVGS-----VDAWYNEISSYDYSNPG----FSENAGHFTQVVWKSSTQVGCGIK 257
           +A G  +        V++WYNEI  YDY++        +  GHFTQ+VW  S +VGC + 
Sbjct: 331 IASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVV 390

Query: 258 DCSATGWGSYVICSYNPAGNFIGE---------FAENVEPL 289
            CS  G G Y++C Y+P GN             + ENV+PL
Sbjct: 391 YCSNNGKGIYILCEYHPVGNIEDSTPGKDRYRLYKENVKPL 431

>Kwal_33.13192
          Length = 799

 Score =  102 bits (254), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 84/143 (58%), Gaps = 18/143 (12%)

Query: 153 ASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYD------CSGNLVHSGGP--YG 204
           AS++L EHN KR+LH NTP L W D L+++A NYA++        CSG L HS      G
Sbjct: 632 ASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQG 691

Query: 205 ENLALGYDAVGS--VDAWYNEISSYDYSN-PGFSEN---AGHFTQVVWKSSTQVGCGIKD 258
           EN+A G  +  +  VD WY+EIS YDY +  G   N    GHFTQ+VW S+ +VGC +  
Sbjct: 692 ENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQ 751

Query: 259 C-SATGWGS---YVICSYNPAGN 277
           C +   +G    Y++C Y  AGN
Sbjct: 752 CDTMAKYGQNSIYLLCEYKDAGN 774

>Kwal_55.21945
          Length = 261

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 25/62 (40%), Gaps = 18/62 (29%)

Query: 202 PYGENLALGYDAVGSVDAWYNEISSYDYSNP---GFSENAGHFTQVVWKSSTQVGCGIKD 258
           PY E L LGY ++G           Y  + P   G  E AG      WK   +  CGI +
Sbjct: 205 PYNELLDLGYKSIG----------DYHSTQPVREGEDERAGR-----WKGKEKTECGIHE 249

Query: 259 CS 260
            S
Sbjct: 250 TS 251

>YPR167C (MET16) [5582] chr16 complement(876841..877626)
           3'-Phosphoadenylylsulfate reductase (PAPS), part of the
           sulfate assimilation pathway [786 bp, 261 aa]
          Length = 261

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 25/62 (40%), Gaps = 18/62 (29%)

Query: 202 PYGENLALGYDAVGSVDAWYNEISSYDYSNP---GFSENAGHFTQVVWKSSTQVGCGIKD 258
           PY E L LGY ++G           Y  + P   G  E AG      WK   +  CGI +
Sbjct: 205 PYNELLDLGYRSIG----------DYHSTQPVKEGEDERAGR-----WKGKAKTECGIHE 249

Query: 259 CS 260
            S
Sbjct: 250 AS 251

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 178 DLASYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVGSVD 218
           D A   + Y ++YDC  +++ + G YG    L    +GSV+
Sbjct: 210 DKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

>KLLA0B10692g complement(939675..940469) highly similar to sp|P18408
           Saccharomyces cerevisiae YPR167c MET16 3
           -phosphoadenylylsulfate reductase singleton, start by
           similarity
          Length = 264

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 34/85 (40%), Gaps = 23/85 (27%)

Query: 179 LASYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVGSVDAWYNEISSYDYSNP---GFS 235
           LA++  N   +Y    N+     PY E L LGY ++G           Y  + P   G  
Sbjct: 190 LANWDFNQVQSYIRDNNV-----PYNELLDLGYRSIG----------DYHSTQPVQEGED 234

Query: 236 ENAGHFTQVVWKSSTQVGCGIKDCS 260
           E +G      WK   +  CGI + S
Sbjct: 235 ERSGR-----WKGKAKTECGIHETS 254

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.128    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,065,275
Number of extensions: 225729
Number of successful extensions: 465
Number of sequences better than 10.0: 23
Number of HSP's gapped: 435
Number of HSP's successfully gapped: 24
Length of query: 290
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 189
Effective length of database: 13,099,691
Effective search space: 2475841599
Effective search space used: 2475841599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)