Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_675.2631931916320.0
YKR011C3533503712e-41
CAGL0B03201g3183183002e-31
Kwal_14.24142933252754e-28
AAL180C2973082432e-23
KLLA0C09372g2943241861e-15
KLLA0B02695g29939690.95
KLLA0B05159g39783671.8
KLLA0A03003g20258642.9
Scas_591.1077238654.0
YOR276W (CAF20)16147608.7
YJR031C (GEA1)140843628.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_675.26
         (319 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_675.26                                                           633   0.0  
YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...   147   2e-41
CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...   120   2e-31
Kwal_14.2414                                                          110   4e-28
AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...    98   2e-23
KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...    76   1e-15
KLLA0B02695g 237221..238120 similar to sp|P34234 Saccharomyces c...    31   0.95 
KLLA0B05159g 466882..468075 similar to sp|P53397 Saccharomyces c...    30   1.8  
KLLA0A03003g 264785..265393 weakly similar to sp|P43592 Saccharo...    29   2.9  
Scas_591.10                                                            30   4.0  
YOR276W (CAF20) [5062] chr15 (841330..841815) mRNA cap-binding p...    28   8.7  
YJR031C (GEA1) [2927] chr10 complement(486500..490726) Component...    28   8.7  

>Scas_675.26
          Length = 319

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/319 (95%), Positives = 305/319 (95%)

Query: 1   MTTSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENXXXX 60
           MTTSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITEN    
Sbjct: 1   MTTSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENLKLT 60

Query: 61  XXXXXXXXXXFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNGATKS 120
                     FIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNGATKS
Sbjct: 61  STSSLATSPTFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNGATKS 120

Query: 121 WEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNESSCK 180
           WEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNESSCK
Sbjct: 121 WEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNESSCK 180

Query: 181 SFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADLPIEE 240
           SFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADLPIEE
Sbjct: 181 SFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADLPIEE 240

Query: 241 EGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLKTKAGIPRKL 300
           EGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLKTKAGIPRKL
Sbjct: 241 EGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLKTKAGIPRKL 300

Query: 301 RRNSSKITKDTRTKHINRA 319
           RRNSSKITKDTRTKHINRA
Sbjct: 301 RRNSSKITKDTRTKHINRA 319

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score =  147 bits (371), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 170/350 (48%), Gaps = 42/350 (12%)

Query: 1   MTTSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENXXXX 60
           M+  ET+YLY G+ QP+VKLT +++    + +IK+ HSIQ+ Y IE Q  ETITEN    
Sbjct: 1   MSKLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKID 60

Query: 61  XXXXXXXXXX----FIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNG 116
                         +I+EY EI D+F++WKS+G+W++  +   +Y        K      
Sbjct: 61  CAPAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVK------ 114

Query: 117 ATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDS----- 171
              SW+  F+ND R K++ K+  L+  L  +N D S +++ +FW+Q D ICQ  +     
Sbjct: 115 -NTSWKEVFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKK 173

Query: 172 ----HMGNESSCKSFIVMALFRTRISRNKKLLQKLISEY----------GERCRNNSTEA 217
               +M    + K+ + +A+ +T++  NK+LL   +  Y           E+    ++ A
Sbjct: 174 QEQFNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLA 233

Query: 218 ITSDNSAELAIED-----SPLADLPIEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQ--- 269
             S+N    ++E      SP+  L          + +  Y Y  P ++ + + +      
Sbjct: 234 SCSNNEPSASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNFMHSSATN 293

Query: 270 --VFSNFNRHFKVTAEDYELFDLKT-KAGIPRKLRR-NSSKITKDTRTKH 315
             + SNF  +FK+ AEDYE FDL+      PRK +     KITK+    H
Sbjct: 294 DLIKSNFESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSH 343

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score =  120 bits (300), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 158/318 (49%), Gaps = 30/318 (9%)

Query: 3   TSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENXXXXXX 62
           + ET+Y+  G+N   V+L++V    D  +L+ YF  IQD+ +++F+  ETI +N      
Sbjct: 2   SGETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVF 60

Query: 63  XXXXXXXX----FIIEYNEIYDSFYVWKSEGKWEMTDIVTQIY----NTQSQPKAKTKTP 114
                       +I+E+N+  + F VW+S+G+W   + V Q +    +   +   KTK+ 
Sbjct: 61  LGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120

Query: 115 NGATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMG 174
           +     W  +F    R++ H  K  L+ +L  LNVDWS  + + FW ++DN C++D+   
Sbjct: 121 D-----WR-EFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQA 174

Query: 175 NESSCKS------FIVMALFRTRISRNKKLLQKLISEYGER-CRNNSTEAITSDNSAELA 227
           ++ +  S       +++AL +  +S+NK +++  I  +  R  R +       D+  E  
Sbjct: 175 SKHATASTEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKDSIMESI 234

Query: 228 IEDSPLADLPIEEEGLKTSSSNQHYSYHQPSTRDSKDI---VAKQVFSNFNRHFKVTAED 284
            EDS       +EE ++  S + +Y+    S R  +DI    +KQ+ SNFN  FK   E+
Sbjct: 235 SEDSCE-----DEEMIRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVEN 289

Query: 285 YELFDLKTKAGIPRKLRR 302
           +E   L   +  P + RR
Sbjct: 290 FEDVYLDKYSKYPERKRR 307

>Kwal_14.2414
          Length = 293

 Score =  110 bits (275), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 147/325 (45%), Gaps = 61/325 (18%)

Query: 1   MTTSET-----IYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITE 55
           MT+S+T     IY+  GD+Q  VKLT V  F + S + ++ HS+QDT+ +E   C TIT+
Sbjct: 1   MTSSDTHAAQEIYVPIGDDQ-SVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITD 59

Query: 56  NXXXXXXXXXXXXX--XFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKT 113
           N                +I+E++++   + +WKS G W +  ++T +Y T++  + +   
Sbjct: 60  NLKIQCVSHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGAR-RVHP 118

Query: 114 PNGATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVD------------------ 155
              A  + +V  K+D           L   L  LNVDW  +D                  
Sbjct: 119 TLKALVAEQVSSKHD--------APFLMETLQKLNVDWDNIDTRFDFTLFLKLLEEALEL 170

Query: 156 ---INEFWNQLDNICQIDSHMGNESSCKSFIVMALFRTRISRNKKLLQKLISEYGERCRN 212
                ++ + LD + ++          KS + MA+ RT+++ +K+LL+K + +Y  R R 
Sbjct: 171 EIGTRDYSSYLDIVTRLQY--------KSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRA 222

Query: 213 NSTEAITSDNSAELAIEDSPLADLPIEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFS 272
                   D   E + E S L+D  +      TS+         P   D   + +KQ+ +
Sbjct: 223 ------ADDACKEASREASVLSDSIVHSRSPSTSA---------PVPDDEYLLSSKQLVT 267

Query: 273 NFNRHFKVTAEDYELFDLKTKAGIP 297
           NF  HF+  AE +E FD+K+    P
Sbjct: 268 NFQNHFRNMAETFETFDVKSSIKCP 292

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 137/308 (44%), Gaps = 46/308 (14%)

Query: 5   ETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENXXXXXXXX 64
           E +Y+Y G+N P+V+L  +R+++   ++  Y   +QD Y +     ETIT N        
Sbjct: 10  EELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGCDTH 69

Query: 65  XXXXXX--FIIEYNEIYDSFYVWK-SEGKWEMTDIVTQIYNTQSQP-KAKTKTP---NGA 117
                   +I+EYNE+   + +WK ++  W +  IV  +Y     P + +   P    G 
Sbjct: 70  ADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLPRELQGL 129

Query: 118 TKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNES 177
            +  ++++  D               L  LN+    +D  EF   L+++        ++ 
Sbjct: 130 REGLDMEYVWD--------------CLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDC 175

Query: 178 -SCKSFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADL 236
            + +  + +A  +  +  +K+ ++  +  Y  R R  ST A T  +        SP + L
Sbjct: 176 VTLRGVVALAALQATVQTSKRAVRSQLRAYDRRVRAASTPASTRTS--------SPESLL 227

Query: 237 PIEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFD-----LK 291
           P +    ++S S+ HY+Y  P+T         Q+ +NF  +F+  AE++ELF+     L+
Sbjct: 228 PADSR--ESSVSSVHYTYGLPAT---------QLDANFKTYFRSMAENFELFEEPALALR 276

Query: 292 TKAGIPRK 299
            +   PRK
Sbjct: 277 GRVAKPRK 284

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 139/324 (42%), Gaps = 56/324 (17%)

Query: 7   IYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENXXXXXXXXXX 66
           IY+Y G+N+PKV+LT+++      ++I+Y H +QD + ++ +  ETIT N          
Sbjct: 4   IYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNSHSD 63

Query: 67  XXXX-----FIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNGATKSW 121
                    +I+EY    D++ +WKS  +W+++  +  +Y + +      +       S 
Sbjct: 64  DTDDHDKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPDRLVEALKDSQ 123

Query: 122 EVQFKNDPRLKSHRKKDILKLALNNLNVDWSMV--DINEFWNQLDNICQIDSHMGNESSC 179
            + F     LK    +D +K       +DW  +  D+  F+   +    ID +       
Sbjct: 124 HI-FMVRNLLKEFNIRDTMK-------IDWDSIATDLMIFFEARELKKPIDPY-----EL 170

Query: 180 KSFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADLPIE 239
           K+ + ++L R+ +  NK+ L   +  Y  +   +++   +  +++               
Sbjct: 171 KTSMALSLLRSMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSAS--------------- 215

Query: 240 EEGLKTSSSNQHYSY-----HQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLKTKA 294
                 + +N++ ++     H PST         Q+ SNFN  F+  AE++E +D + + 
Sbjct: 216 ------TKANKNITFQSDYTHMPST---------QLQSNFNTFFQSMAENFETYDTERQP 260

Query: 295 GIPRKLRRNSSKITKDTRTKHINR 318
              R LR  S    K T    +++
Sbjct: 261 ST-RSLRLPSFAKNKKTPAGQVHK 283

>KLLA0B02695g 237221..238120 similar to sp|P34234 Saccharomyces
           cerevisiae YKL183w hypothetical protein singleton, start
           by similarity
          Length = 299

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 253 SYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLK 291
           SY Q +T  S +++ +  ++NF+RH+ V  ED  LF  K
Sbjct: 161 SYLQETTLSSVELILRPKYANFDRHYNVEVED--LFTFK 197

>KLLA0B05159g 466882..468075 similar to sp|P53397 Saccharomyces
           cerevisiae YML060w OGG1 8-oxoguanine DNA glycosylase
           singleton, start by similarity
          Length = 397

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 127 NDPRLKSHRKKDI-LKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNESSCKSFIVM 185
           N  +L+SH K    L ++LNNL   WS  D   F N+     ++ +    E+ C SFI  
Sbjct: 67  NLEKLESHLKDYFELDVSLNNLMTQWSDADPKGFQNKEHRGVRVLNQNPWETLC-SFICS 125

Query: 186 ALFRTRISRNKKLLQKLISEYGE 208
           +     ISR  K+   L +E+G+
Sbjct: 126 S--NNNISRITKMCHSLATEFGD 146

>KLLA0A03003g 264785..265393 weakly similar to sp|P43592
           Saccharomyces cerevisiae YFR008w singleton, hypothetical
           start
          Length = 202

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 240 EEGLK---TSSSNQHYSYHQPSTRDSKDIVAKQVF----SNFNRHFKVTAEDYELFDL 290
           +EGL+   T   N+ YSYH      S+D++  Q++    S FN++ +   +  +L DL
Sbjct: 133 DEGLEICVTMLRNEIYSYHVTVLSRSRDLIENQLYKAEDSQFNQYLESVTDLQQLLDL 190

>Scas_591.10
          Length = 772

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 20  LTRVRQFADFSDLI-KYFHSIQD-TYLIEFQICETITE 55
           +TR+RQ AD  DL+ K FH   + T +I  Q+C+ + E
Sbjct: 489 ITRMRQLADHPDLVLKRFHDQANVTGVIVCQLCDDVAE 526

>YOR276W (CAF20) [5062] chr15 (841330..841815) mRNA cap-binding
           protein (eIF4F) 20K subunit, may regulate Cdc33p (eIF4E)
           function [486 bp, 161 aa]
          Length = 161

 Score = 27.7 bits (60), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 238 IEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAED 284
           I +E LK   +N++ S ++P+  D++DIVA +    FN    + +ED
Sbjct: 112 IAQETLKVKPNNKNISSNRPA--DTRDIVADKPILGFNAFAALESED 156

>YJR031C (GEA1) [2927] chr10 complement(486500..490726) Component of
           complex with guanine-nucleotide-exchange activity for
           ARF [4227 bp, 1408 aa]
          Length = 1408

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 214 STEAITSDNSAELAIEDSPLADLPIEEEGLKTSSSNQHYSYHQ 256
           +T A +S  + EL ++  PL ++ +E+ G K S SNQ     Q
Sbjct: 860 TTLAQSSAKAVELDVDSIPLVEIFVEDTGSKISVSNQSIRLGQ 902

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,556,014
Number of extensions: 452799
Number of successful extensions: 1656
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1641
Number of HSP's successfully gapped: 37
Length of query: 319
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 217
Effective length of database: 13,065,073
Effective search space: 2835120841
Effective search space used: 2835120841
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)