Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_671.1248648625410.0
YIL090W49148717580.0
CAGL0D04202g49949016850.0
Sklu_2251.1047948615350.0
Kwal_27.1150047549213600.0
ADL208W50251112731e-172
KLLA0E08173g48648411781e-158
YMR277W (FCP1)73233711.3
AGL233C87264702.0
YLR313C (SPH1)66153692.2
CAGL0M02959g75833682.8
Scas_684.32951183683.4
ABL127W72833673.7
KLLA0C02607g47357656.1
ADL128C1082123657.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_671.12
         (486 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_671.12                                                           983   0.0  
YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknow...   681   0.0  
CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces c...   653   0.0  
Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement     595   0.0  
Kwal_27.11500                                                         528   0.0  
ADL208W [1533] [Homologous to ScYIL090W - SH] complement(337120....   494   e-172
KLLA0E08173g complement(740213..741673) similar to sp|P40499 Sac...   458   e-158
YMR277W (FCP1) [4231] chr13 (820255..822453) TFIIF-interacting c...    32   1.3  
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    32   2.0  
YLR313C (SPH1) [3702] chr12 complement(760357..762342) Protein i...    31   2.2  
CAGL0M02959g 332990..335266 similar to sp|Q03254 Saccharomyces c...    31   2.8  
Scas_684.32                                                            31   3.4  
ABL127W [465] [Homologous to ScYMR277W (FCP1) - SH] complement(1...    30   3.7  
KLLA0C02607g 236042..237463 similar to sp|P50874 Saccharomyces c...    30   6.1  
ADL128C [1613] [Homologous to ScYGR218W (CRM1) - SH] (464144..46...    30   7.2  

>Scas_671.12
          Length = 486

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/486 (100%), Positives = 486/486 (100%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
           KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
           ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 301 VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK 360
           VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK
Sbjct: 301 VVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYK 360

Query: 361 MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM 420
           MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM
Sbjct: 361 MACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAM 420

Query: 421 YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480
           YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT
Sbjct: 421 YAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480

Query: 481 TPGSKQ 486
           TPGSKQ
Sbjct: 481 TPGSKQ 486

>YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.4010p [1476 bp, 491 aa]
          Length = 491

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/487 (69%), Positives = 404/487 (82%), Gaps = 9/487 (1%)

Query: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+FTV+LF LYF++TTL++ AR+
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121
           +G R++I  TN LYY QHFIIASLLYLFLSGFSN++L ++L++     +S  +  K N  
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALK-NSL 122

Query: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181
           +S Q N+VLYYYYYRF VQPWQF+L+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241
           NTW+ISSLL SGGVITASLYYLYRIYVTPIW LS+QTASLLG  LS+V GLG+YGIV+ K
Sbjct: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242

Query: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL +FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353
           +LKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 303 ILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINE 362

Query: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473
           PCILIAMY HLILQYSGELK +LC+WGC+ K F  DQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVY 482

Query: 474 ASELIGT 480
           A+ELIG+
Sbjct: 483 ATELIGS 489

>CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces
           cerevisiae YIL090w, start by similarity
          Length = 499

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/490 (66%), Positives = 387/490 (78%), Gaps = 10/490 (2%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           +I+    R IRI SA  YL+ TL+SIPISFKIGGL CGL+FTV+LF LY +STTLS+ AR
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGN-----KPIDSIADI 115
           +  +R ++  T+ILYY QH +IA LL+LFLSGFSNE+ +  L          P  S  D+
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDL 122

Query: 116 FKKNVASSTQA----NWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGET 171
            K  +  +T A    NW LYYYY++F VQPWQ++LSYSTPFFTL EGFFTILAIQAIGET
Sbjct: 123 LKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGET 182

Query: 172 NKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGG 231
           NKWL YE+NSNTW+I+SLL SGGVIT SLYYLYRIYVTPIW+L++Q+ASLLGF LS+V  
Sbjct: 183 NKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFC 242

Query: 232 LGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSP 291
           LG+YGI++ KGSVIESS+FFAYIVRCIYEISPKLAT ATEEIL++ K+VWQ HQ NL + 
Sbjct: 243 LGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNR 302

Query: 292 NNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSI 351
           +NLL+YYHNVVLKN E +WESF +  +  + +    R      P+WK  K FT++VPSSI
Sbjct: 303 DNLLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSI 362

Query: 352 NELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYW 411
            EL  VTYKMA ES+SPAVIVNLCFR+LIFYSATRIIPALQR    E R+SRRI+K+LYW
Sbjct: 363 VELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYW 422

Query: 412 YSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFPS-DQPKIIVDSWGFWNWCNIFFTI 470
           YSPC+LIAMY HLILQYSGELK ELCLWGC S  F S DQP+I+ DSW FWNWCNIF+T+
Sbjct: 423 YSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCNIFWTV 482

Query: 471 LVYASELIGT 480
           LVYA+ELIGT
Sbjct: 483 LVYANELIGT 492

>Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement
          Length = 479

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 383/486 (78%), Gaps = 18/486 (3%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M+  S I+ IR C  TFYLL  LI+IPISF++GGL+CGL+FTV+LF LYFL+TTL I ++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLR-DGNKPIDSIADIFKKN 119
           KY +R++  +T+ +YY QHFII SLL+LFLSGF+N++L   +  D N P +S+ +  +  
Sbjct: 61  KY-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK 119

Query: 120 VASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEI 179
              S + +W+ YYYYY+F V+PWQF+L +STP+FTL EGFFT+L IQAIGETNKWL Y  
Sbjct: 120 ---SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHK 176

Query: 180 NSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVT 239
           NSNTW+I SLL SGGVIT SLYYLYRIYVTP+W+LS+QTASLLGFTLS+V GLG+YGIV+
Sbjct: 177 NSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVS 236

Query: 240 DKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYH 299
            KGSVIESS+FFAYIVRCIYEISP+LAT+A +EI ++ K+ WQ+HQ NL + +NLLSYY 
Sbjct: 237 GKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYR 295

Query: 300 NVVLKNIETIWESFKINDNSFITSFSTERVITI-FMPIWKLLKTFTITVPSSINELCFVT 358
           NVVLKN E IW++  I   +  TS ST +++ +   P+WK  K FTI+VPSSI E+  VT
Sbjct: 296 NVVLKNGEMIWDA--IVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVT 353

Query: 359 YKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILI 418
            KMA ES++P V++NL FR+L+FYSATRIIPALQ+ + N  + SRR+M+++YWYSPCI+I
Sbjct: 354 LKMATESVTPTVVINLVFRILVFYSATRIIPALQKDNPNGRKSSRRLMRLIYWYSPCIVI 413

Query: 419 AMYAHLILQYSGELKDELCLWGCNSKIFP---SDQP--KIIVDSWGFWNWCNIFFTILVY 473
           AMY HLILQYSGEL ++LCLWGC    FP   ++ P  K++VD+WGFWNWCN+F T+ +Y
Sbjct: 414 AMYTHLILQYSGELNNDLCLWGC----FPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIY 469

Query: 474 ASELIG 479
             ELIG
Sbjct: 470 GLELIG 475

>Kwal_27.11500
          Length = 475

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 358/492 (72%), Gaps = 26/492 (5%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           MI  S ++ IR+C  +FYLL  LI+IPI+F++GGL+CGL+FTV+LF LY ++TTL I AR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             G      L +  YY QHF I SLL+LFLSGFSN++L   +    +P +S+ D+ + + 
Sbjct: 61  ARG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSST 117

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
            S     W+ YYYYY + V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL     
Sbjct: 118 HSQP---WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN WVIS L+ SGGVITA+LYYLYRIYVTPIW+LSVQTASLLGFT S+V GLGI+GIV+ 
Sbjct: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
           +GS IESS+FFAYIVRC+YEISP+LAT+A +EI  + K+ W     +L S +  L+YY +
Sbjct: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294

Query: 301 VVLKNIETIWESFKINDNSFITS------FSTERVITIFMPIWKLLKTFTITVPSSINEL 354
           ++LKN E IW++     N  ++        S  RV     P+WK +K FT +VPSSI E+
Sbjct: 295 IILKNGEMIWDAVLARTNVNVSGAGPVAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 355 CFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSP 414
             +T  MA E+I+PAV++NLCFR+LIFYSATRIIPALQR+     R+SRR M++LYWYSP
Sbjct: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSP 407

Query: 415 CILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQP---KIIVDSWGFWNWCNIFFTIL 471
           CI+IAMY HLI+QYSG++ ++LCLWGC    FP   P   K++VDSWGFWNWCNIF T+ 
Sbjct: 408 CIVIAMYTHLIMQYSGQISNDLCLWGC----FPWSPPEGSKVVVDSWGFWNWCNIFCTMA 463

Query: 472 VYASELIGTTPG 483
           +YASEL G+  G
Sbjct: 464 IYASELFGSKSG 475

>ADL208W [1533] [Homologous to ScYIL090W - SH]
           complement(337120..338628) [1509 bp, 502 aa]
          Length = 502

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 346/511 (67%), Gaps = 41/511 (8%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           M+    +R +R   A+FYL   LI++PISF+IGGL+CGL+FTV+LFILYF++TTL I A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  KYGSR-IHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKN 119
             G    HI  T  LYY QHF++ S+L+LFLSGF+N+QL   L   +        IF  N
Sbjct: 61  TRGDEWKHIAST--LYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGN 118

Query: 120 VASS---------TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170
           +  S              + Y +YYR+ V+PWQ++L ++TP FTL+EGFFT+LAIQ IGE
Sbjct: 119 MNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178

Query: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230
           T +WL Y+ NS  WVISSL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLSLV 
Sbjct: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238

Query: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290
           GLG+YGI++ KGS IESS+FFAY+V CIYEISP+LA TA  EI +V    WQ  Q  L  
Sbjct: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298

Query: 291 PNNLLSYYHNVVLKNIETIWE-----SFKINDNSFITSFSTERVITIFM----------- 334
            N+LL+YY N +L N E +W+     +F ++      + S+  V    +           
Sbjct: 299 -NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356

Query: 335 PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRR 394
            +W   K F+  +P SI+E+  VT  +A ESI+ AV+ NL FRV++FYSATRIIPALQR 
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416

Query: 395 DDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFP-----SD 449
                 +SR++M+++YWYSPCI+IAMY H+IL+YSGEL +ELC+WGC    FP     ++
Sbjct: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC----FPWLQSEAN 470

Query: 450 QPKIIVDSWGFWNWCNIFFTILVYASELIGT 480
           + + +VD+WGFWNWCN+FFT+L+YA ELIG+
Sbjct: 471 RDRWVVDAWGFWNWCNLFFTLLIYAVELIGS 501

>KLLA0E08173g complement(740213..741673) similar to sp|P40499
           Saccharomyces cerevisiae YIL090w singleton, start by
           similarity
          Length = 486

 Score =  458 bits (1178), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 325/484 (67%), Gaps = 45/484 (9%)

Query: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60
           +I  S ++ +RI   T YL   LI+IPISF++GGL+CGL+FTV+LF LYF+STT  +   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120
             GS     L+ ++YY QH +I S+L++FLS F N          +  +DS  + FK   
Sbjct: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN--------IDSDTVDS--EYFK--- 144

Query: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180
                        ++   V+PWQ  L +STP FTL EG FTILAIQAIGET +WL     
Sbjct: 145 ------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRR 192

Query: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240
           SN WVI SLL SGG+IT SL+Y YRIYVTP+W+LS  +ASLLGFT S+V G+G+YGI   
Sbjct: 193 SNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NG 251

Query: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300
            GSV+ESS+FFAY+VR +YEISPK+A  A +EI ++ KE W+ HQANL   +NLL     
Sbjct: 252 SGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----E 307

Query: 301 VVLKNIETIWESF---KINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFV 357
           ++ KN   IW         ++ +I     ++   I  P+W  +K FT +VP SI E+  V
Sbjct: 308 LMTKNYRAIWSQIVEHTPRNHKYIKMM--DQCKWILNPLWNSVKNFTKSVPISIQEIFVV 365

Query: 358 TYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCIL 417
           T+KMA ES+ PAV++NL FR+LIFYSATRIIP LQ R+  E R  RRIM  +YWYSPCI+
Sbjct: 366 TFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPCII 424

Query: 418 IAMYAHLILQYSGELKDELCLWGCNSKIFPSD-QPKIIVDSWGFWNWCNIFFTILVYASE 476
           IAMY HLIL+YSG+LK++LC+WGC    FP + +PKI+VDSW FWNWCNI+ T+L+YA E
Sbjct: 425 IAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIYSTMLIYALE 480

Query: 477 LIGT 480
           L+G+
Sbjct: 481 LMGS 484

>YMR277W (FCP1) [4231] chr13 (820255..822453) TFIIF-interacting
           component of the RNA polymerase II C-terminal domain
           (CTD) phosphatase, specific for Rpo21p CTD serine
           residue 2 [2199 bp, 732 aa]
          Length = 732

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +K+FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 310 AKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 342

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
           (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 247 SSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVLKNI 306
           SS     ++R I E+  +LA   +E + ++F    Q+H     SP N LS +H V+ K  
Sbjct: 64  SSTPNVELLRRIDELETELARMKSEMVPQLF---MQKHVMGTVSPVNRLSQFHLVIEKQG 120

Query: 307 ETIW 310
            TI+
Sbjct: 121 RTIF 124

>YLR313C (SPH1) [3702] chr12 complement(760357..762342) Protein
           involved in polarized growth, with roles in shmoo
           formation and bud site selection [1986 bp, 661 aa]
          Length = 661

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 13/53 (24%)

Query: 273 ILEVFKEVWQR--HQANLTSPNN-----LLSYYHNVVLKNIETIWESFKINDN 318
           IL++F E+ +R  H  ++ + NN      L++Y N      +T++ESFKIND+
Sbjct: 105 ILDIFTEIERRNLHHLDMGTHNNGLDEGDLNFYLN------DTLFESFKINDD 151

>CAGL0M02959g 332990..335266 similar to sp|Q03254 Saccharomyces
           cerevisiae YMR277w FCP1, start by similarity
          Length = 758

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
           +++FP+DQ  ++V  D    WNWC     ++ Y
Sbjct: 297 TRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY 329

>Scas_684.32
          Length = 951

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 81/183 (44%), Gaps = 20/183 (10%)

Query: 236 GIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLL 295
           GI T +G V+  +VF   +   I  + P+ A   TEE++ + K  +        SP++ +
Sbjct: 384 GIRTHRGKVL--AVFLKALGSIIPLMDPEYAAYYTEEVMRIVKREF-------NSPDDEM 434

Query: 296 SYYHNVVLKN---IETIWESFKIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSS 350
                +VL+     E I   +   +    F  +F T RV  + +P+ KL+   T+ +   
Sbjct: 435 RKTVLIVLQKCCRTEGITPKYLKTEVAPEFFRTFWTRRV-ALDLPMNKLVIYTTVILSEK 493

Query: 351 INELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLY 410
           I    +V  K+    ++P       FR++  Y+  R++  L   + NE  ++R I  +L 
Sbjct: 494 IG-CSYVVEKL----LTPLKDEAEPFRIMAIYAVNRVVKLLGTAELNERLETRLIDALLI 548

Query: 411 WYS 413
            + 
Sbjct: 549 AFQ 551

>ABL127W [465] [Homologous to ScYMR277W (FCP1) - SH]
           complement(156800..158986) [2187 bp, 728 aa]
          Length = 728

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 2/33 (6%)

Query: 443 SKIFPSDQPKIIV--DSWGFWNWCNIFFTILVY 473
            ++FP DQ  ++V  D    WNWC     ++ Y
Sbjct: 295 ERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPY 327

>KLLA0C02607g 236042..237463 similar to sp|P50874 Saccharomyces
           cerevisiae YNL261w ORC5 origin recognition complex, 50
           kDa subunit singleton, start by similarity
          Length = 473

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 34/57 (59%)

Query: 285 QANLTSPNNLLSYYHNVVLKNIETIWESFKINDNSFITSFSTERVITIFMPIWKLLK 341
           Q NL +P  L++   +++ + +  +      + +SF++++ST +V TIF P +K L+
Sbjct: 138 QVNLETPTQLMALPGSILPQAMIQLRLIISFSKSSFLSNYSTFKVPTIFFPKYKPLE 194

>ADL128C [1613] [Homologous to ScYGR218W (CRM1) - SH]
           (464144..467392) [3249 bp, 1082 aa]
          Length = 1082

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 8/123 (6%)

Query: 302 VLKNIETIWESFKINDNSFITSFSTERVITIF----MPIWKLLKTFTITVPSSINELCFV 357
           V+K++  + E  +  DN  + + +   V+  +       WK LKT  + +   ++E    
Sbjct: 529 VIKDLLALTEQKRGKDNKAVVASNIMYVVGQYPRFLKAHWKFLKTVVLKLFEFMHETHEG 588

Query: 358 TYKMACESISPAVIVNLCFRVLIFYSATRIIPALQR--RDDNELRKSRRIMKVLYWYSPC 415
              MAC++     IV  C R  +    T   P +Q   RD  +  +  +  +V  +Y  C
Sbjct: 589 VQDMACDTF--IKIVQKCKRHFVIQQPTEKEPFIQAIIRDIQKTTEDLQPQQVHTFYRAC 646

Query: 416 ILI 418
            LI
Sbjct: 647 GLI 649

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.140    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,301,855
Number of extensions: 643842
Number of successful extensions: 2427
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2453
Number of HSP's successfully gapped: 28
Length of query: 486
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 380
Effective length of database: 12,926,601
Effective search space: 4912108380
Effective search space used: 4912108380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)