Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_675.241319131951320.0
YJL076W (NET1)11894408596e-96
CAGL0H02783g17854387116e-76
AAL181C12214376631e-70
Scas_711.389983825771e-60
Kwal_14.242112054995524e-57
KLLA0C09394g11844505435e-56
CAGL0B03179g9273444682e-47
YKR010C (TOF2)7712383137e-29
AGR150C83047723.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_675.24
         (1319 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_675.24                                                          1981   0.0  
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   335   6e-96
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   278   6e-76
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   259   1e-70
Scas_711.38                                                           226   1e-60
Kwal_14.2421                                                          217   4e-57
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   213   5e-56
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   184   2e-47
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...   125   7e-29
AGR150C [4461] [Homologous to ScYDR081C (PDC2) - SH] (1031850..1...    32   3.3  

>Scas_675.24
          Length = 1319

 Score = 1981 bits (5132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1053/1319 (79%), Positives = 1053/1319 (79%)

Query: 1    MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60
            MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN
Sbjct: 1    MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60

Query: 61   NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTLQ 120
            NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTLQ
Sbjct: 61   NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTLQ 120

Query: 121  DINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQLKT 180
            DINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQLKT
Sbjct: 121  DINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQLKT 180

Query: 181  SPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNNSXXXX 240
            SPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNNS    
Sbjct: 181  SPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNNSDDER 240

Query: 241  XXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQQVMLP 300
                  SFL          IRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQQVMLP
Sbjct: 241  DDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQQVMLP 300

Query: 301  GTPANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKSQQGQQPTLSTPRIT 360
            GTPANYTMTPNRVTLTGQRVLSE          LIFVSSTQGPNKSQQGQQPTLSTPRIT
Sbjct: 301  GTPANYTMTPNRVTLTGQRVLSENYNTNGNNNGLIFVSSTQGPNKSQQGQQPTLSTPRIT 360

Query: 361  SGMLXXXXXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPYLETMEQDDSDRESTSDNE 420
            SGML             LHEG          KSDRIPMKKPYLETMEQDDSDRESTSDNE
Sbjct: 361  SGMLRIPEPRIAEIERELHEGPSSPASALPAKSDRIPMKKPYLETMEQDDSDRESTSDNE 420

Query: 421  VTPIPIEEEKSNDIFNTSKFGKISQKPDKVVIQRKSSLESKVGNKRVGSLAEQFPDDDMK 480
            VTPIPIEEEKSNDIFNTSKFGKISQKPDKVVIQRKSSLESKVGNKRVGSLAEQFPDDDMK
Sbjct: 421  VTPIPIEEEKSNDIFNTSKFGKISQKPDKVVIQRKSSLESKVGNKRVGSLAEQFPDDDMK 480

Query: 481  RISSFSXXXXXXXYAKNQNINLLPNIGXXXXXXXXXXXAITTLNKNEKNQNFTITSNENK 540
            RISSFS       YAKNQNINLLPNIG           AITTLNKNEKNQNFTITSNENK
Sbjct: 481  RISSFSDEDEEEEYAKNQNINLLPNIGEKNEKNEKNEKAITTLNKNEKNQNFTITSNENK 540

Query: 541  ISRLTKSTLAEDEGEFSTTEKEDLLKMVDTFLPGSPSKKSNGDKVLGSTKGEPNQEAKVE 600
            ISRLTKSTLAEDEGEFSTTEKEDLLKMVDTFLPGSPSKKSNGDKVLGSTKGEPNQEAKVE
Sbjct: 541  ISRLTKSTLAEDEGEFSTTEKEDLLKMVDTFLPGSPSKKSNGDKVLGSTKGEPNQEAKVE 600

Query: 601  NKTKKPTLKEIVRDSKVPDKLLNKTKTPKGKVSDTNQQVIEKGVSQKRLNAEPAEKRLXX 660
            NKTKKPTLKEIVRDSKVPDKLLNKTKTPKGKVSDTNQQVIEKGVSQKRLNAEPAEKRL  
Sbjct: 601  NKTKKPTLKEIVRDSKVPDKLLNKTKTPKGKVSDTNQQVIEKGVSQKRLNAEPAEKRLNK 660

Query: 661  XXXXXXXXXXXXXXXXAKNDQINSSNLXXXXXXXXXXXXXXXXRMERDVRILKQPVSSKE 720
                            AKNDQINSSNL                RMERDVRILKQPVSSKE
Sbjct: 661  KINVNKIVNVTKSTKTAKNDQINSSNLSEDDETSEESSTDDESRMERDVRILKQPVSSKE 720

Query: 721  KSSKNLHAVKQMEVPKGSQNSVNKMLPEDAAQMIVQKKKNENEEVXXXXXXXXXXXXERL 780
            KSSKNLHAVKQMEVPKGSQNSVNKMLPEDAAQMIVQKKKNENEEV            ERL
Sbjct: 721  KSSKNLHAVKQMEVPKGSQNSVNKMLPEDAAQMIVQKKKNENEEVSSTSDSDSDSDSERL 780

Query: 781  IKIGNKTHMNKPNSVIKNQISKKPVKKTTFVLPASDVYSKSNKPKNKEFQTPEFIQXXXX 840
            IKIGNKTHMNKPNSVIKNQISKKPVKKTTFVLPASDVYSKSNKPKNKEFQTPEFIQ    
Sbjct: 781  IKIGNKTHMNKPNSVIKNQISKKPVKKTTFVLPASDVYSKSNKPKNKEFQTPEFIQDDSD 840

Query: 841  XXXXXXXXXXXXXXXXXXXKVEQQNNKSKYREIAKPFESNEYRMIREILNGNNVPNDSTI 900
                               KVEQQNNKSKYREIAKPFESNEYRMIREILNGNNVPNDSTI
Sbjct: 841  SSENTSSDSESEDDATDTSKVEQQNNKSKYREIAKPFESNEYRMIREILNGNNVPNDSTI 900

Query: 901  KDTQKPASQPXXXXXXXXXXXXXXXXXXXXXXXXPLPEVPDHDKKNENENSSPTKKIKES 960
            KDTQKPASQP                        PLPEVPDHDKKNENENSSPTKKIKES
Sbjct: 901  KDTQKPASQPKPTNESNNSKTKKSASKSKNISSKPLPEVPDHDKKNENENSSPTKKIKES 960

Query: 961  NNLVGESKNISDNKKFPIVQHVERENNDDKQREKESKVAKDKKSTSTILLKKESINTGTN 1020
            NNLVGESKNISDNKKFPIVQHVERENNDDKQREKESKVAKDKKSTSTILLKKESINTGTN
Sbjct: 961  NNLVGESKNISDNKKFPIVQHVERENNDDKQREKESKVAKDKKSTSTILLKKESINTGTN 1020

Query: 1021 DARSAETQSVPIKEKNSTLEQRKEKIKNMKTSTESPKGKKKQSNSLVPPRTTTKPNEPSL 1080
            DARSAETQSVPIKEKNSTLEQRKEKIKNMKTSTESPKGKKKQSNSLVPPRTTTKPNEPSL
Sbjct: 1021 DARSAETQSVPIKEKNSTLEQRKEKIKNMKTSTESPKGKKKQSNSLVPPRTTTKPNEPSL 1080

Query: 1081 EEALKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVSRRLVVATP 1140
            EEALKA                                           KVSRRLVVATP
Sbjct: 1081 EEALKASNNSSDSSNESNSSGSYSSSMIESSSDDSSDSSSSDEGDSSSSKVSRRLVVATP 1140

Query: 1141 KGELSFIPKKPSQTDFSDLENMXXXXXXXXXXXXXLAKQPPKQTSDAAHKSESNVVVSKP 1200
            KGELSFIPKKPSQTDFSDLENM             LAKQPPKQTSDAAHKSESNVVVSKP
Sbjct: 1141 KGELSFIPKKPSQTDFSDLENMPQSTQPQQKSPPKLAKQPPKQTSDAAHKSESNVVVSKP 1200

Query: 1201 VNDIKEASTTIKPSLSSLSDLVSRGIPDVKENKANKSNSKPTLDKTAQEPTXXXXXXXXX 1260
            VNDIKEASTTIKPSLSSLSDLVSRGIPDVKENKANKSNSKPTLDKTAQEPT         
Sbjct: 1201 VNDIKEASTTIKPSLSSLSDLVSRGIPDVKENKANKSNSKPTLDKTAQEPTSGSDDSGES 1260

Query: 1261 XXXXXXXXXXXXXXXXXXXXXXNEQKSFIXXXXXXXXXXXXXXXVRGGFASLIKDSKKK 1319
                                  NEQKSFI               VRGGFASLIKDSKKK
Sbjct: 1261 SESSSSDSDSSSSDSDESSSSENEQKSFISAKSASAALKKKSKKVRGGFASLIKDSKKK 1319

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  335 bits (859), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 273/440 (62%), Gaps = 33/440 (7%)

Query: 1   MYKLQVVLVPPSARDSL-VPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSN 59
           MYKLQVVLVPPS + ++ +   Y     +SSQ +   N +N     M    GD S+Q++N
Sbjct: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLL--PNRTN-----MAQSAGDASLQYAN 53

Query: 60  NNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTL 119
             +  +     P+Y NQ++ +KFL FTKPTN+LL LSDE++ KCEKMYP+L ED+EIL+L
Sbjct: 54  LRSANVS--FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSL 111

Query: 120 QDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQLK 179
           QD +GCDLDPDF VKD+FN++N+V V++KNE+D+  +   S+Y++ KR KLNNG  Q ++
Sbjct: 112 QDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQ 171

Query: 180 TSPRT-QSTGALKIEKKRP----STSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKM-T 233
              +   S+G L+I KKRP    +T++ IR+ T   N ++R+STPLA QIYP P  K+ +
Sbjct: 172 PQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSAT---NGSMRVSTPLARQIYPPPSSKIVS 228

Query: 234 NNSXXXXXXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKS 293
           NNS          SFL          IRISSGI+  K+I+S+IVEED VSRS TVDPDK+
Sbjct: 229 NNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKT 288

Query: 294 KQQVMLPGTPANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKSQQG---- 349
           KQQ +L GTP   TMTPNRVTLTGQRV+SE          L+F +S    + +  G    
Sbjct: 289 KQQRLLSGTPIMSTMTPNRVTLTGQRVVSE----HAHKNELVFSASASSSSFANGGTAAV 344

Query: 350 ------QQPTLSTPRITSGMLXXXXXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPYL 403
                 ++P ++TPRITSGML             L EG          K+ +IPMKKPYL
Sbjct: 345 TAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYL 404

Query: 404 ETMEQDDSDRESTSDNEVTP 423
           E  E  +SD  S+S+N+ TP
Sbjct: 405 ENGENYESDDSSSSENQETP 424

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  278 bits (711), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 188/438 (42%), Positives = 241/438 (55%), Gaps = 51/438 (11%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSS------QFMNDGNGSNILPKSMINGTGDMS 54
           MYKLQV+LVPPS +++   L+Y   Q ++S      Q  N  NG+     +  NG     
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTF---NNTFNGQSQPD 57

Query: 55  MQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDL 114
                  T +  S++ PNY  Q   KKFLHFTK  N+LL LSDE+  KC+ MYP+L  DL
Sbjct: 58  SSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADL 117

Query: 115 EILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGG 174
           +IL+LQD NGCDLDPDF VKD+FN+DN+V V++ +ELD+S     S YR+ KR++LN   
Sbjct: 118 DILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSIKRRRLN--- 174

Query: 175 AQQLKTSPRTQSTG----ALKIEKKRPSTSSGIRNPT-TNGNSTLRISTPLANQIYPSPI 229
            + L  S      G    ++K+ KKR STS+ I+  +  NG    RISTPLA Q+YP   
Sbjct: 175 PESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNING----RISTPLARQLYPPSA 230

Query: 230 MKMTNNSXXXXXXXXXXSFLXXXXXXXXXXIRISSGINQS-KRIRSTIVEEDTVSRSGTV 288
           +    NS          SFL          IRISSGI+ + ++I S I E+DTVSRS TV
Sbjct: 231 IFEPQNS--DDEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDTVSRSATV 288

Query: 289 DPDKSKQQVMLPGTPANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKS-- 346
           DPDKS+QQ +L GTP   TMTPNRVTLTGQRV+SE                 Q PN S  
Sbjct: 289 DPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISE-----------------QRPNDSVL 331

Query: 347 ----QQGQQPTLSTPRITSGMLXXXXXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPY 402
               +   +P+ S  RITSGML             L EG            D+IPMKKP+
Sbjct: 332 TFTNRHINEPSHSR-RITSGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPF 390

Query: 403 LET---MEQDDSDRESTS 417
           +ET     +D S+ ES S
Sbjct: 391 IETERYYSEDSSETESNS 408

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  259 bits (663), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 179/437 (40%), Positives = 229/437 (52%), Gaps = 49/437 (11%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60
           MYKLQVVLVPPS    L  +  PA   D+S F   G+   I   S+  G G+ S    N 
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQ-GHAQPISTSSIAGGRGEFSSGIGNT 59

Query: 61  --NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILT 118
             N + +  ++   +  +A+ +KFLHFTKPTNSL  L+DE++ KC KMYP L E+ EI+T
Sbjct: 60  SANAVYLSGLVG-AHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVT 118

Query: 119 LQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQL 178
           LQD+N CDLDPDF VKD+FN+DN V VL++N+LD  +AG  +IY   K++KLN G A   
Sbjct: 119 LQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-EAAGDRTIY--MKKRKLNTGAAGVP 175

Query: 179 KTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNNSXX 238
                 Q+   L + KKR S  +          S LR+STPLANQIYP P  K   NS  
Sbjct: 176 AAGGSVQA-AVLNVAKKRASIKT----------SALRVSTPLANQIYPPPTKKQV-NSDF 223

Query: 239 XXXXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQQVM 298
                   S L          IRISSG++Q KRI    + ++ VS+S TVDP+KS+QQ +
Sbjct: 224 EDDDVADKSIL-PPPPPQSPPIRISSGMDQ-KRIN---MNDNAVSKSETVDPNKSRQQRL 278

Query: 299 LPGT---PANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKSQQGQQPTLS 355
             GT   P +   TPNRV+LTG  VLSE                            P ++
Sbjct: 279 PSGTPMRPVSMVETPNRVSLTGPTVLSESTVSQKSTAT------------------PIIT 320

Query: 356 TPRITSGMLXXXXXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPYLETMEQDD---SD 412
             RITSGML             L EG          +  RIPMKKPY  +M+QD+   S 
Sbjct: 321 NIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLSSS 380

Query: 413 RESTSDNEVTPIPIEEE 429
             ST DN V  +P E E
Sbjct: 381 SSSTEDN-VPAVPYENE 396

>Scas_711.38
          Length = 998

 Score =  226 bits (577), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 150/382 (39%), Positives = 205/382 (53%), Gaps = 22/382 (5%)

Query: 54  SMQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNED 113
           S Q+  N  ++ G  +  N++   K KKFL FTKPTN L  LS E++ KCE MYP+L+E+
Sbjct: 41  SFQYPYNRFLSFGLPL--NFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEE 98

Query: 114 LEILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNG 173
           LEI TL+D   CDLDPDF V+++F+  N+V V++KN++D  S    S Y++ KR+K N G
Sbjct: 99  LEIETLRDSTDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTG 158

Query: 174 GAQQLKTS-PRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKM 232
             Q L     + Q+ G   I +K+    S  + P+  G    RISTPLA QIYP    ++
Sbjct: 159 SYQPLSNKVSQQQANGVYGIPRKQYLAISSTKTPSNVGR---RISTPLAQQIYPDIDEQL 215

Query: 233 TNNSXXXXXXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDK 292
            N            SFL          IR+SSGI++SK+I   I ++D+VSRS  VDPDK
Sbjct: 216 EN---EEDRNAADRSFLPPPAQPQSPQIRVSSGIDRSKKIDG-IAKDDSVSRSEVVDPDK 271

Query: 293 SKQQVMLPGTPANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKSQQGQQ- 351
           SKQQ +L GTP   TMTPNRVTLTGQRV+SE          L F+     PN  +   Q 
Sbjct: 272 SKQQRLLLGTPIMTTMTPNRVTLTGQRVVSE----SHTSNSLQFI-----PNNKENSTQR 322

Query: 352 -PTLSTPRITSGMLXXX-XXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPYLETMEQD 409
             + S  R+ S +L              L  G          KS+R+PMK+P+L  +   
Sbjct: 323 LSSNSNRRVNSAVLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFLTGVSSS 382

Query: 410 DSDRESTSDNEVTPIPIEEEKS 431
            SD   +SD+     P  + +S
Sbjct: 383 YSDENISSDSSTHSRPTLQRQS 404

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 23/27 (85%)

Query: 1211 IKPSLSSLSDLVSRGIPDVKENKANKS 1237
            ++PSL+SLSDL+ +GIPDVKE + N S
Sbjct: 896  VRPSLNSLSDLIYKGIPDVKEKRLNAS 922

>Kwal_14.2421
          Length = 1205

 Score =  217 bits (552), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 175/499 (35%), Positives = 245/499 (49%), Gaps = 88/499 (17%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQP--DSSQFMND---GNGSNILPKSMINGTGDMSM 55
           MYKLQVVLVPP    S V  + P N P  D+SQ +      NGS IL  +      ++  
Sbjct: 1   MYKLQVVLVPPGF--SGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRP----ELGQ 54

Query: 56  QFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLE 115
           Q  ++N + + S     + +  K +K LHFTKPTN+L +L++E++ +C+K+YPNL   +E
Sbjct: 55  QTGSSNNLFMSSFAS-THGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVE 113

Query: 116 ILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGA 175
           +LTLQD N CDLDPD+ VKD+FN+DNVV  +++N++++S   S ++Y + KR++LN+   
Sbjct: 114 VLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLNSS-- 170

Query: 176 QQLKTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNN 235
                +P  Q    L I KKRP     +RN     +S +R+STPLANQIYP P      N
Sbjct: 171 ---LPNPSGQPN-VLHIAKKRPHM---LRN-----SSAMRVSTPLANQIYP-PATGRQVN 217

Query: 236 SXXXXXXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQ 295
           S          S L          IRISSG+  +K+I      EDTVSRS  VDPDKS+Q
Sbjct: 218 SDYEDDDVGDRSVLPPPQPQSQP-IRISSGVGSAKKIN---FNEDTVSRSEAVDPDKSRQ 273

Query: 296 QVMLPGTPANY-----TMTPNRVTLTGQRVLSEXXXXXXXXXXLIFVSSTQGPNKSQQGQ 350
           Q +  GTP  +       TPNR+ +    + ++                    NKS    
Sbjct: 274 QRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVT-----------------NKSSA-- 314

Query: 351 QPTLSTPRITSGMLXXXXXXXXXXXXXLHEGXXXXXXXXXXKSDRIPMKKPYLETMEQDD 410
            P  +  RITSGML             L +G          + DRIPMKK      + DD
Sbjct: 315 TPVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIPMKKQQFP--QSDD 372

Query: 411 SDRESTSDNEVTPIPIEEEKSNDIF------------------------NTSKFGKISQK 446
            ++  +S NE    P   EK+N++                         + +K G ++  
Sbjct: 373 EEQSQSSGNEN---PTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDGNKIGNVNLA 429

Query: 447 PDKVV---IQRKSSLESKV 462
               V   I RKSSLESKV
Sbjct: 430 ELPQVGRRITRKSSLESKV 448

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  213 bits (543), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 223/450 (49%), Gaps = 64/450 (14%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFM------------NDGNGSNILPKSMIN 48
           M+KLQVVLVP  A  S      P+   +SSQF+            N    +N +P    N
Sbjct: 1   MFKLQVVLVPAGANRSFN-FGLPSVSSESSQFILPVQQQVLQQGGNAPQLANNIPAQ--N 57

Query: 49  GTGDMSMQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYP 108
           G G +    S N T  + S +  + T + K KKFL FTKPTN+L  LS E+L KC K+YP
Sbjct: 58  GIGALDPNVSTN-TAYLSSFMTSHIT-RPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYP 115

Query: 109 NLNEDLEILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSS--AGSTSIYRNFK 166
           NL+ +LEI TLQD++ CDLDPDF VKD+FN+ N V V+++N++D+ S      S+Y + K
Sbjct: 116 NLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSS-K 174

Query: 167 RQKLNNGGAQQLKTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYP 226
           R+KLNNG +QQ        STGA      +P T +  R P    NS LRISTPLA+QIYP
Sbjct: 175 RRKLNNGNSQQ------NTSTGAT---LDQPVTVAK-RRPQALKNSALRISTPLAHQIYP 224

Query: 227 SPIM---KMTNNSXXXXXXXXXX----SFLXXXXXXXXXXIRISSGINQSKRIRSTIVEE 279
            P     K  N+               S L          IRISS I Q KR++     E
Sbjct: 225 PPSQRNPKQVNSDYEEDEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQ-KRLKIN-GSE 282

Query: 280 DTVSRSGTVDPDKSKQQVMLPGT---PANYTMTPNRVTLTGQRVLSEXXXXXXXXXXLIF 336
           DTVS+S TVDP K+KQQ +  GT   P N   TPNR                     L+ 
Sbjct: 283 DTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAM---------PQQAQHLLR 333

Query: 337 VSSTQGPNKSQQGQQPTLSTPRITSGMLXXXXXXXXXXXXXLHEGXXX-XXXXXXXKSDR 395
           ++ST           P ++  RITSGML             +HEG           KS +
Sbjct: 334 INST-----------PVVTNKRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAK 382

Query: 396 IPMKKPYL-ETMEQDDSDRESTSDNEVTPI 424
           IPMKK Y+ +  +   S+ E T D E  P+
Sbjct: 383 IPMKKQYIPDEHDSSSSEGEFTEDKESVPV 412

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 174/344 (50%), Gaps = 66/344 (19%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60
           MYKLQVVL+             P NQ  ++ +  DG+ S+           D ++    N
Sbjct: 1   MYKLQVVLI------------QPQNQLKANGYSIDGDNSD-----------DQTITTIRN 37

Query: 61  NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLN-EDLEILTL 119
                G IIR +      T+KFLHFTKP N+LL L+DE+  +  K+Y NLN E  EIL+L
Sbjct: 38  G----GHIIRDH------TRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSL 87

Query: 120 QDINGCDLDPDFTVKDIFNIDNVVMVLIKNEL------------DVSSAGSTSIYRNFKR 167
           QDIN CDLD  + VKD+F++DN V+V++KNEL            D+  AG  S Y + ++
Sbjct: 88  QDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRK 147

Query: 168 QKLNNGGAQQLKTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPS 227
           ++ +       +  P+      L  ++ +P+  + + N        LR+++PLAN+I   
Sbjct: 148 RRSSKAFGNSSRIEPQI-----LVPKRSKPNNLAPLSN-------NLRVTSPLANEISND 195

Query: 228 PI--------MKMTNNSXXXXXXXXXXSFLXXXXXXXXXXIRISSGINQSKRIRSTIVEE 279
            I          ++             SFL          IRISSGI   KRI S     
Sbjct: 196 EINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNL 255

Query: 280 DTVSRSGTVDPDKSKQQVMLPGTPANYTMTPNRVTLTGQRVLSE 323
           D VSRS  VDPDKSKQQ+++P  P  +  TPNRV L+GQRV+SE
Sbjct: 256 DVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISE 299

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 453 QRKSSLESKVGNKRVGSLAEQFPDDDMKRISSFS 486
           +R SSLE KV NKRV S      +D +KRI +FS
Sbjct: 359 KRTSSLELKVHNKRVNSTNIPIIEDVLKRIDNFS 392

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score =  125 bits (313), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 128/238 (53%), Gaps = 20/238 (8%)

Query: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60
           M++LQ+VLVPPSA+D +  L    N P S   M   N   I   + IN   D S   S +
Sbjct: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSINNCSDPSPT-SPS 62

Query: 61  NTMTIGSIIRPNYTNQA-KTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTL 119
           +  +I S    ++ N     KKFLHFT   N+LL LS+E+L K +++YPN  E +EI++L
Sbjct: 63  SQNSIQSNRSSDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSL 122

Query: 120 QDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQLK 179
           QD +GCDLD +F +KD+F  D VV+V++K+ELD S     S+ +   RQ+      ++  
Sbjct: 123 QDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQ-LARQR------RRQD 175

Query: 180 TSPRTQSTGALKIEKKRPSTSSGIRNPTTN---GNSTL--------RISTPLANQIYP 226
             P T+S    K +K      S I N  T      S+L        R+STPL N+I P
Sbjct: 176 NKPSTKSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILP 233

>AGR150C [4461] [Homologous to ScYDR081C (PDC2) - SH]
           (1031850..1034342) [2493 bp, 830 aa]
          Length = 830

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 17  LVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNNNTM 63
            + L++ A  PD+ +   +   S ILP  MIN TG +SM F  N  +
Sbjct: 401 FIKLAWEAIPPDTIK--ANWKASGILPPEMINFTGTVSMAFKKNEVL 445

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.305    0.123    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,821,860
Number of extensions: 1566088
Number of successful extensions: 7194
Number of sequences better than 10.0: 330
Number of HSP's gapped: 7242
Number of HSP's successfully gapped: 404
Length of query: 1319
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1205
Effective length of database: 12,649,657
Effective search space: 15242836685
Effective search space used: 15242836685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 68 (30.8 bits)