Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_674.271067106748880.0
YJR091C (JSN1)1091107626190.0
Kwal_33.143951076108424430.0
CAGL0M09108g110992124220.0
AGL305W1057108423400.0
KLLA0E05984g1094111822740.0
CAGL0H08778g106562414061e-177
Scas_672.26*107939513421e-167
YPR042C (PUF2)107538211861e-144
Scas_7.12472256957e-84
YGL014W (PUF4)8882402039e-16
Scas_688.288312461941e-14
Kwal_47.175117072831885e-14
AGL086C7352041885e-14
Scas_688.28282411885e-14
ADL056W8072371779e-13
KLLA0F15477g9303031742e-12
YLL013C (PUF3)8792301733e-12
CAGL0D05544g9112281725e-12
AAL152W7872431672e-11
CAGL0A00473g7862401672e-11
Scas_707.378132361662e-11
CAGL0L05962g8972231662e-11
KLLA0E13629g8222211643e-11
Sklu_2097.27873271625e-11
YGL178W (MPT5)8592561635e-11
Kwal_20.27293892021571e-10
KLLA0A09097g8052021537e-10
Sklu_2033.27442211456e-09
Kwal_33.151137582381421e-08
Scas_621.10415115960.003
YGR159C (NSR1)414114800.26
ABR207W240277800.28
KLLA0E22396g64192732.1
CAGL0I01496g64792703.9
CAGL0I03322g64692704.4
KLLA0A09405g269108676.3
CAGL0B02816g89488696.6
YJR045C (SSC1)65492687.1
Sklu_2264.366492679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_674.27
         (1067 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_674.27                                                          1887   0.0  
YJR091C (JSN1) [2982] chr10 complement(594975..598250) Protein t...  1013   0.0  
Kwal_33.14395                                                         945   0.0  
CAGL0M09108g 910473..913802 similar to sp|P47135 Saccharomyces c...   937   0.0  
AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C (...   905   0.0  
KLLA0E05984g 541992..545276 similar to sp|P47135 Saccharomyces c...   880   0.0  
CAGL0H08778g 854147..857344 some similarities with tr|Q12221 Sac...   546   e-177
Scas_672.26*                                                          521   e-167
YPR042C (PUF2) [5475] chr16 complement(650430..653657) Protein t...   461   e-144
Scas_7.1                                                              272   7e-84
YGL014W (PUF4) [1959] chr7 (466144..468810) Protein with pumilio...    83   9e-16
Scas_688.28                                                            79   1e-14
Kwal_47.17511                                                          77   5e-14
AGL086C [4225] [Homologous to ScYGL014W (PUF4) - SH] (543176..54...    77   5e-14
Scas_688.2                                                             77   5e-14
ADL056W [1685] [Homologous to ScYGL178W (MPT5) - SH] complement(...    73   9e-13
KLLA0F15477g complement(1429123..1431915) some similarities with...    72   2e-12
YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein i...    71   3e-12
CAGL0D05544g complement(527482..530217) similar to tr|Q07807 Sac...    71   5e-12
AAL152W [35] [Homologous to ScYLL013C (PUF3) - SH] complement(77...    69   2e-11
CAGL0A00473g complement(51137..53497) similar to sp|P25339 Sacch...    69   2e-11
Scas_707.37                                                            69   2e-11
CAGL0L05962g complement(662298..664991) similar to sp|P39016 Sac...    69   2e-11
KLLA0E13629g complement(1201715..1204183) some similarities with...    68   3e-11
Sklu_2097.2 YLL013C, Contig c2097 4468-6831                            67   5e-11
YGL178W (MPT5) [1813] chr7 (167356..167358,167999..170575) Prote...    67   5e-11
Kwal_20.2729                                                           65   1e-10
KLLA0A09097g 794827..797244 some similarities with sp|P25339 Sac...    64   7e-10
Sklu_2033.2 YGL178W, Contig c2033 2461-4695                            60   6e-09
Kwal_33.15113                                                          59   1e-08
Scas_621.10                                                            42   0.003
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    35   0.26 
ABR207W [801] [Homologous to ScYHR165C (PRP8) - SH] complement(7...    35   0.28 
KLLA0E22396g 1990670..1992595 highly similar to sp|P12398 Saccha...    33   2.1  
CAGL0I01496g 120258..122201 highly similar to sp|P12398 Saccharo...    32   3.9  
CAGL0I03322g complement(283299..285239) highly similar to sp|P12...    32   4.4  
KLLA0A09405g complement(820161..820970) no similarity, hypotheti...    30   6.3  
CAGL0B02816g complement(271482..274166) similar to sp|Q06488 Sac...    31   6.6  
YJR045C (SSC1) [2939] chr10 complement(519552..521516) Mitochond...    31   7.1  
Sklu_2264.3 YJR045C, Contig c2264 2755-4749                            30   9.5  

>Scas_674.27
          Length = 1067

 Score = 1887 bits (4888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1067 (87%), Positives = 936/1067 (87%)

Query: 1    MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDDELDTQQTQKLGSYRARAGKFSNTLSNL 60
            MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDDELDTQQTQKLGSYRARAGKFSNTLSNL
Sbjct: 1    MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDDELDTQQTQKLGSYRARAGKFSNTLSNL 60

Query: 61   LPSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLS 120
            LPSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLS
Sbjct: 61   LPSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLS 120

Query: 121  DLTPPQENGKLVHFPDTTNYMLNPPRSSNDSFQFNRSRNNTVSSQITSLSSLQPNTQTNA 180
            DLTPPQENGKLVHFPDTTNYMLNPPRSSNDSFQFNRSRNNTVSSQITSLSSLQPNTQTNA
Sbjct: 121  DLTPPQENGKLVHFPDTTNYMLNPPRSSNDSFQFNRSRNNTVSSQITSLSSLQPNTQTNA 180

Query: 181  NNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTITPVPSYYEPSLSQQKSETLN 240
            NNLWTSVSNPPEA         FNSNNNPNILGMSNLNTITPVPSYYEPSLSQQKSETLN
Sbjct: 181  NNLWTSVSNPPEAMQQQQMLQQFNSNNNPNILGMSNLNTITPVPSYYEPSLSQQKSETLN 240

Query: 241  NTLTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEARSRATSSYTISQQPLSQEFPSVGD 300
            NTLTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEARSRATSSYTISQQPLSQEFPSVGD
Sbjct: 241  NTLTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEARSRATSSYTISQQPLSQEFPSVGD 300

Query: 301  EVDPRAINWVSMETTVPTINQINNLLPTNTITISNVFXXXXXXXXXXXTINLTSTSLATL 360
            EVDPRAINWVSMETTVPTINQINNLLPTNTITISNVF           TINLTSTSLATL
Sbjct: 301  EVDPRAINWVSMETTVPTINQINNLLPTNTITISNVFPLQQQQPQLNNTINLTSTSLATL 360

Query: 361  CSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHH 420
            CSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHH
Sbjct: 361  CSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHH 420

Query: 421  FNXXXXXXXXXXXXXXXXXXXXXXXXXXYNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVS 480
            FN                          YNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVS
Sbjct: 421  FNQQQQQLQQSRTADQSQQPQPLLQEQLYNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVS 480

Query: 481  NSTGNTYSYPXXXXXXXXXXXXXXXXXXXXXEKEQCPFPLPPPKLSTQKSKLEDIIHSFD 540
            NSTGNTYSYP                     EKEQCPFPLPPPKLSTQKSKLEDIIHSFD
Sbjct: 481  NSTGNTYSYPTHATSHGGSSSNGGTATTATNEKEQCPFPLPPPKLSTQKSKLEDIIHSFD 540

Query: 541  TKADRLQLEALINNGINYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLE 600
            TKADRLQLEALINNGINYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLE
Sbjct: 541  TKADRLQLEALINNGINYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLE 600

Query: 601  LEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWA 660
            LEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWA
Sbjct: 601  LEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWA 660

Query: 661  CQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNF 720
            CQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNF
Sbjct: 661  CQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNF 720

Query: 721  WIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCV 780
            WIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCV
Sbjct: 721  WIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCV 780

Query: 781  LPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEIFGKLDSKEPPK 840
            LPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEIFGKLDSKEPPK
Sbjct: 781  LPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEIFGKLDSKEPPK 840

Query: 841  VLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGL 900
            VLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGL
Sbjct: 841  VLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGL 900

Query: 901  APTSAXXXXXXXXXXXXXXXXXXXXXVYNPADANPSHMRGMSVSSVRSNGSRHNTXXXXX 960
            APTSA                     VYNPADANPSHMRGMSVSSVRSNGSRHNT     
Sbjct: 901  APTSASMQQGGGGSGSHRKSSLSHLGVYNPADANPSHMRGMSVSSVRSNGSRHNTQVPIP 960

Query: 961  XXXXXXXXXXXXXXXXXXXXXXXMNNASTNSINAGYYNYPGMFPGSFGPPTGMNGAYPMN 1020
                                   MNNASTNSINAGYYNYPGMFPGSFGPPTGMNGAYPMN
Sbjct: 961  QGAIQQQQSQQQPVPIPSIVQQPMNNASTNSINAGYYNYPGMFPGSFGPPTGMNGAYPMN 1020

Query: 1021 TDDLSSQFDMLALNNGTHLSLPQLSVXXXXXXXXXXXXXXXSATYRS 1067
            TDDLSSQFDMLALNNGTHLSLPQLSV               SATYRS
Sbjct: 1021 TDDLSSQFDMLALNNGTHLSLPQLSVTNQNNNTTNLLNKTNSATYRS 1067

>YJR091C (JSN1) [2982] chr10 complement(594975..598250) Protein that
            when overproduced can suppress the hyperstable
            microtubule phenotype of tub2-150 [3276 bp, 1091 aa]
          Length = 1091

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1076 (54%), Positives = 730/1076 (67%), Gaps = 63/1076 (5%)

Query: 1    MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDDELDT--------QQTQKLGSYRARAGK 52
            M++ +  + NN  L NIPEVIDPGITIPIY+++  +         QQ QKLGSYR+RAGK
Sbjct: 1    MDKSKQMNINN--LSNIPEVIDPGITIPIYEEEYENNGESNSQLQQQPQKLGSYRSRAGK 58

Query: 53   FSNTLSNLLPSISAKLHHSKKNGTVHGKNG-EFSPTNSSSGSTVDLKAQQVSPLKPM--- 108
            FSNTLSNLLPSISAKLHHSKKN   HGKNG EFS +N+SS STV  K  + SP +     
Sbjct: 59   FSNTLSNLLPSISAKLHHSKKNS--HGKNGAEFSSSNNSSQSTVASKTPRASPSRSKMME 116

Query: 109  KNFTATTTGNLSDLTPPQENGKLVHFPDTTNYMLNP-PRSSNDSF----QFNRSRNNTVS 163
             +    T      LTPPQ+  KLVHFPD++N  L P PR S+DSF    Q +R+RNNT+S
Sbjct: 117  SSIDGVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQISRTRNNTMS 176

Query: 164  SQITSLSSLQPNTQTNANNLWTS--VSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTIT 221
            SQITS+SS+ P  +T++  +W+S   +N P             SNN  N   +++ +T T
Sbjct: 177  SQITSISSIAPKPRTSSG-IWSSNASANDPMQQHLLQQLQPTTSNNTTNSNTLNDYSTKT 235

Query: 222  PVPSYYEPSLSQQKSETLNNT-----LTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEA 276
               +Y++  +S   S+  +N      L +P+S VW N RQRS SN SS+Y DA  Y+Q A
Sbjct: 236  ---AYFDNMVSTSGSQMADNKMNTNNLAIPNS-VWSNTRQRSQSNASSIYTDAPLYEQPA 291

Query: 277  RSRATSSYTISQQPLSQEFPSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTITISNV 336
            R+  +S YTI     +QE P + DE+DP++INWV+M+ TVP+INQI+NLLPTNTI+ISNV
Sbjct: 292  RASISSHYTIP----TQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNV 347

Query: 337  FXXXXXXXXXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDL 396
            F            INLTSTSLATLCSKYGEVIS+RT + LN+ALVEF++VESA++A   L
Sbjct: 348  FPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSL 407

Query: 397  QGKDVSVIGTPSNVSFAKILPMHH----FNXXXXXXXXXXXXXXXXXXXXXXXXXXYNGS 452
            QGK+VS+IG PS +SFAKILPMH     F                           +NG+
Sbjct: 408  QGKEVSMIGAPSKISFAKILPMHQQPPQF-LLNSQGLPLGLENNNLQPQPLLQEQLFNGA 466

Query: 453  VTFQQQGNVSVPVFKQYSQYQQPFVNVSNSTGNTYSYPXXXXXXXXXXXXXXXXXXXXXE 512
            VTFQQQGNVS+PVF Q SQ  Q   + S S G    +                      E
Sbjct: 467  VTFQQQGNVSIPVFNQQSQQSQHQNHSSGSAG----FSNVLHGYNNNNSMHGNNNNSANE 522

Query: 513  KEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTNDTMNFGPLPE 572
            KEQCPFPLPPP ++ ++  L +II  F+  +D  Q+ +LI   +N+KGT+DT NFGPLPE
Sbjct: 523  KEQCPFPLPPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPE 582

Query: 573  PLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKS 632
            PL+ ++FD PKLRELRK+ID+N  SDLE+EQLA+ MLDELPELSSDYLGNTIVQKLFE S
Sbjct: 583  PLSGREFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHS 642

Query: 633  SDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQ 692
            SDI+KDIMLRKTSKYLTSMGVHKNGTWACQKMITMA TPRQI  V++GV DYCTPL NDQ
Sbjct: 643  SDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQ 702

Query: 693  FGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLS 752
            FGNYVIQCVLKFGFPWN FIF+SII+NFW++VQNRYGARAVRACLEAHDIVT EQ++VLS
Sbjct: 703  FGNYVIQCVLKFGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLS 762

Query: 753  AMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKI 812
            AMIV Y+EYL++N+NG LL+TWFLDT VLPNRHSILA RL   IV+LC HRLASLT+LK+
Sbjct: 763  AMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKV 822

Query: 813  LNYRGDDEARKILFEEIFGKLDSKE--PPKVLTQILTDANYGPTFIYKILSMPLLEDEIR 870
            LNYRGDD ARKI+ + +FG +++ +  PPK LT++L + NYGPTF++K+L+MPLLED++R
Sbjct: 823  LNYRGDDNARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLR 882

Query: 871  SHVIKQVRKILMEHGLSQQQHRRLMEEVGLAPTSAXXXXXXXXXXXXXXXXXXXXXVYNP 930
            +H+IKQVRK+L +     Q  RRL+EEVGLA  S                      ++  
Sbjct: 883  AHIIKQVRKVLTD-STQIQPSRRLLEEVGLA--SPSSTHNKTKQQQQQHHNSSISHMFAT 939

Query: 931  ADANPSHMRGMSVSSVRSNGSRHNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNASTN 990
             D +  HMRG+SVSSV+S GS+H T                              NA++N
Sbjct: 940  PDTSGQHMRGLSVSSVKSGGSKHTTMNTTTTNGSSASTLSPGQPL----------NANSN 989

Query: 991  SINAGYYNYPGMFPGSFGPPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLPQLSV 1046
            S + GY++YPG+FP S       NG Y MN DDLSSQFDML  NNGT LSLPQLS+
Sbjct: 990  S-SMGYFSYPGVFPVSGFSGNASNG-YAMNNDDLSSQFDMLNFNNGTRLSLPQLSL 1043

>Kwal_33.14395
          Length = 1076

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1084 (49%), Positives = 666/1084 (61%), Gaps = 81/1084 (7%)

Query: 3    EKRTPSANNGLLHNIPEVIDPGITIPIYDDD--ELDTQQTQKLGSYRARAGKFSNTLSNL 60
            EK  PS    L   IPE IDPGI +P+Y+++    D  Q QKLGSYR RAG+FSNTLSNL
Sbjct: 2    EKAKPSQKQSLTQ-IPEAIDPGIILPLYEEELHSNDPSQPQKLGSYRVRAGRFSNTLSNL 60

Query: 61   LPSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLS 120
            LPSISAKLHHS+K  T  G +        S  S+ D    Q+S  + +    AT    LS
Sbjct: 61   LPSISAKLHHSRK--TTSGTSKHAPDAALSGSSSEDASRSQISLSRQITPPEATA---LS 115

Query: 121  DLTPPQENGKLVHFPDTTNYMLNP--PRSSNDSFQFN-------------RSRNNTVSSQ 165
             +   Q  G L   P+ T+    P   R+S DSF F+             R+RNNTVSSQ
Sbjct: 116  SVDSSQLGGPL---PEDTSSFFAPLGARNSGDSFSFSAANNGIHPSNPLSRTRNNTVSSQ 172

Query: 166  ITSLSSLQPNTQTNANNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTITPVPS 225
            +TSLS + P T   A +LW++ ++P E                 N +  ++ +  +PV  
Sbjct: 173  VTSLSGM-PQT---AGSLWSTNTSPNEQHVLSST----------NAMNTASFSAASPVNE 218

Query: 226  YYEPSLSQQKSETLNN------TLTVPS---SNVWGNNRQRSHSNTSSLYVDAQFYDQEA 276
            Y   +    K  T+ N      +LTVP+    N+WG  RQRSHSN SS+Y DA  YD   
Sbjct: 219  YSSNTYFDVK--TVGNPPNNSSSLTVPAPANGNIWGA-RQRSHSNASSIYTDAPVYDNIG 275

Query: 277  --RSRATSSYTISQQPL------------SQEFPSVGDEVDPRAINWVSMETTVPTINQI 322
              RSRA++      QP             S   P+V D++DPR+INWV+ + TVP INQI
Sbjct: 276  VNRSRASTFGLGLDQPQIILNNAPPARQHSPPTPAVADDIDPRSINWVTTDPTVPAINQI 335

Query: 323  NNLLPTNTITISNVFXXXXXXXXXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALVE 382
            + LLPTNT++ISNV+            INLTSTSLATLC K+G VIS+RT K +N+A+VE
Sbjct: 336  STLLPTNTVSISNVYSLQQQQPQLSNAINLTSTSLATLCLKFGNVISARTLKRINMAIVE 395

Query: 383  FANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHHFNXXXXXXXXXXXXXXXXXXXX 442
            F +VESAMRAK+ L GK+VS++G PS VSFAK+LPMH                       
Sbjct: 396  FDSVESAMRAKEALHGKEVSLVGAPSCVSFAKVLPMHQ--QPMSSNQPIASGPGVSGPQS 453

Query: 443  XXXXXXYNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVSNSTGNTYSYPXXXXXXXXXXXX 502
                  YNG+VT QQQGN+SVPV    ++ QQ    + N   N  S              
Sbjct: 454  LLQEQLYNGAVTLQQQGNISVPVLGGCTRSQQQQPQMQNLQQNVSSSHSTNTGANHSTAN 513

Query: 503  XXXXXXXXXEKEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTN 562
                     EKE CPFPLPPP++S     LED ++SF T  D  Q   ++NN I   GT+
Sbjct: 514  QNSSSHSTAEKEHCPFPLPPPRVSEYTQALEDTVNSFGTSHDSTQTRHVVNNAIKCSGTS 573

Query: 563  DTMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGN 622
            DT +FGPLP+PL +++FDAPKLRE+RK ID N +++LE+EQLA+ MLDELPEL SDYLGN
Sbjct: 574  DTADFGPLPDPLPNREFDAPKLREIRKAIDGNMMTELEIEQLAITMLDELPELCSDYLGN 633

Query: 623  TIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVN 682
            TI QKLFE SS ++KDIMLR+T+ +LTSMGVHKNGTWACQK+ITMA TPRQ  LV++GV 
Sbjct: 634  TIAQKLFEHSSTVIKDIMLRQTNTFLTSMGVHKNGTWACQKIITMADTPRQKALVAKGVE 693

Query: 683  DYCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDI 742
             YCTPLFNDQFGNYVIQCVLKFGFPWN+FIF+ IISNFW + QNRYGARAVRACLEAHDI
Sbjct: 694  KYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFEHIISNFWTIAQNRYGARAVRACLEAHDI 753

Query: 743  VTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRH 802
            +T EQ LVLSAMIV YSEYLA+N+NG LL+TWFLDTC LP+RH+ILA +L+ N+ +LC H
Sbjct: 754  ITREQLLVLSAMIVLYSEYLATNSNGALLVTWFLDTCTLPHRHTILAPKLVSNLAELCCH 813

Query: 803  RLASLTVLKILNYRGDDEARKILFEEIFGKLDSKEPPKVLTQILTDANYGPTFIYKILSM 862
            RLASLTVLK+LNYRGD++A++ + E +FGK D+   P++L Q+L+D+NYGPTF+YK+LSM
Sbjct: 814  RLASLTVLKLLNYRGDEKAKRFILESLFGKKDNTTVPQILYQVLSDSNYGPTFVYKVLSM 873

Query: 863  PLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGLAPTSAXXXXXXXXXXXXXXXXX 922
             LLE +IR HV++QVRK+LME   S Q HRRLM+EVGL    A                 
Sbjct: 874  SLLEGDIRVHVVQQVRKVLMEITTS-QNHRRLMDEVGLG-GGAVSSTVTNSSSTGSKHRP 931

Query: 923  XXXXVYNPADANPSHMRGMSVSSVRSNGSRHNTXXXXXXXXXXXXXXXXXXXXXXXXXXX 982
                V+N    N  HMR +SV S  S GSR                              
Sbjct: 932  SISHVFN--MDNTGHMRNVSVGSAMSGGSRPRALSNSGLSAMPLSNPNTNGIVSGQVPP- 988

Query: 983  XMNNASTNSINAGYYNYPGMFPGSFGPPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLP 1042
                A   ++  GYYNYPG+FP S       N  Y +N DDL+SQF+ML L N T +SLP
Sbjct: 989  ---QAQQMAVPGGYYNYPGVFPVS-----SSNRGYSVNGDDLASQFEMLGLQNNTQISLP 1040

Query: 1043 QLSV 1046
            QLS+
Sbjct: 1041 QLSM 1044

>CAGL0M09108g 910473..913802 similar to sp|P47135 Saccharomyces
           cerevisiae YJR091c suppresses the high-temperature
           lethality of TUB2-150, hypothetical start
          Length = 1109

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/921 (56%), Positives = 630/921 (68%), Gaps = 74/921 (8%)

Query: 16  NIPEVIDPGITIPIYDDD--ELDTQQTQKLGSYRARAGKFSNTLSNLLPSISAKLHHSKK 73
           NIPEVIDPGITIPI+++D   +  +Q QKLGSYRARAGKFSNTLSNLLPSISAKLHHSKK
Sbjct: 7   NIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAGKFSNTLSNLLPSISAKLHHSKK 66

Query: 74  NGTVHGKNGEFSPTNSSSGSTVDLKAQ----------------------QVSPLKP--MK 109
            G   G +   S  +SS  +  +L A+                       + P +P  ++
Sbjct: 67  QGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQGMPSMTAAVAADMGPPRPAHVE 126

Query: 110 NFTATTTGNLSDLTPPQENGKLVHFPDTTNYMLNPPRSSNDSF------QFNRSRNNTVS 163
            F+A       + TPP++  KLVHFP++T Y+++ PR+SNDSF      Q +R+RNNT+S
Sbjct: 127 GFSARGAAQ-DNTTPPRDADKLVHFPESTEYLISRPRTSNDSFGNNLPRQISRTRNNTMS 185

Query: 164 SQITSLSSLQP----NTQTNANNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNT 219
           SQITS+SS+ P    NT  N N+         +              N  N + M     
Sbjct: 186 SQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQQQQQQQQQQMVPQINTYNAMDMGQQ-- 243

Query: 220 ITPVPSYYEPSLSQQKSETLNNTLTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEARSR 279
               P+Y + +++QQ      N LTV  +N W +NR RSHSN SS+Y DA  YD   RSR
Sbjct: 244 ----PNYGD-TMNQQMG---GNNLTV--NNAWNSNRPRSHSNASSIYTDAPQYDTVGRSR 293

Query: 280 ATSSYTISQQPLSQEFPSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTITISNVFXX 339
           A SSY       +   P V DEVDPR++NWV+ +  VP INQI+NLLPTNTI+ISNVF  
Sbjct: 294 AASSYAHG----NSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNTISISNVFPL 349

Query: 340 XXXXXXXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGK 399
                     INLTS SLATLCSKYGEVIS+RT +G+N+ALVEF +V+SA+RA   LQGK
Sbjct: 350 QQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSAIRALDALQGK 409

Query: 400 DVSVIGTPSNVSFAKILPMHHFNXXXXXXXXXXXXXXXXXXXXXXXXXXYNGSVTFQQQG 459
           +VS+IG PS VSFAKILPMH+                             NG+VTF QQG
Sbjct: 410 EVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQLNNGAVTFHQQG 469

Query: 460 NVSVPVFKQYSQYQQPFVNVSNSTGNTYSYPXXXXXXXXXXXXXXXXXXXXXEKEQCPFP 519
           N+S+PVF Q +QY     N  N+  N  S                       +KEQCPFP
Sbjct: 470 NISIPVFNQ-NQYS----NGQNTNNNASS---------------HPGTSSSSDKEQCPFP 509

Query: 520 LPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTNDTMNFGPLPEPLTSKDF 579
           LPPP LS +KS+LE ++  F++  D  Q+ +LINN +  K T+D  NFGPLP  +++K F
Sbjct: 510 LPPPPLSGKKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNKQF 569

Query: 580 DAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDI 639
           DAPKLRELRK ID+N++SD+E+EQLA+ MLDELPELSSDYLGNTIVQKLFE SSDI+KDI
Sbjct: 570 DAPKLRELRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDI 629

Query: 640 MLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ 699
           MLRKT KYL SMGVHKNGTWACQK+IT A TPRQIKLV++G+ DYCT LFNDQFGNYVIQ
Sbjct: 630 MLRKTGKYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYVIQ 689

Query: 700 CVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYS 759
           CVLKFG+PWN FIF+SI+SNFW +VQNRYGARAVRACLEAHDIVT EQTLVLSAMIV Y+
Sbjct: 690 CVLKFGYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVIYA 749

Query: 760 EYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDD 819
           EYL +N+NGTLL+TWFLDTCVL NRHSILA RL+ +IVDLCRHRLASLT+LKILNYRGDD
Sbjct: 750 EYLTTNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRGDD 809

Query: 820 EARKILFEEIFGKLDSKEPPKVLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRK 879
            ARK +   +FG  ++ EP ++L QIL D NYGPTF+YK+LSMPLLED+IR H+I QVRK
Sbjct: 810 AARKTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIAQVRK 869

Query: 880 ILMEHGLSQQQHRRLMEEVGL 900
           ILME   + Q HRRLMEEVGL
Sbjct: 870 ILMESN-TAQHHRRLMEEVGL 889

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 4/51 (7%)

Query: 996  YYNYPGMFPGSFGPPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLPQLSV 1046
            Y NYPG+FP   G P   N +Y +N DDL S+ DML L NGTHLSLPQLSV
Sbjct: 1005 YMNYPGVFP--MGYPNN-NSSYGIN-DDLVSKLDMLTLGNGTHLSLPQLSV 1051

>AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C (PUF2)
            - SH] complement(128699..131872) [3174 bp, 1057 aa]
          Length = 1057

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1084 (48%), Positives = 671/1084 (61%), Gaps = 132/1084 (12%)

Query: 14   LHNIPEVIDPGITIPIYDDDELDTQ-------QTQKLGSYRARAGKFSNTLSNLLPSISA 66
            L  IPEVIDPGIT+PIY++D +  Q       Q QKLGSYRARAG+FSNTLSNLLPSISA
Sbjct: 36   LSKIPEVIDPGITVPIYEEDIVGDQGGTDVDGQPQKLGSYRARAGRFSNTLSNLLPSISA 95

Query: 67   KLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLSDLTPPQ 126
            KLHH++K GT     G+ +P+ + + +                  T         +TPPQ
Sbjct: 96   KLHHNRKGGT-----GKVAPSAADADAG--------------AGSTVVAGEMAGSITPPQ 136

Query: 127  ENGKLVHFPDTTNYMLNPPRSSNDSFQFN----------------RSRNNTVSSQITSLS 170
            +   +V FP+   Y L  PR+S++S+ +                 R+RNNTVSSQITSLS
Sbjct: 137  DLHNVVSFPEP--YGLAQPRTSSESYTYGSGYSGHLQPTVSNPATRTRNNTVSSQITSLS 194

Query: 171  SLQPNTQTNANNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTITPVPSYYEPS 230
            S+      + +N+WT+  + P           FN    P+  G SN         YY+  
Sbjct: 195  SMGQLGTPSTSNIWTNNGSGPADPISNMLTTQFNPIPLPD-FGQSN---------YYD-V 243

Query: 231  LSQQKSETLNNTLTVPSS-NVWGNNRQRSHSNTSSLYVDAQFYD---QEA---RSRATS- 282
            ++QQ+     N+L VPS  N++   R RS SN SS+Y DA F     Q+A   RSRA++ 
Sbjct: 244  ITQQQPPQSTNSLNVPSGGNIFWEKRTRSQSNASSIYADALFDTSGMQQAPPTRSRASTF 303

Query: 283  SYTISQQ----------PLSQEFPSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTIT 332
            + T + Q          PLS   P V DEVDPR++NWVS + TVP INQI++LLP+NTI+
Sbjct: 304  ASTTAHQNMLNTPVMSAPLSAG-PIVQDEVDPRSLNWVSTDPTVPPINQISHLLPSNTIS 362

Query: 333  ISNVFXXXXXXXXXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALVEFANVESAMRA 392
            ISN+F            +NLTSTSLATLC  +G+V+S+RT K +N+A+VEF  V++AMRA
Sbjct: 363  ISNIFPLQQQQPHFSNAVNLTSTSLATLCLNFGKVLSARTLKTVNMAIVEFETVDAAMRA 422

Query: 393  KQDLQGKDVSVIGTPSNVSFAKILPMHHFNXXXXXXXXXXXXXXXXXXXXXXXXXXYNGS 452
            K  L GKDVS++G PS V FAK+LPMH                             ++G+
Sbjct: 423  KDALNGKDVSLVGAPSAVFFAKVLPMHQ-----QASTLPPIQTNPNGPQSLLQEQLFSGA 477

Query: 453  VTFQQQGNVSVPVFKQYSQYQQPFV---------NVSNSTGNTYSYPXXXXXXXXXXXXX 503
            VTF QQ  +S+PVF       Q  +         +V+     T+S+              
Sbjct: 478  VTFHQQNGISIPVFNASGAGSQHHLASQQSQSQSHVTKHPNLTHSF-------------- 523

Query: 504  XXXXXXXXEKEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTND 563
                    EKE CPFP+PP  +  Q S L DII SF  + D+ Q++ ++++ I Y GT+D
Sbjct: 524  TSLSHTPSEKEHCPFPMPPADIKDQVSLLIDIIRSFGVEHDQDQVQHIVSDAIAYNGTSD 583

Query: 564  TMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNT 623
            T +FGPLPEPL  ++FDAPKLRELRK +D + VSDLE+EQLA+ MLDELPELSSDYLGNT
Sbjct: 584  TADFGPLPEPLPHREFDAPKLRELRKLMDTDNVSDLEIEQLAVAMLDELPELSSDYLGNT 643

Query: 624  IVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVND 683
            IVQKLFE SS I+KDIMLR+TSKYLTSMGVHKNGTWACQKM TMA TPRQ+ LV++GV  
Sbjct: 644  IVQKLFENSSTIIKDIMLRQTSKYLTSMGVHKNGTWACQKMTTMADTPRQMDLVAKGVYK 703

Query: 684  YCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIV 743
            YCTPLFNDQFGNYVIQCVLKFGFPWN+FIF+SI+SNF  +VQNRYGARAVRACLEAHDI+
Sbjct: 704  YCTPLFNDQFGNYVIQCVLKFGFPWNNFIFESIVSNFCTIVQNRYGARAVRACLEAHDII 763

Query: 744  TTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHR 803
            T EQ LVLSAMI+ Y+EYLA+N+NG LL+TWFLDT  LPNRHSIL ++LLP+IV+LC  R
Sbjct: 764  TQEQLLVLSAMILLYAEYLATNSNGALLVTWFLDTSSLPNRHSILTEKLLPHIVELCCDR 823

Query: 804  LASLTVLKILNYRGDDEARKILFEEIFGKLDSKE-PPKVLTQILTDANYGPTFIYKILSM 862
            LASLT+LKILN+R D+ A++++ + IFG LDS   PP+ L Q+L+D NYG TF+YKILS 
Sbjct: 824  LASLTILKILNFRSDEHAKRVILDTIFGALDSDSGPPQTLYQLLSDTNYGSTFVYKILST 883

Query: 863  PLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGLAPTSAXXXXXXXXXXXXXXXXX 922
            PLLE EIR+HVI+QVR +LMEH  S  QHRRLMEEVG A  S+                 
Sbjct: 884  PLLEGEIRNHVIQQVRHVLMEH--SGPQHRRLMEEVGFA-NSSTTGSSGNNSSASSKHRP 940

Query: 923  XXXXVYNPADANPSHMRGMSVSSVRSNGSRHNTXXXXXXXXXXXXXXXXXXXXXXXXXXX 982
                VY  A  +  HMR +SVSS RS+GS   T                           
Sbjct: 941  AVSHVY--ATDSSGHMRTVSVSSNRSSGSVPRT----------------LTSSQSHSAAT 982

Query: 983  XMNNASTNSINAGYYNYPGMFPGSFGPPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLP 1042
               +  ++S   GY NYPG FP +       +G++ M  DDL++QFD+L +NN   + LP
Sbjct: 983  SQQSPGSSSTVCGY-NYPGTFPTN-------SGSFSMAADDLATQFDILNINNNAQMPLP 1034

Query: 1043 QLSV 1046
            Q+S+
Sbjct: 1035 QISM 1038

>KLLA0E05984g 541992..545276 similar to sp|P47135 Saccharomyces
            cerevisiae YJR091c JSN1 suppresses the high-temperature
            lethality of TUB2-150, start by similarity
          Length = 1094

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1118 (47%), Positives = 672/1118 (60%), Gaps = 120/1118 (10%)

Query: 1    MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDD-------ELDTQ--QTQKLGSYRARAG 51
            ME+++    +   L NIPEVIDPG+TIPIY+DD        +D    Q QKLGSYR++AG
Sbjct: 1    MEKRKASGDSMSGLSNIPEVIDPGVTIPIYEDDFTLSGGNNIDQLPIQPQKLGSYRSKAG 60

Query: 52   KFSNTLSNLLPSISAKLHHSKKN--GTVHGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMK 109
            KFSNTLSNLLPSISAKLHH+KK   G+     G  S   SS  +T +  ++Q S    + 
Sbjct: 61   KFSNTLSNLLPSISAKLHHNKKGSKGSSAVGEGNHSGELSSDDATAN-TSEQTSKSGSIA 119

Query: 110  NFTATTTGNLSDLTPP--QENGKLVHFPDTTNYML-NPPRSSNDSFQF------------ 154
                +  G++   TPP   +  + +H PD+++ ++ + PR S DSF F            
Sbjct: 120  QINLSVPGHI---TPPLDVDYNQAIHLPDSSSLLVPSQPRLSGDSFTFATNSVPLQPTAS 176

Query: 155  ---NRSRNNTVSSQITSLSSLQPNTQTNANNLW--TSVSNPPEAXXXXXXXXXFNSNNNP 209
               +R+RNNTVSSQIT  S++      N  N+W    +S  P +           + NN 
Sbjct: 177  NTISRTRNNTVSSQITGPSNVN-GLVPNVGNVWFPNDMSVNPMSPPGIQTTTNPTNVNNN 235

Query: 210  NILGMSNLNTITPVPSYYEPSLSQQKSETLN------NTLTVPSSNVWG----------- 252
            N    S+L      P  Y P  +      LN      N L VP +   G           
Sbjct: 236  NNNNNSHL-----APGTYSPYEATGNYFDLNTSSNNINNLGVPGATTAGAHQFQSQQIGG 290

Query: 253  --NNRQRSHSNTSSLYVDAQFYDQ-EARSRATSSYTI--SQQP-----LSQEFPSVGDEV 302
              N+R RS SN SS+Y DA  YDQ + RSRA S++ I  S  P      +   P V D++
Sbjct: 291  VWNSRPRSQSNASSIYTDAPTYDQMDTRSRA-STFIIPPSMDPQLKATAASTNPIVQDDM 349

Query: 303  DPRAINWVSMETTVPTINQINNLLPTNTITISNVFXXXXXXXXXXXTINLTSTSLATLCS 362
            D R+INWV+ + +VP+IN I+NLLPTNTI+ISNVF           T+NLTSTSLATLC 
Sbjct: 350  DSRSINWVTTDPSVPSINHISNLLPTNTISISNVFSLQQQQPHLSNTVNLTSTSLATLCL 409

Query: 363  KYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHHFN 422
            K+G VIS+RT +G+N+A+VEFA+VE+A++AK+ L GK+VS++G PS VSFAK+LPMH   
Sbjct: 410  KFGTVISARTLRGVNMAIVEFASVEAAIKAKEALNGKEVSLVGAPSTVSFAKVLPMHQQL 469

Query: 423  XXXXXXXXXXXXXXXXXX-XXXXXXXXYNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVSN 481
                                       ++G+V FQQQGNVSVP F               
Sbjct: 470  PQTQQTQQQNNHQSTAINPQSLLQEQLFSGAVQFQQQGNVSVPSF--------------- 514

Query: 482  STGNTYSYPXXXXXXXXXXXXXXXXXXXXXEKEQCPFPLPPPKLSTQKSKLEDIIHSFDT 541
             TGNT++                       EKEQCPFPLPPP      + L D I+ F  
Sbjct: 515  -TGNTHA-----QSSSQAFVSPTNPSSSNSEKEQCPFPLPPPSFKENITLLNDTINKFGI 568

Query: 542  KADRLQLEALINNGINYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNIDANTVSDLEL 601
              D  Q + +I N I Y GT+DT +FGPLPEPL++++FDAP+LRELRK+ID+  +SDLE+
Sbjct: 569  NYDTSQYQHIIANAIEYNGTSDTTDFGPLPEPLSTREFDAPRLRELRKSIDSGQMSDLEI 628

Query: 602  EQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWAC 661
            EQL L MLDE+PELSSDYLGNTIVQKLFE +S ++KDIMLRKTS YLTSMGVHKNGTWAC
Sbjct: 629  EQLVLAMLDEIPELSSDYLGNTIVQKLFEHASSVIKDIMLRKTSVYLTSMGVHKNGTWAC 688

Query: 662  QKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNFW 721
            QKMIT A TPRQ   V+ GV  YCTPLFNDQFGNYVIQCVLKFGFPWN+FIF++I+SNFW
Sbjct: 689  QKMITNADTPRQKMYVANGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFENIVSNFW 748

Query: 722  IVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVL 781
             +VQNRYGARAVRACLEAHDI+T EQ L+LSAMIV + +YLA+N+NG LL+TWFLDTC L
Sbjct: 749  NIVQNRYGARAVRACLEAHDIITQEQLLLLSAMIVFFVKYLATNSNGALLVTWFLDTCTL 808

Query: 782  PNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEIFGKLD---SKEP 838
            P RHSILA+ LLPNI +L  H+LASLT+LKILNYRGD+ A++ + + IFG +D   S +P
Sbjct: 809  PKRHSILAEALLPNIFELGCHKLASLTILKILNYRGDEVAKRAILDTIFGPMDNEISSKP 868

Query: 839  PKVLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRKILMEHGLSQQQHRRLMEEV 898
            P++L Q+L+D NYGP+F+YK+LS+P+LE ++R HVI+QVR IL     +  QHRRL+EEV
Sbjct: 869  PQLLYQLLSDTNYGPSFVYKVLSIPMLEGDVRHHVIEQVRYILTTES-NITQHRRLLEEV 927

Query: 899  GL-----APTSAXXXXXXXXXXXXXXXXXXXXXVYNPADANPSHMRGMSVSSVRSNGSRH 953
            GL      P++A                          + +P HMR +SV+SVRS  SR 
Sbjct: 928  GLNAINNQPSTAQTKPRMSISHVF-------------GNDHPQHMRTVSVNSVRSASSRP 974

Query: 954  NTXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNNASTNSIN-----AGYYNYPGMFPGSFG 1008
                                           +     SI+     A YY YPGMFP S  
Sbjct: 975  RASSNAQSQQQPIQSSQVQAQLPQQSQSQPQHQPQQASISGISGQASYYTYPGMFPAS-- 1032

Query: 1009 PPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLPQLSV 1046
             P   + +     DDL S FDML  NNGT +SLPQL++
Sbjct: 1033 QPYQYSTSTSGLNDDLVSNFDMLTFNNGTQISLPQLTM 1070

>CAGL0H08778g 854147..857344 some similarities with tr|Q12221
           Saccharomyces cerevisiae YPR042c PUF2 or sp|P47135
           Saccharomyces cerevisiae YJR091c JSN1, hypothetical
           start
          Length = 1065

 Score =  546 bits (1406), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 283/624 (45%), Positives = 394/624 (63%), Gaps = 34/624 (5%)

Query: 289 QPLSQEFPSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTITISNVFXXXX----XXX 344
           Q   Q  P V D+VDP  I+WVS    +P  NQ   LLPTNT+ ISNVF           
Sbjct: 316 QQQEQLTPVVADDVDPALISWVSTNINIPASNQTGFLLPTNTLCISNVFPLQTPGEYGNN 375

Query: 345 XXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDLQGKDVSVI 404
                INLTST LA+LCS+YG+V+SSRT + LNIALVEF  V+SA+ A + LQGK++S++
Sbjct: 376 NLSHPINLTSTLLASLCSQYGKVLSSRTLRHLNIALVEFETVDSAITALESLQGKELSLL 435

Query: 405 GTPSNVSFAKILPMHHFNXXXXXXXXXXXXXXXX--XXXXXXXXXXYNGS-VTFQQQGNV 461
           G P + +FAKIL +                                Y GS  TF  Q N+
Sbjct: 436 GFPCSAAFAKILSVSDGVGLGEHTLSVKENSTRKPLLHEVFLNTALYQGSNSTFTLQSNL 495

Query: 462 SVPVFKQYSQYQQPFVNVSNSTGNTYSYPXXXXXXXXXXXXXXXXXXXXXEKEQCPFPLP 521
             PV    SQ  +  ++  N++    S                       + + CPF LP
Sbjct: 496 QPPVV--ISQPSKENISTKNASNVHLS---------------------SADNDPCPFKLP 532

Query: 522 PPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTN--DTMNFGPLPEPLTSKDF 579
           P  L+ +    +DII  F+ K D   +  ++NN +  KG N  D  NFGP+P+    + F
Sbjct: 533 PAILADKLDDFQDIIKKFNIKYDVDIVNHMLNNSLQ-KGPNACDVNNFGPIPQQSVHRQF 591

Query: 580 DAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDI 639
           DAPKLRELRK  D+N++S +E+EQLA+ MLDELPEL  DY GNTI+QKL++  S I+ D+
Sbjct: 592 DAPKLRELRKAFDSNSLSQVEMEQLAIAMLDELPELCLDYSGNTIIQKLYDNCSPIIVDL 651

Query: 640 MLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ 699
           MLR++ KYLTSMG+HKNGTW  QK+I + KTPRQ+  +++G+ DYCT LFNDQ+GNYVIQ
Sbjct: 652 MLRESHKYLTSMGIHKNGTWVSQKIIKVVKTPRQMDFITKGIQDYCTALFNDQYGNYVIQ 711

Query: 700 CVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYS 759
            VL FGFPWN FIF++I+SNFW++V N++G RAVRACLEA+  ++ EQ L+L +MI+ YS
Sbjct: 712 GVLTFGFPWNSFIFENIMSNFWVIVDNKFGVRAVRACLEANGHMSKEQELLLCSMIILYS 771

Query: 760 EYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDD 819
           EYL+++N GTLL+TW+LD+C    +++++   L+P+IV+LC HRL SLTVLK+LN R D 
Sbjct: 772 EYLSTSNTGTLLVTWYLDSCTFEEKYAMIISSLIPHIVELCSHRLGSLTVLKLLNLRIDQ 831

Query: 820 EARKILFEEIFGKLDSKEPPKVLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRK 879
             +  +   IFG L+  +P + L +IL D + G +F+YKI+S   LE E +SH++++++ 
Sbjct: 832 CVKDSILTAIFGDLNDNKPSENLIEILKDNHNGGSFLYKIISSRFLESERKSHLVEKIKI 891

Query: 880 ILMEHGLSQQQHRRLMEEVGLAPT 903
           +L+   L+  Q++RL+EEVGL  T
Sbjct: 892 VLLNSNLA-HQNKRLIEEVGLTST 914

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%), Gaps = 4/42 (9%)

Query: 33 DELDTQQTQKLGSYRARAGKFSNTLSNLLPSISAKLHHSKKN 74
          D+LD     K  SYR++  +F++TL+++LPSISAK  HS+KN
Sbjct: 31 DDLDES---KRISYRSKKERFASTLNSILPSISAKF-HSRKN 68

>Scas_672.26*
          Length = 1079

 Score =  521 bits (1342), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/395 (57%), Positives = 310/395 (78%), Gaps = 5/395 (1%)

Query: 512 EKEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKG-TNDTMNFGPL 570
           EKE+CPF LPPP     +   + II SF+   D++Q+  ++ N +  K  T+D  N+GPL
Sbjct: 518 EKEKCPFHLPPPPFKDNQMLFQQIISSFNVDYDQVQVNHILMNALESKTRTSDPNNYGPL 577

Query: 571 PEPLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFE 630
           P PL +++FD P+LRE+RKNID+N+++ +E+EQLA+ MLDE+PELSSDYLGNTI+QKL++
Sbjct: 578 PTPLLNREFDTPRLREIRKNIDSNSLTTIEIEQLAITMLDEIPELSSDYLGNTIIQKLYD 637

Query: 631 KSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFN 690
            SSDI+++I+L+KT+KYL S+GVHKNGTW CQKMI MA+TPR+++++++G+ DYCTPLFN
Sbjct: 638 NSSDIIREIILQKTAKYLCSIGVHKNGTWVCQKMIKMAQTPRKMQIITDGIQDYCTPLFN 697

Query: 691 DQFGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLV 750
           DQFGNYVIQCVLKFGFPWN FIF++II NFW + QNRYGARA+RACLE  D++T EQ+LV
Sbjct: 698 DQFGNYVIQCVLKFGFPWNTFIFENIIDNFWTIAQNRYGARAIRACLETQDVITQEQSLV 757

Query: 751 LSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVL 810
           +S MI+ Y EYLA ++NGTLL++W LDT  LPN+H IL ++L+P++  LC H+L SLTVL
Sbjct: 758 ISTMIILYGEYLAVDDNGTLLISWLLDTSPLPNKHVILTQKLIPHLKSLCCHKLGSLTVL 817

Query: 811 KILNYRGDDEARKILFEEIFGKLDS---KEPPKVLTQILTDANYGPTFIYKILSMPLLED 867
           K+LNYRG D A+ ++ E +FGK+D+    E P +L ++L D+NYGP F+YK L   + + 
Sbjct: 818 KLLNYRGSDSAKNLILETVFGKVDNNGIHESPSILIELLNDSNYGPNFVYKTLISRVFDG 877

Query: 868 EIRSHVIKQVRKILMEHGLSQQQHRRLMEEVGLAP 902
             + H+I+QV  +L+E   +  QHRRLMEEVGL P
Sbjct: 878 NAKHHIIRQVHDLLLEINPT-HQHRRLMEEVGLIP 911

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 208/426 (48%), Gaps = 45/426 (10%)

Query: 18  PEVIDPGITIPIYDDDELDTQQTQKLGSYRARAGKFSNTLSNLLPSISAKLHHSKKNGTV 77
           PE ++   T     +  +  + TQKLGSYR +AGKFS T+ N+LPS+SAKLHHSKKN   
Sbjct: 27  PETLNSATTADESTNYTVAQRSTQKLGSYRTKAGKFSTTIGNILPSLSAKLHHSKKNEKS 86

Query: 78  HGKNGEFSPTNSSSGSTVDLKAQQVSPLKPMKNFTATTTGNLSD--------LTPPQENG 129
             +N  +S +NSSS S  ++  +        K   +T  G+  D                
Sbjct: 87  K-ENDPYSSSNSSSESNTNIANKTHHKYINKKVEASTVQGSFVDNGSVDFRSTVEKNTTN 145

Query: 130 KLVHFPDTTNYMLNPPRSS-NDSFQFN--------RSRNNTVSSQITSLSSLQPNTQTNA 180
            + +   +T YML+   +S     QFN        R R NT+SSQI+ +SS+  N     
Sbjct: 146 TMFNIDGSTKYMLDLEGTSPQTQRQFNNLSMIPGLRQRENTLSSQISDMSSIPGNNTF-- 203

Query: 181 NNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTITPVPSYYEPSLSQQKSETLN 240
             LW  V++P  +          +  N       SNL T+          L      +LN
Sbjct: 204 --LW-PVTDPATSNLLATENTEADGPN-------SNLGTLI---RSMTNELIDSSHSSLN 250

Query: 241 NTLTVPSSNVWGNN-----RQRSHSNTSSLYVDAQFYDQEARSRATSSYTISQQPLSQEF 295
             +    +N+         ++R+ S    ++   +  + E R   T+   I QQ   Q+ 
Sbjct: 251 KNIGYDENNITNTTGNLDVKRRAQSINYHMFDGPKLQNNERRRANTTFVPIQQQ---QDV 307

Query: 296 PSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTITISNVFXXXXXXXXXXXTI--NLT 353
             + D VDP ++NWVS    VP+ N++ NL PTNTI  +N+F            +   +T
Sbjct: 308 TLLLDNVDPMSLNWVSASPAVPSANRVGNLGPTNTILFTNIFPVPQHSLQAQPMVPAPIT 367

Query: 354 STSLATLCSKYGEVISSRTFKGLN--IALVEFANVESAMRAKQDLQGKDVSVIGTPSNVS 411
           S SLA+LCSK+G VISSR   GL   +ALVEF ++E+A+   ++LQG+D+S  G P+ ++
Sbjct: 368 SASLASLCSKFGHVISSRILGGLEFPLALVEFNSIEAAIHTMENLQGRDLSGAGVPTILA 427

Query: 412 FAKILP 417
           FAKILP
Sbjct: 428 FAKILP 433

>YPR042C (PUF2) [5475] chr16 complement(650430..653657) Protein that
           binds mRNA, has similarity to Jsn1p [3228 bp, 1075 aa]
          Length = 1075

 Score =  461 bits (1186), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 288/382 (75%), Gaps = 17/382 (4%)

Query: 533 EDIIH---SFDTKADRLQLEALINNGINYKGTNDTMNFGPLPE-----PLTSKDFDAPKL 584
           +DI+H   SF  + D L+L  L+ N +  KG +DT  FGPLPE     P     FDAPKL
Sbjct: 494 KDILHTISSFKLEYDHLELNHLLQNALKNKGVSDTNYFGPLPEHNSKVPKRKDTFDAPKL 553

Query: 585 RELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKT 644
           RELRK  D+N++S +E+EQLA+ MLD+LPELSSDYLGNT++QKLFE SS+I++DIMLRK 
Sbjct: 554 RELRKQFDSNSLSTIEMEQLAIVMLDQLPELSSDYLGNTVIQKLFENSSNIIRDIMLRKC 613

Query: 645 SKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKF 704
           +KYLTSMGVHKNGTW CQK+I MA TPRQI LV+ GV+DYCTPLFNDQFGNYVIQ +LKF
Sbjct: 614 NKYLTSMGVHKNGTWVCQKIIKMANTPRQINLVTSGVSDYCTPLFNDQFGNYVIQGILKF 673

Query: 705 GFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLAS 764
           GFPWN FIF+S++S+FW +VQNRYG+RAVRACLEA  I+T  Q L ++++I+  S YLA+
Sbjct: 674 GFPWNSFIFESVLSHFWTIVQNRYGSRAVRACLEADSIITQCQLLTITSLIIVLSPYLAT 733

Query: 765 NNNGTLLLTWFLDTCVLPNRHSILAKRLL-PNIVDLCRHRLASLTVLKILNYRGDDE--- 820
           + NGTLL+TW LDTC LPN++ IL  +L+  N+V LC H+L SLTVLKILN RG +E   
Sbjct: 734 DTNGTLLITWLLDTCTLPNKNLILCDKLVNKNLVKLCCHKLGSLTVLKILNLRGGEEEAL 793

Query: 821 ARKILFEEIF-GKLDSKEPPKVLTQILTDANYGPTFIYKILSMPLLEDEIRSHVIKQVRK 879
           ++  +   IF G + S     +L QIL + NYGPTFIYK+L+  +L++ +R   I ++R+
Sbjct: 794 SKNKIIHAIFDGPISSDS---ILFQILDEGNYGPTFIYKVLTSRILDNSVRDEAITKIRQ 850

Query: 880 ILMEHGLSQQQHRRLMEEVGLA 901
           +++   ++ Q  R+L+EEVGL+
Sbjct: 851 LILNSNINLQS-RQLLEEVGLS 871

 Score =  229 bits (583), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 177/459 (38%), Positives = 241/459 (52%), Gaps = 91/459 (19%)

Query: 1   MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDD-ELDTQQT------------------- 40
           M+ KR     NG L NIPEVIDPGITIPIY++D   DT+                     
Sbjct: 1   MDNKR---LYNGNLSNIPEVIDPGITIPIYEEDIRNDTRMNTNARSVRVSDKRGRSSSTS 57

Query: 41  -QKLGSYRARAGKFSNTLSNLLPSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKA 99
            QK+GSYR RAG+FS+TL+NLLPSISAKLHHSKK+  V        PT+S+  S   L +
Sbjct: 58  PQKIGSYRTRAGRFSDTLTNLLPSISAKLHHSKKSTPV----VVVPPTSSTPDS---LNS 110

Query: 100 QQVSPLKPMKNFTATTTGNLSDLTPPQENGKLVHFPDTTNYMLNPPRSSNDSFQFNRSRN 159
              +P     +FT  T                             P S   +    R+RN
Sbjct: 111 TTYAPRVSSDSFTVAT-----------------------------PLSLQSTTTRTRTRN 141

Query: 160 NTVSSQITSLSSLQPNT-QTNANNLWTS------VSNP----PEAXXXXXXXXXFNSNNN 208
           NTVSSQIT+ SSL  +     + N+W++       S+P    P A         F S +N
Sbjct: 142 NTVSSQITASSSLTTDVGNATSANIWSANAESNTSSSPLFDYPLATSYFEPLTRFKSTDN 201

Query: 209 PNILGMSNLNTITPVPSYYEPSLSQQKSETLNNTLTVPSSNVWGNNRQRSHSNTSSLYVD 268
             +   + LN+   +     P++      +  + L  P   +    R +S S T+ +Y D
Sbjct: 202 YTLPQTAQLNSF--LEKNGNPNIWSSAGNSNTDHLNTP---IVNRQRSQSQSTTNRVYTD 256

Query: 269 AQFYDQEARS-------RATSSYTISQQPLSQEFPSVGDEVDPRAINWVSMETTVPTINQ 321
           A +Y Q A++       R   S +IS        P + D+VDP +INW++    VP +NQ
Sbjct: 257 APYYQQPAQNYQVQVPPRVPKSTSIS--------PVILDDVDPASINWITANQKVPLVNQ 308

Query: 322 INNLLPTNTITISNVFXXXXXXXXXXXTINLTSTSLATLCSKYGEVISSRTFKGLNIALV 381
           I+ LLPTNTI+ISNVF            +NLTSTSLATLCS+YG+V+S+RT +GLN+ALV
Sbjct: 309 ISALLPTNTISISNVFPLQPTQQHQQNAVNLTSTSLATLCSQYGKVLSARTLRGLNMALV 368

Query: 382 EFANVESAMRAKQDLQGKDVSVIGTPSNVSFAKILPMHH 420
           EF+ VESA+ A + LQGK++S +G PS VSFA++LPM+ 
Sbjct: 369 EFSTVESAICALEALQGKELSKVGAPSTVSFARVLPMYE 407

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 1022 DDLSSQFDMLALNNGTHLSLP 1042
            D+L+SQFD   + NGT+LSLP
Sbjct: 965  DELNSQFDSFRIANGTNLSLP 985

>Scas_7.1
          Length = 247

 Score =  272 bits (695), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 164/225 (72%), Gaps = 1/225 (0%)

Query: 449 YNGSVTFQQQGNVSVPVFKQYSQYQQPFVNVSNSTGNTYSYPXXXXXXXXXXXXXXXXXX 508
           YNG+VTFQQQGNVS+PVF Q++       N + S  NT +                    
Sbjct: 14  YNGAVTFQQQGNVSIPVFNQHTTSSHGNGNSTGSNNNTITS-TSGNNNGNNNGNNNHSTT 72

Query: 509 XXXEKEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTNDTMNFG 568
              EKE CPFPLPPP ++     L+DII SF T  +  Q+  +++N +NY+GTNDT  FG
Sbjct: 73  HLPEKEHCPFPLPPPSVADNTLTLKDIISSFKTAYNPAQINHIVSNALNYEGTNDTSEFG 132

Query: 569 PLPEPLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKL 628
           PLP+PL +++FDAPKLRELRK IDAN++SDLE+EQLA+ MLDELPELSSDYLGNTIVQKL
Sbjct: 133 PLPDPLATREFDAPKLRELRKMIDANSMSDLEIEQLAVAMLDELPELSSDYLGNTIVQKL 192

Query: 629 FEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQ 673
           FE SS IVKD MLR+T++YLTSMGVHKNGTWACQKMITM+ TPRQ
Sbjct: 193 FEHSSTIVKDTMLRQTNRYLTSMGVHKNGTWACQKMITMSDTPRQ 237

>YGL014W (PUF4) [1959] chr7 (466144..468810) Protein with pumilio
           repeats that is involved with Mpt5p in relocalization of
           Sir3p and Sir4p from telomeres to the nucleolus [2667
           bp, 888 aa]
          Length = 888

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 113/240 (47%), Gaps = 13/240 (5%)

Query: 580 DAPKLRELRKNID--ANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVK 637
           D    R L+K +D   +  +D   E+      D   EL +D  GN ++QKL E+ +   +
Sbjct: 574 DQHGCRFLQKQLDILGSKAADAIFEETK----DYTVELMTDSFGNYLIQKLLEEVTTEQR 629

Query: 638 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYV 697
            ++ + +S +   + ++ +GT A QK+I   KT  + ++V + +  Y   L  D  GN+V
Sbjct: 630 IVLTKISSPHFVEISLNPHGTRALQKLIECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHV 689

Query: 698 IQCVLKFGFPWN-DFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIV 756
           IQ  L+   P N  FIF +I  +   +  +R+G   ++ CL   D  TTEQ   L   ++
Sbjct: 690 IQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCCVLQRCL---DHGTTEQCDNLCDKLL 746

Query: 757 CYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAK---RLLPNIVDLCRHRLASLTVLKIL 813
              + L  +  G  ++ + +      N++    K    L P  ++L  H+  S  + KIL
Sbjct: 747 ALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEKIL 806

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 7/210 (3%)

Query: 626 QKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYC 685
           Q+  E+SS    D +L +    + S+   ++G    QK + +  + +    + E   DY 
Sbjct: 547 QRKIEESSRFA-DAVLDQYIGSIHSLCKDQHGCRFLQKQLDILGS-KAADAIFEETKDYT 604

Query: 686 TPLFNDQFGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQ-NRYGARAVRACLEAHDIVT 744
             L  D FGNY+IQ +L+        +   I S  ++ +  N +G RA++  +E   I T
Sbjct: 605 VELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIEC--IKT 662

Query: 745 TEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRL 804
            E+  ++   +  Y+  L+ + NG  ++   L   + P     +   +  + +D+  HR 
Sbjct: 663 DEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQR-LKPENFQFIFDAISDSCIDIATHRH 721

Query: 805 ASLTVLKILNYRGDDEARKILFEEIFGKLD 834
               + + L++ G  E    L +++   +D
Sbjct: 722 GCCVLQRCLDH-GTTEQCDNLCDKLLALVD 750

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 64/136 (47%), Gaps = 8/136 (5%)

Query: 587 LRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSK 646
           L++ +D  T    + + L   +L  + +L+ D  GN +VQ +  K ++  K     K   
Sbjct: 726 LQRCLDHGTTE--QCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVH 783

Query: 647 YL----TSMGVHKNGTWACQKMITMA--KTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQC 700
            L      + +HK G+   +K++  A    P  +++++ G       L ND +GNYV+Q 
Sbjct: 784 LLKPRAIELSIHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQT 843

Query: 701 VLKFGFPWNDFIFQSI 716
            L      ND++++ +
Sbjct: 844 ALDISHKQNDYLYKRL 859

>Scas_688.28
          Length = 831

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 118/246 (47%), Gaps = 16/246 (6%)

Query: 595 TVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVH 654
           T S  E E +   + DE   LS+D  GN ++QK FE  S   +DI++ +    + ++ + 
Sbjct: 510 TSSPSEREVIFNELRDEAISLSNDVFGNYVIQKFFEFGSVTQRDILVDQFKGKMQNLSLQ 569

Query: 655 KNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWND--FI 712
                  QK +   K  ++++LVSE ++     +  DQ GN+VIQ  ++   P  D  FI
Sbjct: 570 MYACRVIQKALEFIKPDQRLELVSE-LSQCVLQMIKDQNGNHVIQKAIE-CIPMKDLPFI 627

Query: 713 FQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLL 772
             S+  + + +  + YG R ++  LE   +   +QTL+LS +   +  YL  +  G  ++
Sbjct: 628 LDSLHGHIYHLSTHSYGCRVIQRLLEFGSL--EDQTLILSEL-KDFIPYLIQDQYGNYVI 684

Query: 773 TWFLD--------TCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKI 824
              L+        +  + N    +   +  N+V+  +H+ AS  V + + Y G+++ R +
Sbjct: 685 QHILEQQDNNPNVSQEMMNTKQEIVNIVSQNVVEFSKHKFASNVVERAILY-GNEKQRNL 743

Query: 825 LFEEIF 830
           +  +I 
Sbjct: 744 IIRQIL 749

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 70/174 (40%), Gaps = 6/174 (3%)

Query: 657 GTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFG-FPWNDFIFQS 715
           G+   Q  ++   +P + +++   + D    L ND FGNYVIQ   +FG     D +   
Sbjct: 499 GSRFIQHELSTTSSPSEREVIFNELRDEAISLSNDVFGNYVIQKFFEFGSVTQRDILVDQ 558

Query: 716 IISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWF 775
                  +    Y  R ++  LE    +  +Q L L + +      +  + NG  ++   
Sbjct: 559 FKGKMQNLSLQMYACRVIQKALE---FIKPDQRLELVSELSQCVLQMIKDQNGNHVIQKA 615

Query: 776 LDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEI 829
           ++ C+       +   L  +I  L  H      + ++L + G  E + ++  E+
Sbjct: 616 IE-CIPMKDLPFILDSLHGHIYHLSTHSYGCRVIQRLLEF-GSLEDQTLILSEL 667

>Kwal_47.17511
          Length = 707

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 123/283 (43%), Gaps = 34/283 (12%)

Query: 610 DELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAK 669
           D + EL +D  GN ++QKL E+  D  +  +++ +S+    + +  +GT A QK++    
Sbjct: 422 DYVVELMTDSFGNYLIQKLLERVDDNQRLELIKSSSQSFVLISLDPHGTRALQKLVECTS 481

Query: 670 TPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ-CVLKFGFPWNDFIFQSIISNFWIVVQNRY 728
           T  +  ++ E +      L  D  GN+V+Q C+ K     + FIF +  S    +  +R+
Sbjct: 482 TEEEANIIVESLRGSIVELSRDLNGNHVVQKCLQKLKPEDSQFIFDAATSECVKIATHRH 541

Query: 729 GARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSIL 788
           G   ++ CL   D    +Q   L   I+ + + LA++  G  ++ + L T       S  
Sbjct: 542 GCCVLQRCL---DHGNKDQFQQLCEEIIAHVDELATDPFGNYVVQYIL-TKQTERSESDY 597

Query: 789 AKR----LLPNIVDLCRHRLAS--------------LTVLKILNYRGDDEARKILFEEIF 830
             R    L   IV+L  H+  S              L + ++LN  GD +  ++L +  +
Sbjct: 598 TNRVVNLLRSKIVELSLHKFGSNVVEKVLRTPVVSDLMISELLNQSGDSKIEQLLHDG-Y 656

Query: 831 GKLDSKEPPKVLTQILTDANYGPTFIYKILS---MPLLEDEIR 870
           G         VL   L  A     ++Y+ LS    PLL   IR
Sbjct: 657 GNY-------VLQTALDIARENNRYLYQRLSDTLKPLLVGPIR 692

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 99/248 (39%), Gaps = 15/248 (6%)

Query: 579 FDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKD 638
            D    R L+K ++  T ++ E   +   +   + ELS D  GN +VQK  +K       
Sbjct: 465 LDPHGTRALQKLVEC-TSTEEEANIIVESLRGSIVELSRDLNGNHVVQKCLQKLKPEDSQ 523

Query: 639 IMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVI 698
            +    +     +  H++G    Q+ +       Q + + E +  +   L  D FGNYV+
Sbjct: 524 FIFDAATSECVKIATHRHGCCVLQRCLDHGNK-DQFQQLCEEIIAHVDELATDPFGNYVV 582

Query: 699 QCVL-----KFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLE---AHDIVTTEQTLV 750
           Q +L     +    + + +   + S    +  +++G+  V   L      D++ +E   +
Sbjct: 583 QYILTKQTERSESDYTNRVVNLLRSKIVELSLHKFGSNVVEKVLRTPVVSDLMISE---L 639

Query: 751 LSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNR--HSILAKRLLPNIVDLCRHRLASLT 808
           L+       E L  +  G  +L   LD     NR  +  L+  L P +V   R+      
Sbjct: 640 LNQSGDSKIEQLLHDGYGNYVLQTALDIARENNRYLYQRLSDTLKPLLVGPIRNTPHGRR 699

Query: 809 VLKILNYR 816
           ++ IL + 
Sbjct: 700 IMGILEFE 707

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 79/188 (42%), Gaps = 6/188 (3%)

Query: 648 LTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVL-KFGF 706
           + S+   ++G    Q+ + +   P     + +   DY   L  D FGNY+IQ +L +   
Sbjct: 388 ILSLCKDQHGCRFLQRQLDVGG-PEAANSIFQETKDYVVELMTDSFGNYLIQKLLERVDD 446

Query: 707 PWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNN 766
                + +S   +F ++  + +G RA++  +E     T E+  ++   +      L+ + 
Sbjct: 447 NQRLELIKSSSQSFVLISLDPHGTRALQKLVEC--TSTEEEANIIVESLRGSIVELSRDL 504

Query: 767 NGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILF 826
           NG  ++   L   + P     +        V +  HR     + + L++   D+ ++ L 
Sbjct: 505 NGNHVVQKCLQK-LKPEDSQFIFDAATSECVKIATHRHGCCVLQRCLDHGNKDQFQQ-LC 562

Query: 827 EEIFGKLD 834
           EEI   +D
Sbjct: 563 EEIIAHVD 570

>AGL086C [4225] [Homologous to ScYGL014W (PUF4) - SH]
           (543176..545383) [2208 bp, 735 aa]
          Length = 735

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 102/204 (50%), Gaps = 7/204 (3%)

Query: 614 ELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQ 673
           EL +D  GN ++QKL E+ S   +  +++ ++    S+ +  +GT A QK++    T  +
Sbjct: 454 ELMTDSFGNYLIQKLVERVSAEQRITLVKSSADQFVSIALDPHGTRALQKLVECISTEEE 513

Query: 674 IKLVSEGVNDYCTPLFNDQFGNYVIQ-CVLKFGFPWNDFIFQSIISNFWIVVQNRYGARA 732
            +++   + +    L  D  GN+V+Q C+ KF    + FIF +  ++   +  +R+G   
Sbjct: 514 SRIIIASLKNSVVQLSKDLNGNHVVQKCLQKFSSADSQFIFDAACADCVKIATHRHGCCV 573

Query: 733 VRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFL--DTCVLPNRHSI-LA 789
           ++ CL   D  + +Q   L A ++   + L  +  G  ++ + L  +  + P+ ++  + 
Sbjct: 574 LQRCL---DYGSDQQRDQLCAQVLGNVDALTLDPFGNYVVQYILTKEAELPPSTYTTKIV 630

Query: 790 KRLLPNIVDLCRHRLASLTVLKIL 813
             L P +++L  H+  S  V KIL
Sbjct: 631 DTLKPRVIELSLHKFGSNVVEKIL 654

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 80/189 (42%), Gaps = 6/189 (3%)

Query: 648 LTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ-CVLKFGF 706
           L S+   ++G    Q+ + +A  P     + E    Y   L  D FGNY+IQ  V +   
Sbjct: 416 LYSLCKDQHGCRFLQRQLDVAG-PDAATSIFEETKPYVVELMTDSFGNYLIQKLVERVSA 474

Query: 707 PWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNN 766
                + +S    F  +  + +G RA++  +E   I T E++ ++ A +      L+ + 
Sbjct: 475 EQRITLVKSSADQFVSIALDPHGTRALQKLVEC--ISTEEESRIIIASLKNSVVQLSKDL 532

Query: 767 NGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILF 826
           NG  ++   L      +   I       + V +  HR     + + L+Y G D+ R  L 
Sbjct: 533 NGNHVVQKCLQKFSSADSQFIFDAACA-DCVKIATHRHGCCVLQRCLDY-GSDQQRDQLC 590

Query: 827 EEIFGKLDS 835
            ++ G +D+
Sbjct: 591 AQVLGNVDA 599

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 597 SDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYL----TSMG 652
           SD + +QL   +L  +  L+ D  GN +VQ +  K +++       K    L      + 
Sbjct: 582 SDQQRDQLCAQVLGNVDALTLDPFGNYVVQYILTKEAELPPSTYTTKIVDTLKPRVIELS 641

Query: 653 VHKNGTWACQKMITMAKTPRQI--KLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWND 710
           +HK G+   +K++  +     +  +L++ G       L +D FGNYV+Q  L      N 
Sbjct: 642 LHKFGSNVVEKILRTSAVAELMISELLATGRQPGVEQLLHDGFGNYVLQTALDVSKAANS 701

Query: 711 FIF 713
           F++
Sbjct: 702 FLY 704

>Scas_688.2
          Length = 828

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 109/241 (45%), Gaps = 15/241 (6%)

Query: 580 DAPKLRELRKNID--ANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVK 637
           D    R L+K +D   +  +DL  E+     +    EL +D  GN ++QKL E+ +   +
Sbjct: 516 DQHGCRFLQKQLDVLGSKAADLIFEETKFHTI----ELMTDSFGNYLMQKLIERVTTEQR 571

Query: 638 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYV 697
             + +  S     + ++ +GT A QK+I    T  + K++ E + D    L  D  GN+V
Sbjct: 572 IELAKIASPQFVEIALNPHGTRALQKLIECINTEEEAKIIVESLRDSIVQLSKDLNGNHV 631

Query: 698 IQCVLKFGFPWN-DFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIV 756
           +Q  L+   P +  FIF +   N   +  +R+G   ++ CL   D  T EQ   L   ++
Sbjct: 632 VQKCLQKLHPTDFQFIFDATCDNCVDIATHRHGCCVLQRCL---DHGTKEQCEKLCDKLL 688

Query: 757 CYSEYLASNNNGTLLLTWFLDTCVLPNR----HSILAKRLLPNIVDLCRHRLASLTVLKI 812
            + + L  +  G  ++ + +      +     H I+   L P + +L  H+  S  + KI
Sbjct: 689 SHVDKLTLDPFGNYVVQYVITKETERDEFDYTHKIV-HLLKPKVAELSVHKFGSNVIEKI 747

Query: 813 L 813
           L
Sbjct: 748 L 748

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 57/134 (42%), Gaps = 6/134 (4%)

Query: 587 LRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSK 646
           L++ +D  T    + E+L   +L  + +L+ D  GN +VQ +  K ++  +     K   
Sbjct: 668 LQRCLDHGTKE--QCEKLCDKLLSHVDKLTLDPFGNYVVQYVITKETERDEFDYTHKIVH 725

Query: 647 YL----TSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVL 702
            L      + VHK G+   +K++        + L           L ND +GNYV+Q  L
Sbjct: 726 LLKPKVAELSVHKFGSNVIEKILRTPVVTETMILELLNHESEIQNLLNDSYGNYVLQTAL 785

Query: 703 KFGFPWNDFIFQSI 716
                 N +++  +
Sbjct: 786 DISHEHNKYLYDRL 799

>ADL056W [1685] [Homologous to ScYGL178W (MPT5) - SH]
           complement(580439..582862) [2424 bp, 807 aa]
          Length = 807

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 106/237 (44%), Gaps = 23/237 (9%)

Query: 585 RELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKT 644
           R+L    ++N V DL   Q+   +LD    L  D  GN ++QKL E  +   K  M++  
Sbjct: 181 RKLENPAESNQVRDLMYSQIKPYLLD----LILDPFGNYLIQKLCEYLTLDQKTSMIQDI 236

Query: 645 SKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTP------LFNDQFGNYVI 698
             ++  + +++ GT + QK+I   +T + I ++  G +   T       L ND  GN+VI
Sbjct: 237 YTHVFEISINQYGTRSLQKIIDTTETEQHIDMIVSGFSQQFTSINQVVTLINDLNGNHVI 296

Query: 699 Q-CVLKFGFPWNDFIFQSIIS--NFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMI 755
           Q C+ KF     DFI  +I+   N   +  +++G   ++  L    + T +Q   +S  I
Sbjct: 297 QKCIFKFQPTKFDFIIDAIVEKDNIIKISTHKHGCCVLQKLLS---VCTLQQIFKISVKI 353

Query: 756 VCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKI 812
           + Y   L ++  G  ++ +  D          L   LL  I     H L  L+ LK 
Sbjct: 354 IQYLPGLINDQFGNYIIQFLFDI-------KELDFYLLGEIFSKLSHELCQLSCLKF 403

>KLLA0F15477g complement(1429123..1431915) some similarities with
           sgd|S0003936 Saccharomyces cerevisiae YLL013c
           transcript-specific regulator of mRNA degradation,
           hypothetical start
          Length = 930

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 134/303 (44%), Gaps = 33/303 (10%)

Query: 595 TVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVH 654
           T SD + E +   + D+   LS D  GN ++QK FE  +   +++++ +    + ++ + 
Sbjct: 612 TASDADKEVIFNEIRDQCIPLSHDVFGNYVIQKFFEHGTKTQREVLVDQFRGKMENLSLE 671

Query: 655 KNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ----CVLKFGFPWND 710
                  QK        +++ LVSE ++     +  DQ GN+VIQ    C+     P   
Sbjct: 672 MYACRVIQKAFEFLNEDQKVDLVSE-LSHCVLAMIKDQNGNHVIQKAIECIPIEKLP--- 727

Query: 711 FIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTL 770
           FI QS+    + +  + YG R V+  LE   +   +Q  +L+ +   +  +L  +  G  
Sbjct: 728 FILQSLRGQIYHLSTHSYGCRVVQRLLEFGTL--KDQDDILNDLDE-FIPFLIQDQYGNY 784

Query: 771 LLTWFLDTCVLP-NRHSILAKR-----LLPNIVDLCRHRLASLTVLKILNYRGDDEARKI 824
           ++   L       + H  ++K+     +  N+V+  +H+ AS  V K + Y   ++ R+I
Sbjct: 785 VIQHILQHGTEDTSSHIGMSKQNIIDIIRKNVVEYSKHKFASNVVEKSVVYGSKNQIRQI 844

Query: 825 L------FEEIFGKLDSKEPPKVLTQILTDANYGPTFIYKILSMPLLEDE------IRSH 872
           L       EE    L+   P   L  ++ D  Y    + K++ +   EDE      IRS+
Sbjct: 845 LDQILPRDEEHAADLEDNAP---LILMMRD-QYANYVVQKLVGVATGEDERLIVISIRSY 900

Query: 873 VIK 875
           + K
Sbjct: 901 LDK 903

>YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein
           involved in metabolism of COX17 mRNA, has eight
           Pumilio-homology domains [2640 bp, 879 aa]
          Length = 879

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 108/230 (46%), Gaps = 13/230 (5%)

Query: 608 MLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITM 667
           + D+  ELS+D  GN ++QK FE  S I K+ ++ +    +  + +        QK +  
Sbjct: 575 IRDDAIELSNDVFGNYVIQKFFEFGSKIQKNTLVDQFKGNMKQLSLQMYACRVIQKALEY 634

Query: 668 AKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWND--FIFQSIISNFWIVVQ 725
             + ++I+LV E ++D    +  DQ GN+VIQ  ++   P     FI  S+  + + +  
Sbjct: 635 IDSNQRIELVLE-LSDSVLQMIKDQNGNHVIQKAIE-TIPIEKLPFILSSLTGHIYHLST 692

Query: 726 NRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRH 785
           + YG R ++  LE     + +Q  +L+ +   +  YL  +  G  ++ + L      N+ 
Sbjct: 693 HSYGCRVIQRLLEFGS--SEDQESILNEL-KDFIPYLIQDQYGNYVIQYVLQQDQFTNKE 749

Query: 786 SILAKR-----LLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFEEIF 830
            +  K+     +  N+V+  +H+ AS  V K + Y G    + ++  +I 
Sbjct: 750 MVDIKQEIIETVANNVVEYSKHKFASNVVEKSILY-GSKNQKDLIISKIL 798

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 72/175 (41%), Gaps = 8/175 (4%)

Query: 655 KNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFP-WNDFIF 713
           ++G+   Q+ +  +    +  + +E + D    L ND FGNYVIQ   +FG     + + 
Sbjct: 550 QHGSRFIQRELATSPASEKEVIFNE-IRDDAIELSNDVFGNYVIQKFFEFGSKIQKNTLV 608

Query: 714 QSIISNFWIVVQNRYGARAVRACLEAHDI-VTTEQTLVLSAMIVCYSEYLASNNNGTLLL 772
                N   +    Y  R ++  LE  D     E  L LS  ++     +  + NG  ++
Sbjct: 609 DQFKGNMKQLSLQMYACRVIQKALEYIDSNQRIELVLELSDSVLQ----MIKDQNGNHVI 664

Query: 773 TWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKILFE 827
              ++T  +     IL+  L  +I  L  H      + ++L +   ++   IL E
Sbjct: 665 QKAIETIPIEKLPFILSS-LTGHIYHLSTHSYGCRVIQRLLEFGSSEDQESILNE 718

>CAGL0D05544g complement(527482..530217) similar to tr|Q07807
           Saccharomyces cerevisiae YLL013c transcript-specific
           regulator of mRNA degradation, hypothetical start
          Length = 911

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 99/228 (43%), Gaps = 19/228 (8%)

Query: 610 DELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAK 669
           D    L++D  GN ++QK FE  S   KDI++ +    +  + +        Q+ +    
Sbjct: 606 DHALSLANDVFGNYVIQKFFEYGSKTQKDILVEQFRGKMEELSLQMYACRVIQRALEFID 665

Query: 670 TPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ----CVLKFGFPWNDFIFQSIISNFWIVVQ 725
             ++I LV E ++     +  DQ GN+VIQ    C+     P   FI  S+  + + +  
Sbjct: 666 AQQRIDLVRE-LSHCVLQMIKDQNGNHVIQKAIECIPIDLLP---FILNSLEGHIYHLST 721

Query: 726 NRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFL----DTCVL 781
           + YG R V+  LE     T E    +   +  +  YL  +  G  ++   L    D  + 
Sbjct: 722 HSYGCRVVQRLLE---FGTLEDQKRILEELKDFIPYLIQDQYGNYVIQHILQHGSDVNLA 778

Query: 782 PNRHSILAKRLL----PNIVDLCRHRLASLTVLKILNYRGDDEARKIL 825
                ++ + ++     NIV+  +H+ AS  V K + Y  DD+  +++
Sbjct: 779 SEHMRVIKQEIINNVADNIVEFSKHKFASNVVEKAIIYGTDDQKIQLM 826

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 96/244 (39%), Gaps = 23/244 (9%)

Query: 638 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYV 697
           D+ L+    +       ++G+   QK +  A  P + +LV   + D+   L ND FGNYV
Sbjct: 562 DLTLKSIYGHALEFCKDQHGSRFIQKELATAPPPER-ELVFNEIRDHALSLANDVFGNYV 620

Query: 698 IQCVLKFGFP-WNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIV 756
           IQ   ++G     D + +        +    Y  R ++  LE    +  +Q + L   + 
Sbjct: 621 IQKFFEYGSKTQKDILVEQFRGKMEELSLQMYACRVIQRALE---FIDAQQRIDLVRELS 677

Query: 757 CYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYR 816
                +  + NG  ++   ++ C+  +    +   L  +I  L  H      V ++L + 
Sbjct: 678 HCVLQMIKDQNGNHVIQKAIE-CIPIDLLPFILNSLEGHIYHLSTHSYGCRVVQRLLEF- 735

Query: 817 GDDEARKILFEEIFGKLDSKEPPKVLTQILTDANYGPTFIYKIL----SMPLLEDEIRSH 872
           G  E +K + EE+          K     L    YG   I  IL     + L  + +R  
Sbjct: 736 GTLEDQKRILEEL----------KDFIPYLIQDQYGNYVIQHILQHGSDVNLASEHMR-- 783

Query: 873 VIKQ 876
           VIKQ
Sbjct: 784 VIKQ 787

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 27/141 (19%)

Query: 585 RELRKNIDANTVSDLE--LEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDI------- 635
           R +++ ++  T+ D +  LE+L     D +P L  D  GN ++Q + +  SD+       
Sbjct: 727 RVVQRLLEFGTLEDQKRILEELK----DFIPYLIQDQYGNYVIQHILQHGSDVNLASEHM 782

Query: 636 --VKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLV--------SEGVN-DY 684
             +K  ++   +  +     HK  +   +K I      ++I+L+            N + 
Sbjct: 783 RVIKQEIINNVADNIVEFSKHKFASNVVEKAIIYGTDDQKIQLMKMILPRDKEHAANLEE 842

Query: 685 CTPL---FNDQFGNYVIQCVL 702
            +PL     DQF NYV+Q ++
Sbjct: 843 DSPLILMMRDQFANYVVQKLV 863

>AAL152W [35] [Homologous to ScYLL013C (PUF3) - SH]
           complement(77508..79871) [2364 bp, 787 aa]
          Length = 787

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 105/243 (43%), Gaps = 20/243 (8%)

Query: 595 TVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVH 654
           T S++E E +   + D   +LS D  GN ++QK FE  +   KDI++ +    L ++ + 
Sbjct: 468 TASNIEKEVIFNEIRDHAIQLSHDVFGNYVIQKFFEFGTKTQKDILVEQFRGKLEALSLE 527

Query: 655 KNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ----CVLKFGFPWND 710
                  Q+        ++I LV E  +   T +  DQ GN+VIQ    C+     P   
Sbjct: 528 MYACRVIQRAFEFIDEDQKIDLVMELSSSVLT-MIKDQNGNHVIQKTIECIPMSKLP--- 583

Query: 711 FIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTL 770
           FI +S+    + +  + YG R V+  LE       E+ L     +  +  YL  +  G  
Sbjct: 584 FILESLRGQIYHLSTHFYGCRVVQRLLEYGSKADQEEIL---NELDQFIPYLVQDQYGNY 640

Query: 771 LLTWFL--------DTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEAR 822
           ++   L        +  +  ++  I+   +   +V+  +H+ AS  V K + Y    + R
Sbjct: 641 VIQHILQHGGDNPAENHIDKSKQDIV-DTISKTVVEFSKHKFASNVVEKTILYGSASQKR 699

Query: 823 KIL 825
           ++L
Sbjct: 700 QVL 702

>CAGL0A00473g complement(51137..53497) similar to sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 786

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 13/240 (5%)

Query: 580 DAPKLRELRKNID--ANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVK 637
           D    R L+K +D      SD   E+     +    EL +D  GN ++QKL E+ +D  +
Sbjct: 474 DQHGCRFLQKQLDVLGKKASDAIFEETKEYTV----ELMTDSFGNYLIQKLLERVTDDQR 529

Query: 638 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYV 697
             + +  +  +  +    +GT A QK+I    T  + ++V + +      L  D  GN+V
Sbjct: 530 VELAKIAAPKMVEISKDPHGTRALQKLIECISTKEEAEIVVKSLQPDTVILSKDLNGNHV 589

Query: 698 IQ-CVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIV 756
           IQ C+ K     + FIF +  +    +  +R+G   ++ CL   D  T  Q   L   ++
Sbjct: 590 IQKCLQKLNPEDSQFIFDAAGNECGEIATHRHGCCVLQRCL---DHGTKTQFKDLCEKLL 646

Query: 757 CYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAK---RLLPNIVDLCRHRLASLTVLKIL 813
            Y + L  +  G  ++ + +      N +    K   +L P   +L  H+  S  V K+L
Sbjct: 647 KYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIVNQLKPRFTELSVHKFGSNVVEKVL 706

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 19/142 (13%)

Query: 587 LRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSD---------IVK 637
           L++ +D  T +  + + L   +L  +  L+ D  GN +VQ +  K ++         IV 
Sbjct: 626 LQRCLDHGTKT--QFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIVN 683

Query: 638 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQI--KLVSEGVNDYCTPLFNDQFGN 695
            +  R      T + VHK G+   +K++        I  +L++EG  +    L ND FGN
Sbjct: 684 QLKPR-----FTELSVHKFGSNVVEKVLRTPVVSETIINELINEGSAE-VQALLNDSFGN 737

Query: 696 YVIQCVLKFGFPWNDFIFQSII 717
           YV+Q  L      N ++++ ++
Sbjct: 738 YVLQTALDISRDTNPYMYKKLV 759

>Scas_707.37
          Length = 813

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 109/236 (46%), Gaps = 23/236 (9%)

Query: 585 RELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKT 644
           ++L  N +++ V DL  EQ+   +LD    L  D  GN ++QKL +  +   +  M++  
Sbjct: 191 KKLESNAESDIVRDLMYEQIKPYILD----LILDPFGNYLIQKLCDYLTTAQRTDMIQSI 246

Query: 645 SKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTP------LFNDQFGNYVI 698
              +  + +++ GT + QK+I    +  QI+ + +G +   T       L ND  GN+VI
Sbjct: 247 FPQVFQISINQYGTRSLQKIIDTVDSDVQIETIIKGFSQEYTSIQQVVTLINDLNGNHVI 306

Query: 699 Q-CVLKFGFPWNDFIFQSII--SNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMI 755
           Q C+ KF      F+  +I+  +N   +  +++G   ++  L    + T +Q   +S  I
Sbjct: 307 QKCIFKFPPSTFGFVIDAIVEKNNIITISTHKHGCCVLQKLLS---VCTLQQIFTISVKI 363

Query: 756 VCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLK 811
           + +   L ++  G  ++ + LD          L   LLP I     + L  L+ LK
Sbjct: 364 IQFLPGLINDQFGNYIIQFLLDI-------DDLDYYLLPEIFKRLSNELCQLSCLK 412

>CAGL0L05962g complement(662298..664991) similar to sp|P39016
           Saccharomyces cerevisiae YGL178w MPT5 multicopy
           suppressor of POP2, hypothetical start
          Length = 897

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 106/223 (47%), Gaps = 25/223 (11%)

Query: 573 PLTSKDF-----DAPKLRELRKNID----ANTVSDLELEQLALCMLDELPELSSDYLGNT 623
           PL   D+     D    R L+K ++    +N V DL  +Q+    L    EL  D  GN 
Sbjct: 230 PLKELDYVKLATDQFGCRFLQKKLETPSESNLVRDLMYDQIKPYFL----ELILDPFGNY 285

Query: 624 IVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGV-N 682
           ++QKL +  +   +  ++      +  + +++ GT + QK+I      +QI L+ +G  N
Sbjct: 286 LIQKLCDFLTPDQRTALIEAIYPNVFQISINQYGTRSLQKIIDTVDDEQQINLIVKGFSN 345

Query: 683 DYCT-----PLFNDQFGNYVIQ-CVLKFGFPWNDFIFQSII--SNFWIVVQNRYGARAVR 734
           +Y +      L ND  GN+VIQ C+ KF     DFI  +II  +N   +  +++G   ++
Sbjct: 346 EYTSIRQVVTLINDLNGNHVIQKCIFKFPASKFDFIIAAIIDQNNIIAISTHKHGCCVLQ 405

Query: 735 ACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLD 777
             L    + T +QT  +S  IV +   L ++  G  ++ + LD
Sbjct: 406 KLLS---VCTLQQTFKISVKIVQFLPNLINDQFGNYIIQFLLD 445

>KLLA0E13629g complement(1201715..1204183) some similarities with
           sp|P39016 Saccharomyces cerevisiae YGL178w MPT5
           multicopy suppressor of POP2, hypothetical start
          Length = 822

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 100/221 (45%), Gaps = 27/221 (12%)

Query: 577 KDFDAPKL-----------RELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIV 625
           KD D  KL           R+L    +++ V DL  E +    LD    L  D  GN ++
Sbjct: 177 KDLDYVKLSTDQYGCRFLQRKLETPQESDQVRDLIFENVNNFFLD----LILDPFGNYLI 232

Query: 626 QKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVN--- 682
           QKL +  +   K  M++     +  + +++ GT + QK+I   +T   I ++  G +   
Sbjct: 233 QKLCDYLTTDQKTAMIKDIYPSVFQISINQYGTRSLQKIIDTVETQEHIDMIIRGFSQEH 292

Query: 683 ---DYCTPLFNDQFGNYVIQ-CVLKFGFPWNDFIFQSIISNFWIVV--QNRYGARAVRAC 736
              +    L ND  GN+VIQ C+ KF     DFI  +I++N  I+    +++G   ++  
Sbjct: 293 TSIEQVVTLINDLNGNHVIQKCIFKFQPANFDFIIDAIVNNDNIITISTHKHGCCVLQKL 352

Query: 737 LEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLD 777
           L    + T +Q   +S  I+ Y   L ++  G  ++ +  D
Sbjct: 353 LS---VCTLQQIFKISVKIIQYLPSLINDQFGNYIIQFLFD 390

>Sklu_2097.2 YLL013C, Contig c2097 4468-6831
          Length = 787

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 139/327 (42%), Gaps = 35/327 (10%)

Query: 596 VSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHK 655
            SD E E +   + DE   L+ D  GN ++QK FE  +   KD+++ + +  +  + +  
Sbjct: 470 ASDAEKEVIFNEIRDEAIALADDVFGNYVIQKFFEHGTKTQKDVLVEQFTGKMEQLSLEM 529

Query: 656 NGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQCVLKFGFPWND--FIF 713
                 Q+     +  +++ LV E ++     +  DQ GN+VIQ  ++   P +   FI 
Sbjct: 530 YACRVIQRAFECIEEQQKVALVQE-LSHCVLHMIKDQNGNHVIQKAIER-IPIDKLPFIL 587

Query: 714 QSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLT 773
            S+    + +  + YG R ++  LE   +   +Q L     +  +  YL  +  G  ++ 
Sbjct: 588 GSLNEQIYHLSTHSYGCRVIQRLLEYGSLKDQDQIL---DELDQFIPYLIQDQYGNYVIQ 644

Query: 774 WFLDTCVLPNRHS-ILAKRLLPNIVDLC--------RHRLASLTVLKILNYRGDDEARKI 824
             L        H+ I       NIVD+         +H+ AS  V K + +  D + R+I
Sbjct: 645 HILQHG---GEHTNIHIGSTKQNIVDIVSKSVVEYSKHKFASNVVEKTMLFGSDSQKRQI 701

Query: 825 LFEEIFGKLD-----SKEPPKVLTQILTDANYGPTFIYKILSMPLLEDE------IRSHV 873
           +   +   LD         P +L      ANY    + K++ +   ED+      IRS++
Sbjct: 702 MDRILPKSLDHAAHLEDNAPLILMMRDQYANY---VVQKLVGVAQGEDKKLIVVAIRSYL 758

Query: 874 --IKQVRKILMEHGLSQQQHRRLMEEV 898
             + +V  +   H  S ++   L+E+V
Sbjct: 759 DRLNKVNALGNRHLASVEKLAALVEKV 785

>YGL178W (MPT5) [1813] chr7 (167356..167358,167999..170575) Protein
           required for high temperature growth, recovery from
           alpha-factor arrest, post-transcriptional regulation of
           HO expression, and normal life span of yeast cells [2580
           bp, 859 aa]
          Length = 859

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 114/256 (44%), Gaps = 34/256 (13%)

Query: 577 KDFDAPKL-------RELRKNID----ANTVSDLELEQLALCMLDELPELSSDYLGNTIV 625
           +D D  KL       R L+K ++    +N V DL  EQ+    LD    L  D  GN +V
Sbjct: 211 RDLDYIKLATDQFGCRFLQKKLETPSESNMVRDLMYEQIKPFFLD----LILDPFGNYLV 266

Query: 626 QKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYC 685
           QKL +  +   K ++++     +  + +++ GT + QK+I       QI L+ +G +   
Sbjct: 267 QKLCDYLTAEQKTLLIQTIYPNVFQISINQYGTRSLQKIIDTVDNEVQIDLIIKGFSQEF 326

Query: 686 TP------LFNDQFGNYVIQ-CVLKFGFPWNDFIFQSII--SNFWIVVQNRYGARAVRAC 736
           T       L ND  GN+VIQ C+ KF      FI  +I+  +N   +  +++G   ++  
Sbjct: 327 TSIEQVVTLINDLNGNHVIQKCIFKFSPSKFGFIIDAIVEQNNIITISTHKHGCCVLQKL 386

Query: 737 LEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNI 796
           L    + T +Q   +S  IV +   L ++  G  ++ + LD          L   LL  +
Sbjct: 387 LS---VCTLQQIFKISVKIVQFLPGLINDQFGNYIIQFLLDI-------KELDFYLLAEL 436

Query: 797 VDLCRHRLASLTVLKI 812
            +   + L  L+ LK 
Sbjct: 437 FNRLSNELCQLSCLKF 452

>Kwal_20.2729
          Length = 389

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 94/202 (46%), Gaps = 16/202 (7%)

Query: 585 RELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKT 644
           ++L    +  TV DL  +Q+    LD    L  D  GN ++QKL E  +   K  ++   
Sbjct: 183 KKLETPQECCTVRDLMYQQIQPFFLD----LILDPFGNYLIQKLCEYLTTDQKTKLVESI 238

Query: 645 SKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTP------LFNDQFGNYVI 698
             ++  + +++ GT + QK+I    T  QI L+  G     T       L ND  GN+V+
Sbjct: 239 YPHVFQISINQYGTRSLQKVIDTVDTEAQIDLIISGFGQAFTSIEQVVVLINDLNGNHVV 298

Query: 699 Q-CVLKFGFPWNDFIFQSII--SNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMI 755
           Q C+ KF     DFI  +I+  +N   +  +++G   ++  L    + T +Q   +S  I
Sbjct: 299 QKCIFKFPPTKFDFIINAIVDKNNIVKISTHKHGCCVLQKLLS---VCTLQQIFKISVKI 355

Query: 756 VCYSEYLASNNNGTLLLTWFLD 777
           V +   L ++  G  ++ + LD
Sbjct: 356 VQFLRNLINDQFGNYIIQFLLD 377

>KLLA0A09097g 794827..797244 some similarities with sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 805

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 14/202 (6%)

Query: 580 DAPKLRELRKNIDANTVSDLELEQLALCML----DELPELSSDYLGNTIVQKLFEKSSDI 635
           D    R L++ +D N       E++A  +     D + EL +D  GN ++QKLFE+ +  
Sbjct: 490 DQHGCRFLQRQLDENG------EEVASTIYSEIKDHICELMNDPFGNYLMQKLFERINQR 543

Query: 636 VKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGN 695
            +  +++  S     + +  +GT A QK++    T  + +++   +      L  D   N
Sbjct: 544 DRVEIVKNCSPQFMDIALDAHGTRALQKLVECTDTEEETQILVASLQPSILSLSRDFKSN 603

Query: 696 YVIQCVLK-FGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAM 754
           +V+Q +L+ F      FI+ +   +   +  +R G   V+ CL   D   TEQ   L   
Sbjct: 604 HVVQKMLENFSNKDTQFIYDAACDDIIKISNHRNGCCVVQRCL---DFGNTEQLDALCGK 660

Query: 755 IVCYSEYLASNNNGTLLLTWFL 776
           IV  S  L  N  G  ++ + L
Sbjct: 661 IVEKSFELTMNPYGNYVIQYIL 682

>Sklu_2033.2 YGL178W, Contig c2033 2461-4695
          Length = 744

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 27/221 (12%)

Query: 577 KDFDAPKL-------RELRKNIDANT----VSDLELEQLALCMLDELPELSSDYLGNTIV 625
           +D D  KL       R L+K +D++T    V DL  + +    L    EL  D  GN ++
Sbjct: 143 EDLDYVKLATDQFGCRFLQKKLDSSTKYEAVRDLMYQGIQPFFL----ELILDPFGNYLI 198

Query: 626 QKLFEKSSDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYC 685
           QKL +  +   K  +++     +  + +++ GT + QK+I       QI ++ +G +   
Sbjct: 199 QKLCDYLTLDQKTTLIQDIYPNVFQISINQYGTRSLQKIIDTVDNESQIDMLIKGFSQQF 258

Query: 686 TP------LFNDQFGNYVIQ-CVLKFGFPWNDFIFQSIIS--NFWIVVQNRYGARAVRAC 736
           T       L ND  GN+VIQ C+ KF     DFI  +I+   N   +  +++G   ++  
Sbjct: 259 TSIEQVVTLINDLNGNHVIQKCIFKFPPTKFDFIIDAIVEQDNIIKISTHKHGCCVLQKL 318

Query: 737 LEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTWFLD 777
           L    + T +Q   +S  IV +   L ++  G  ++ + LD
Sbjct: 319 LS---VCTLQQIFKISVKIVQFLPGLINDQFGNYIIQFLLD 356

>Kwal_33.15113
          Length = 758

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 105/238 (44%), Gaps = 13/238 (5%)

Query: 596 VSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKSSDIVKDIMLRKTSKYLTSMGVHK 655
            SD E E +   + +E+  L+ D  GN ++QK FE      +DI+       +  + +  
Sbjct: 441 ASDAEKEVIFNEIKEEIITLADDVFGNYVIQKYFEYGLKTHRDILFEHFKGKMEKLSLQM 500

Query: 656 NGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQFGNYVIQ-CVLKFGFPWNDFIFQ 714
                 Q+ +      +++ LV E ++     +  DQ GN+VIQ  + +       FI +
Sbjct: 501 YACRVIQRALECIDEEQKVILVEE-LSGCVLQMIKDQNGNHVIQKAIERIPIARLPFILK 559

Query: 715 SIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLSAMIVCYSEYLASNNNGTLLLTW 774
           S+    + +  + YG R V+  LE     T +Q ++L+ +   +  +L  +  G  ++  
Sbjct: 560 SLEGQTYHLSTHSYGCRVVQRLLEYGS--TDDQNIILNDLD-QFIPFLIQDQYGNYVIQH 616

Query: 775 FL-------DTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKILNYRGDDEARKIL 825
            L       D+ +   + +I+   +  +IV+  +H+ AS  V K + +    + R+ +
Sbjct: 617 ILKQGPDTSDSHMGRTKQAIV-DAVCKSIVEYSKHKFASNVVEKTMVFGSPAQKRQFM 673

>Scas_621.10
          Length = 415

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 27/115 (23%)

Query: 299 GDEVDPRAINWVSMETTVPTINQINNLL--------PTNTITISNVFXXXXXXXXXXXTI 350
           G E+D R IN V M T+ P     +           P+ T+ + N+            + 
Sbjct: 225 GKEIDGREIN-VDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNL------------SF 271

Query: 351 NLTSTSLATLCSKYGEVISSR------TFKGLNIALVEFANVESAMRAKQDLQGK 399
           N    +++ L SKYGE+IS R      T +      V++ NVE A +A + LQG+
Sbjct: 272 NADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGE 326

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 26/114 (22%)

Query: 299 GDEVDPRAINWVSMETTVPTINQINNLL-------PTNTITISNVFXXXXXXXXXXXTIN 351
           G E+D R IN   M T+ P  N             P++T+ + N+            + N
Sbjct: 231 GKEIDGRPIN-CDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNL------------SFN 277

Query: 352 LTSTSLATLCSKYGEVISSR------TFKGLNIALVEFANVESAMRAKQDLQGK 399
               ++  L +K+GEV+S R      T +      V+F+N+E A +A   LQG+
Sbjct: 278 ADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGE 331

>ABR207W [801] [Homologous to ScYHR165C (PRP8) - SH]
            complement(789500..796708) [7209 bp, 2402 aa]
          Length = 2402

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 13/77 (16%)

Query: 213  GMSNLNTITPVPSYYEPSLSQQK----SETLNNTLTVPSSNVW-------GNNRQRSHSN 261
            GM N +   P P  ++PS S+      SE +     VP S +W       G NR+  +  
Sbjct: 2304 GMENKDIFDPSPEGFDPSFSEHAQLLLSERIMGNFLVPKSGIWNYAFMGAGFNRELRYE- 2362

Query: 262  TSSLYVDAQFYDQEARS 278
              SL +   FYD++ R+
Sbjct: 2363 -LSLDIPLGFYDEQHRA 2378

>KLLA0E22396g 1990670..1992595 highly similar to sp|P12398
           Saccharomyces cerevisiae YJR045c SSC1 mitochondrial heat
           shock protein 70-related protein, start by similarity
          Length = 641

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 535 IIHSFDTKADRLQLEAL-INNGI-NYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNID 592
           ++  FD       +  L I+NG+   K TN   + G        +DFD   LRE+ K   
Sbjct: 211 VVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLG-------GEDFDIYLLREIVKQFK 263

Query: 593 ANTVSDLELEQLALCMLDELPELSSDYLGNTI 624
             T  DLE +++A+  + E  E +   L +T+
Sbjct: 264 QETGIDLENDRMAIQRIREAAEKAKIELSSTV 295

>CAGL0I01496g 120258..122201 highly similar to sp|P12398
           Saccharomyces cerevisiae YJR045c SSC1 or sp|P39987
           Saccharomyces cerevisiae YEL030w ECM10, start by
           similarity
          Length = 647

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 535 IIHSFDTKADRLQLEAL-INNGI-NYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNID 592
           ++  FD       +  L I+NG+   K TN   + G        +DFD   LRE+     
Sbjct: 210 VVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLG-------GEDFDIVLLREIVSRFK 262

Query: 593 ANTVSDLELEQLALCMLDELPELSSDYLGNTI 624
           A +  DLE +++A+  + E  E +   L +T+
Sbjct: 263 AESGIDLENDRMAIQRIREAAEKAKIELSSTV 294

>CAGL0I03322g complement(283299..285239) highly similar to sp|P12398
           Saccharomyces cerevisiae YJR045c SSC1 or sp|P39987
           Saccharomyces cerevisiae YEL030w ECM10, start by
           similarity
          Length = 646

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 535 IIHSFDTKADRLQLEAL-INNGI-NYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNID 592
           ++  FD       +  L I+NG+   K TN   + G        +DFD   LRE+     
Sbjct: 212 VVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLG-------GEDFDIVLLREIVSRFK 264

Query: 593 ANTVSDLELEQLALCMLDELPELSSDYLGNTI 624
           A +  DLE +++A+  + E  E +   L +T+
Sbjct: 265 AESGIDLENDRMAVQRIREAAEKAKIELSSTV 296

>KLLA0A09405g complement(820161..820970) no similarity, hypothetical
           start
          Length = 269

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 15/108 (13%)

Query: 173 QPNTQTNANNLWTSVSNPPEAXXXXXXXXXFNSNNNPNILGMSNLNTITPVPSYYEPSLS 232
           QP  Q NA  L      PP A         FNS+   N    S++  +T  PSY+ P  +
Sbjct: 137 QPPEQQNAPQL------PPRADNINTSMLVFNSSGFNNCSPHSSVPIVTGFPSYFNPRQA 190

Query: 233 Q-----QKSETLNNTLTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQE 275
           +     +K E     L +     +  + Q +H+N  S+  D++F++++
Sbjct: 191 KNMPHGEKVERWMENLPI----YFEESEQMTHTNCFSISDDSEFWEED 234

>CAGL0B02816g complement(271482..274166) similar to sp|Q06488
           Saccharomyces cerevisiae YLR357w RSC2 or sp|P53236
           Saccharomyces cerevisiae YGR056w RSC1, hypothetical
           start
          Length = 894

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 40/88 (45%), Gaps = 23/88 (26%)

Query: 789 AKRLLPNIVDL-CRHRLASLTVLKILNYRGDDEARKIL--FEEIFGKLDSKEPPKVLTQI 845
            KR  P I+DL    R+ +  VLK++    D+  R +L  FE+I                
Sbjct: 251 VKRGRPPIIDLPYVQRMKN--VLKVIRKEVDERRRSLLDSFEKI---------------- 292

Query: 846 LTDANYGPTFIYKILSMPLLEDEIRSHV 873
             D NY P + Y I+S P+  DEIR  V
Sbjct: 293 -PDRNYNPQY-YSIISNPISLDEIRKKV 318

>YJR045C (SSC1) [2939] chr10 complement(519552..521516)
           Mitochondrial protein that acts as an import motor with
           Tim44p and as a chaperonin in receiving and folding
           protein chains during import, protects mitochondrial DNA
           synthesis activity (Mip1p) during heat shock, heat shock
           protein of HSP70 family [1965 bp, 654 aa]
          Length = 654

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 9/92 (9%)

Query: 535 IIHSFDTKADRLQLEAL-INNGI-NYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNID 592
           ++  FD       +  L I+NG+   K TN   + G        +DFD   LRE+     
Sbjct: 216 VVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLG-------GEDFDIYLLREIVSRFK 268

Query: 593 ANTVSDLELEQLALCMLDELPELSSDYLGNTI 624
             T  DLE +++A+  + E  E +   L +T+
Sbjct: 269 TETGIDLENDRMAIQRIREAAEKAKIELSSTV 300

>Sklu_2264.3 YJR045C, Contig c2264 2755-4749
          Length = 664

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 535 IIHSFDTKADRLQLEAL-INNGI-NYKGTNDTMNFGPLPEPLTSKDFDAPKLRELRKNID 592
           ++  FD       +  L I+NG+   K TN   + G        +DFD   LRE+  N  
Sbjct: 233 VVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLG-------GEDFDIYMLREIVANFK 285

Query: 593 ANTVSDLELEQLALCMLDELPELSSDYLGNTI 624
             +  DL+ +++A+  + E  E +   L +T+
Sbjct: 286 KESGIDLQNDRMAIQRIREAAEKAKIELSSTV 317

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,307,522
Number of extensions: 1458133
Number of successful extensions: 4843
Number of sequences better than 10.0: 177
Number of HSP's gapped: 4801
Number of HSP's successfully gapped: 224
Length of query: 1067
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 955
Effective length of database: 12,718,893
Effective search space: 12146542815
Effective search space used: 12146542815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)