Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_669.950350326930.0
CAGL0F07777g50450117530.0
KLLA0D09999g50150117510.0
YMR170C (ALD2)50650317140.0
YMR169C (ALD3)50649916640.0
Kwal_23.350750249916290.0
AFL201W49749815090.0
KLLA0D10021g50349411401e-152
Kwal_23.350050349411181e-148
KLLA0E23144g50749510611e-140
YER073W (ALD5)52048610581e-139
Kwal_23.591153848710571e-139
KLLA0C07777g51450010501e-138
Sklu_2369.551449110481e-138
CAGL0J03212g51750210341e-136
Kwal_27.1197652649110301e-135
Sklu_2315.350149410261e-135
Scas_663.452049610251e-134
Scas_701.1451549210221e-134
Sklu_2427.251849510151e-133
CAGL0D06688g52449510151e-133
Kwal_26.675252249510141e-133
CAGL0H05137g49750110081e-132
KLLA0F00440g52249610081e-132
YOR374W (ALD4)51949510001e-130
ADR417W5074959751e-127
Scas_664.244995009501e-123
ACL044W5134889311e-120
YPL061W (ALD6)5004958771e-112
KLLA0F12628g5044786422e-77
Sklu_2087.35064636343e-76
AER007W4954876053e-72
Scas_716.634944655923e-70
YBR006W (UGA2)4974915905e-70
CAGL0C04191g4914825628e-66
Kwal_56.231064954845522e-64
KLLA0E17545g4974975496e-64
AAL075W6374784271e-45
KLLA0C10615g6404804173e-44
Kwal_23.56996414853953e-41
YHR039C (MSC7)6444813858e-40
Scas_690.266514953621e-36
CAGL0F08965g6394993593e-36
KLLA0C10549g5765003291e-32
Kwal_23.57145764903272e-32
CAGL0D03982g5745233263e-32
Scas_690.415814693212e-31
AAL071C5735173202e-31
KLLA0B12540g5214453156e-31
Kwal_26.75955244702952e-28
CAGL0K03509g5273542901e-27
YHR037W (PUT2)5754952902e-27
Scas_717.745223272741e-25
YMR110C5323922661e-24
YDL185W (TFP1)107193721.1
YPL149W (ATG5)29457664.5
Sklu_2381.257684665.5
Scas_608.411548626.2
Kwal_23.562327673646.5
CAGL0J02882g53086656.7
KLLA0B09196g59077649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_669.9
         (503 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_669.9                                                           1041   0.0  
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...   679   0.0  
KLLA0D09999g complement(844368..845873) highly similar to sp|P47...   679   0.0  
YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde ...   664   0.0  
YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasm...   645   0.0  
Kwal_23.3507                                                          632   0.0  
AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C (...   585   0.0  
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...   443   e-152
Kwal_23.3500                                                          435   e-148
KLLA0E23144g complement(2052418..2053941) highly similar to sp|P...   413   e-140
YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehy...   412   e-139
Kwal_23.5911                                                          411   e-139
KLLA0C07777g complement(682962..684506) highly similar to sp|P40...   409   e-138
Sklu_2369.5 YER073W, Contig c2369 5264-6808                           408   e-138
CAGL0J03212g 307754..309307 highly similar to sp|P40047 Saccharo...   402   e-136
Kwal_27.11976                                                         401   e-135
Sklu_2315.3 YPL061W, Contig c2315 5950-7455                           399   e-135
Scas_663.4                                                            399   e-134
Scas_701.14                                                           398   e-134
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                           395   e-133
CAGL0D06688g 639883..641457 highly similar to sp|P46367 Saccharo...   395   e-133
Kwal_26.6752                                                          395   e-133
CAGL0H05137g complement(495715..497208) highly similar to sp|P54...   392   e-132
KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomy...   392   e-132
YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial ald...   389   e-130
ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH] complement(...   380   e-127
Scas_664.24                                                           370   e-123
ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH] complement(...   363   e-120
YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldeh...   342   e-112
KLLA0F12628g complement(1170396..1171910) similar to sp|P38067 S...   251   2e-77
Sklu_2087.3 , Contig c2087 4336-5856                                  248   3e-76
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...   237   3e-72
Scas_716.63                                                           232   3e-70
YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyd...   231   5e-70
CAGL0C04191g complement(409544..411019) highly similar to sp|P38...   221   8e-66
Kwal_56.23106                                                         217   2e-64
KLLA0E17545g 1553982..1555475 highly similar to sp|P38067 Saccha...   216   6e-64
AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH] complement(2...   169   1e-45
KLLA0C10615g complement(912077..913999) similar to sp|P38694 Sac...   165   3e-44
Kwal_23.5699                                                          156   3e-41
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...   152   8e-40
Scas_690.26                                                           144   1e-36
CAGL0F08965g complement(880296..882215) highly similar to sp|P38...   142   3e-36
KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1 Kluyverom...   131   1e-32
Kwal_23.5714                                                          130   2e-32
CAGL0D03982g 397039..398763 highly similar to sp|P07275 Saccharo...   130   3e-32
Scas_690.41                                                           128   2e-31
AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH] (223170..224...   127   2e-31
KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces...   125   6e-31
Kwal_26.7595                                                          118   2e-28
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...   116   1e-27
YHR037W (PUT2) [2324] chr8 (181969..183696) Delta-1-pyrroline-5-...   116   2e-27
Scas_717.74                                                           110   1e-25
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...   107   1e-24
YDL185W (TFP1) [687] chr4 (126788..130003) Catalytic subunit (su...    32   1.1  
YPL149W (ATG5) [5298] chr16 (271309..272193) Protein involved in...    30   4.5  
Sklu_2381.2 YPR072W, Contig c2381 3614-5344                            30   5.5  
Scas_608.4                                                             28   6.2  
Kwal_23.5623                                                           29   6.5  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    30   6.7  
KLLA0B09196g complement(803259..805031) some similarities with s...    29   9.6  

>Scas_669.9
          Length = 503

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/503 (100%), Positives = 503/503 (100%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA
Sbjct: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM
Sbjct: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL
Sbjct: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF
Sbjct: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT
Sbjct: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360
           ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC
Sbjct: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360

Query: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420
           PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL
Sbjct: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420

Query: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL 480
           SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL
Sbjct: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL 480

Query: 481 GRTGVESFMQTKTVQINIRKPNS 503
           GRTGVESFMQTKTVQINIRKPNS
Sbjct: 481 GRTGVESFMQTKTVQINIRKPNS 503

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/501 (63%), Positives = 407/501 (81%), Gaps = 3/501 (0%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           +F+ I IPQ   S +QPIG+FI NEFV SS+G +I+T NPAT+E +TSFYA +E DV+ A
Sbjct: 4   VFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDVDKA 63

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           V++AR SY   W K SP ++ D+LLKLA L+E +K +LA++ET D+GKPY+TNA+ DID 
Sbjct: 64  VKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDDIDQ 123

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           II LTKYFAG+TDKFT G+TIPIDHE L YTLK P+GV   I+PWNYPLAMASWK+Q CL
Sbjct: 124 IIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQGCL 183

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGNT+VIKP+EN+SLSLLY AQL  +AGFP GVVN++PG G+VVG++L  H DVDKISF
Sbjct: 184 AAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVPGKGSVVGNSLGLHMDVDKISF 243

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGSTKVG ++LE +GKSN+KDVTLECGGKSPAV+F+DA+++ A+++ + GIF+NSGQNCT
Sbjct: 244 TGSTKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDADIDNAIEYIANGIFYNSGQNCT 303

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMT- 359
           ANSR+ VQ DI+D+F+ +F ++TK  W FGSK DPFDKDCTVGPV+S+KQ+E + +Y+  
Sbjct: 304 ANSRVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFDKDCTVGPVVSEKQFETVNDYIRH 363

Query: 360 CPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419
             E   +++   ++    D  GYFI PTI+T+VPQ SK  KEEIFGP VV+++F+DY EA
Sbjct: 364 GKEEENLQIHQTVEKC--DCKGYFISPTIFTDVPQGSKLMKEEIFGPVVVVAKFKDYKEA 421

Query: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479
           + LANDT+YGLA+ VFT+NI +A+ FARDI +GTVW+N+SN ED T+PFGGFK SGIGRE
Sbjct: 422 IKLANDTNYGLASMVFTKNISVANWFARDIKSGTVWINSSNEEDPTVPFGGFKQSGIGRE 481

Query: 480 LGRTGVESFMQTKTVQINIRK 500
           LG TGVES+MQ KTV +N+ +
Sbjct: 482 LGETGVESYMQIKTVHLNMSE 502

>KLLA0D09999g complement(844368..845873) highly similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 aldehyde
           dehydrogenase 2 (NAD+), start by similarity
          Length = 501

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/501 (62%), Positives = 403/501 (80%), Gaps = 4/501 (0%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           +++T+ IPQ +++  QP+GLFI+NEFVKSSDG +I++ NP+T+E + SF+A SE DVN A
Sbjct: 3   LYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNSA 62

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           V AAR ++   WSKTS EQR  LL KL  L+ERDK +LA+IET DSGKPY++N+L D++ 
Sbjct: 63  VTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLEQ 122

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           I++LT+Y+AG  DKFT GE IP++ +  AYT+KVP+GVVAQIVPWNYPLAMASWK+QSCL
Sbjct: 123 ILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSCL 182

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGNT+VIKP+EN+SLSLLYFAQL+ EAGFPPGV+NI+PGYG+V G A+++H D+DKI+F
Sbjct: 183 AAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIAF 242

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGST VG  V+  + +SNLK VTLECGGKSP +IF DANL+EA+ W + GIF+NSGQNCT
Sbjct: 243 TGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNCT 302

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360
           ANSRI V  DI++EF+ KF++Y K  W FG+KFDPFDKDCT+GPVIS+ QY++IQ Y+  
Sbjct: 303 ANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVEH 362

Query: 361 PEGC-PVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419
            +    +      +YP     GYFIPPTI+++VP  SK  +EEIFGP  V++ F  Y+EA
Sbjct: 363 GKASEKLGFKEFAEYPS---KGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEEA 419

Query: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479
           + LAND+SYGLA+ VF+EN R   +FARDI AGTVW+N+SN E++++PFGGFKMSGIGRE
Sbjct: 420 IKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGRE 479

Query: 480 LGRTGVESFMQTKTVQINIRK 500
           LGR GV+S++QTK V +NI K
Sbjct: 480 LGRNGVDSYLQTKAVHVNIAK 500

>YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde
           dehydrogenase (NAD(P)+), likely cytosolic [1521 bp, 506
           aa]
          Length = 506

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/503 (62%), Positives = 400/503 (79%), Gaps = 1/503 (0%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           ++  IEIPQ  +S++QP+GLFI+NEF  SSDG  I+T NPAT E +TSF A +E DV+ A
Sbjct: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKA 63

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           V+AAR ++   WSKTS EQR   L  L  L+E +++ LA++ET D+GKPY++NA  D+  
Sbjct: 64  VKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQ 123

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           I++LT+YFAGS DKF  G TIP+     AYTLKVPFGVVAQIVPWNYPLAMA WKLQ  L
Sbjct: 124 ILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGAL 183

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGNTV+IKP+EN+SLSLLYFA LI +AGFPPGVVNI+PGYG++VG AL++H D+DKISF
Sbjct: 184 AAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISF 243

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGSTKVG  VLE SG+SNLKDVTLECGGKSPA++F+DA+L++A+ W + GIF+NSGQNCT
Sbjct: 244 TGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCT 303

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM-T 359
           ANSR+ VQ  I+D+FV KFK+  K++W+   KFDPFD+ C VGPVIS  QY++I+ Y+  
Sbjct: 304 ANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIER 363

Query: 360 CPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419
                 +++    ++P     GYFIPPTI+T+VPQ SK  ++EIFGP VV+S+F +YD+A
Sbjct: 364 GKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDA 423

Query: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479
           L LANDT YGLA+AVFT++++ AH FARDI AGTVW+N+SN EDVT+PFGGFKMSGIGRE
Sbjct: 424 LKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGRE 483

Query: 480 LGRTGVESFMQTKTVQINIRKPN 502
           LG++GV++++QTK V IN+   N
Sbjct: 484 LGQSGVDTYLQTKAVHINLSLDN 506

>YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasmic,
           stress inducible aldehyde dehydrogenase, probable
           isoform of Ald2p [1521 bp, 506 aa]
          Length = 506

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 395/499 (79%), Gaps = 1/499 (0%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           ++  IEIPQ  +S++QP+GLFI+NEF  SSDG  I+T NPAT E +TSF A +E DV+ A
Sbjct: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKA 63

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           V+AAR ++   WSKTS EQR   L  L  L+E +++ LA++ET D+GKP+++NA  D+  
Sbjct: 64  VKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQ 123

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           II+LT+Y+AG+ DKF  GETIP+     AYTLKVPFGVVAQIVPWNYPLAMA  K+Q  L
Sbjct: 124 IIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGAL 183

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGNTV+IKP+EN+SLSLLYFA LI +AGFPPGVVN+IPGYG+VVG AL TH D+DKISF
Sbjct: 184 AAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISF 243

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGSTKVG +VLE SG+SNLKD+TLECGGKSPA++F+DA+L++A++W + GIFFNSGQ CT
Sbjct: 244 TGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICT 303

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM-T 359
           ANSR+ VQ  I+D+FV KFK+  K++W+   KFDPFD+ C VGPVIS  QY++I+ Y+  
Sbjct: 304 ANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIER 363

Query: 360 CPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419
             +   +++    ++P     GYFIPPTI+T+VP+ SK  ++EIFGP VV+S+F +YD+A
Sbjct: 364 GKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDA 423

Query: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479
           L LANDT YGLA+AVFT++++ AH FARDI AGTVW+N +N E+  +PFGGFKMSGIGRE
Sbjct: 424 LKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRE 483

Query: 480 LGRTGVESFMQTKTVQINI 498
            G TGV++++Q K+V +++
Sbjct: 484 SGDTGVDNYLQIKSVHVDL 502

>Kwal_23.3507
          Length = 502

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/499 (60%), Positives = 390/499 (78%), Gaps = 7/499 (1%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I IPQ  L+ +QP+GL+I+NEFV SSDG  I++ NPAT + + SF A ++ DV+ AV AA
Sbjct: 7   IHIPQLDLTYQQPLGLYINNEFVASSDGGSIESVNPATGKPVASFQAATDADVDRAVAAA 66

Query: 65  RTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKL 124
           R +Y   W  TS EQR+ LL KLA LVE+++E+LA+IET DSGKP++TNA  D+D I++L
Sbjct: 67  RKAYQSHWRHTSAEQRSALLAKLAELVEQERELLAAIETLDSGKPFHTNAKGDLDQIVQL 126

Query: 125 TKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGN 184
           TKY+AG  DKF  G+ IP+  +  AYT++ P+GVVAQ+VPWNYPLAMASWK+Q CLAAGN
Sbjct: 127 TKYYAGGADKFNKGQHIPVGPDKYAYTVQAPYGVVAQVVPWNYPLAMASWKMQGCLAAGN 186

Query: 185 TVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGST 244
           TVVIKP+EN+SLSLLYFAQL   AGFP GVVN++PG+G V G  L+ H DVDKI+FTGST
Sbjct: 187 TVVIKPAENTSLSLLYFAQLFERAGFPAGVVNVVPGHGAVAGSRLAAHMDVDKIAFTGST 246

Query: 245 KVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSR 304
            VG  V+  +  SNLK VTLECGGKSPAVIF DA+L++AV+WT+ GI++NSGQNCTANSR
Sbjct: 247 AVGQKVMGLAAASNLKAVTLECGGKSPAVIFADADLDQAVEWTAAGIYYNSGQNCTANSR 306

Query: 305 ILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM---TCP 361
           + VQ  ++DEFV KF  Y ++ W FG+K DPFD +CTVGPV+SQ QY++I+ Y+      
Sbjct: 307 LYVQESVYDEFVAKFCAYVEKTWKFGAKHDPFDPECTVGPVVSQVQYDRIRGYIEHGKSS 366

Query: 362 EGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALS 421
           E   +    + D  P    G+FIPPT++T+VPQDSK  +EEIFGP  VI++F+DYD+AL+
Sbjct: 367 EQLGIRQIGVADVAP----GFFIPPTLFTDVPQDSKLSREEIFGPVAVIAKFKDYDDALA 422

Query: 422 LANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELG 481
            ANDT+YGLAAAVFTE++R A+ FARDI AGTVW+N+SN E+V++PFGGFKMSGIGRELG
Sbjct: 423 RANDTNYGLAAAVFTEDVRKANHFARDIDAGTVWINSSNDEEVSVPFGGFKMSGIGRELG 482

Query: 482 RTGVESFMQTKTVQINIRK 500
           ++G++ + Q K V +NI K
Sbjct: 483 QSGMDVYTQIKAVHVNISK 501

>AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C
           (ALD3) - SH] complement(58424..59917) [1494 bp, 497 aa]
          Length = 497

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/498 (56%), Positives = 363/498 (72%), Gaps = 5/498 (1%)

Query: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60
           +F+ I +P+   +  QP+GLFI NEFV    G+Q+ T NPA  E + +FYA    DV+ A
Sbjct: 4   LFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYAAGAADVDAA 63

Query: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120
           V AAR +Y + W  TS ++R  LL +LA LV+ ++E+LA IET DSGKPY+TNAL D+D 
Sbjct: 64  VAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGIETLDSGKPYHTNALADLDQ 123

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
           +  +T+Y+AG  DK   G+   + H   AYTL+VP+GVVAQIVPWNYPLAMASWK Q CL
Sbjct: 124 VAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQGCL 183

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           AAGN VVIKPSEN+SLSLLYFA L+  AGFPPGV N++PG G  VG  L+ H  VDKI+F
Sbjct: 184 AAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDKIAF 243

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGST VG  V+  +  SNLKDVTLECGGKSPAVIF DA+L+ AV + + GIF+NSGQNCT
Sbjct: 244 TGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQNCT 303

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360
           ANSRI VQ  ++D F+ KF+ + +  ++FGS    F KDC +GPVIS+ QY+++  Y+  
Sbjct: 304 ANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGYINH 361

Query: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420
                +        P     GY+IPPTI+ +VPQ S+ C+EEIFGP  V+++F+DYDEA+
Sbjct: 362 GINEKLAYEQFGSVPE---KGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDYDEAI 418

Query: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL 480
             ANDT+YGLA+ VFTENIR+AH F RD+ +GTVWVN+SN E+V +PFGGFKMSGIGREL
Sbjct: 419 RYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGIGREL 478

Query: 481 GRTGVESFMQTKTVQINI 498
           G+ G+++++QTK V +N 
Sbjct: 479 GKAGLQTYLQTKAVHLNF 496

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
           albicans aldehyde dehydrogenase, mitochondrial (by
           homology), start by similarity
          Length = 503

 Score =  443 bits (1140), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 225/494 (45%), Positives = 325/494 (65%), Gaps = 15/494 (3%)

Query: 15  RQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFY-AGSETDVNVAVRAARTSYTKTWS 73
           +QP+GLFI+NE+V++     + ++NP++ E++     A  + DV++AV+AAR ++   W 
Sbjct: 15  QQPLGLFINNEYVEAHGSETLTSYNPSSGEEICKVQCADPKIDVDLAVKAARDAFP-GWK 73

Query: 74  KTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTD 133
            T   ++ DL  KLA L+ERD +IL+ IE+ D+GKP   NA  DI  ++++ KY+AG  D
Sbjct: 74  ATPAIEKRDLFYKLAGLLERDIDILSKIESLDTGKPIANNAKYDILEVVEVLKYYAGWID 133

Query: 134 KFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSEN 193
           K   G++     E LAYTL  P GVV  I+P+NYPLAM SWK  + +A GNT V K ++ 
Sbjct: 134 K-AGGQSFAPSSEKLAYTLHQPLGVVGCIIPFNYPLAMMSWKW-TAIATGNTTVFKSADQ 191

Query: 194 SSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQ 253
           + LS+LYFA+L+ EAGFP GV N++ G G  VG A+  H  VDKI+FTGST VG  +++Q
Sbjct: 192 TPLSILYFAKLVKEAGFPAGVFNVLSGTGASVGSAIVKHTGVDKIAFTGSTAVG-QIIQQ 250

Query: 254 SGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFD 313
               NLK +TLECGGKS  +IF+D +LE+AVKW++ GIF N GQ C+  SR+ VQ  I++
Sbjct: 251 QSAVNLKPITLECGGKSANMIFEDCDLEQAVKWSAWGIFNNMGQICSGTSRVFVQESIYE 310

Query: 314 EFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC--PEGCPVEVSHI 371
           EFV +  D+ K+ +  G+   P D    VGP +S+KQ E++ EY+     EGC V +  +
Sbjct: 311 EFVAQLADHVKKTYIVGA---PSDDAVIVGPQVSKKQQERVLEYIKIGIEEGCKVPLGGL 367

Query: 372 -----IDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDT 426
                I   P   NGY++ PTI  +V    +  KEEIFGP +V+  F+DY EAL +AND+
Sbjct: 368 GAPEPIANDPALANGYYVKPTILADVKASYRIAKEEIFGPVIVVGSFKDYKEALDIANDS 427

Query: 427 SYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVE 486
            YGL +A+F+++I   H+FA+D+ AG VW+N+SN  D+ +PFGG KMSG GRELG  G+ 
Sbjct: 428 DYGLGSAIFSKDIVTCHKFAQDVEAGMVWINSSNDVDINVPFGGVKMSGHGRELGEYGLA 487

Query: 487 SFMQTKTVQINIRK 500
           +F   K+V +N+ +
Sbjct: 488 NFTNVKSVHVNLGR 501

>Kwal_23.3500
          Length = 503

 Score =  435 bits (1118), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/494 (44%), Positives = 316/494 (63%), Gaps = 15/494 (3%)

Query: 13  SIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAG-SETDVNVAVRAARTSYTKT 71
           S  QP+GLFI+NE+V S    +I++F+ AT E + +  A  +  DV++AV AAR ++   
Sbjct: 13  SYTQPLGLFINNEYVDSHSSEKIESFDAATGEVIAAVQAADASVDVDLAVSAARAAFPG- 71

Query: 72  WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGS 131
           W  T   ++ DLLLKLASLVE +KE+LA++E+ DSGKP  +NA+ D++ +  + KY+AG 
Sbjct: 72  WRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGILKYYAGW 131

Query: 132 TDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPS 191
            DK   G++     + L YTL  P GVV  I+P+NYPL M +WK  + +A GNT V K +
Sbjct: 132 VDK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKW-TAVATGNTTVFKSA 189

Query: 192 ENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVL 251
           E + LS+LYFAQL+V AGFPPGV N++ G G  VGDA++ H  +DKI+FTGST VG  + 
Sbjct: 190 EQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGSTSVGQQI- 248

Query: 252 EQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDI 311
           +++   NLK +TLECGGKSPA++F DA+ E+AV+WT+ GIF+N GQ C+  SR  V+  I
Sbjct: 249 QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSRCYVEDSI 308

Query: 312 FDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMT--CPEGCPVEVS 369
           +D+FV     +    +  G    P      VGP +S+ Q E++Q Y+     EG  + + 
Sbjct: 309 YDKFVDALAAHVADTYVVGP---PSQSTTRVGPQVSRTQQERVQNYIRKGVEEGARLVLG 365

Query: 370 -----HIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLAN 424
                  I       NG+++ PTI  +V Q     +EEIFGP + +S+F DYDEAL LAN
Sbjct: 366 GEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYDEALRLAN 425

Query: 425 DTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTG 484
           D+ YGL +A+FT ++  AH+FA ++ +G  ++N+SN  D   PFGG KMSG GRELG  G
Sbjct: 426 DSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYGRELGEYG 485

Query: 485 VESFMQTKTVQINI 498
           + +F   K V +N+
Sbjct: 486 LANFTNVKAVYVNL 499

>KLLA0E23144g complement(2052418..2053941) highly similar to
           sp|P54115 Saccharomyces cerevisiae YPL061w ALD6 aldehyde
           dehydrogenase, cytosolic, start by similarity
          Length = 507

 Score =  413 bits (1061), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 216/495 (43%), Positives = 307/495 (62%), Gaps = 8/495 (1%)

Query: 4   TIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRA 63
           +I +P + L+ +QP GLFI+N+F+KS DG  +   NP+T+E +    + +  DV  AV A
Sbjct: 20  SITLP-NGLTYQQPTGLFINNQFIKSQDGKTLKVENPSTEEIIVEVQSATSQDVEYAVEA 78

Query: 64  ARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
           A  ++   WS   P++R  LL KLA L+E  KE++ASIE+ D+GK     A  D+ ++I 
Sbjct: 79  ADAAFNSEWSTMDPKKRGSLLFKLADLIEAQKELIASIESADNGKTLAL-ARGDVGLVID 137

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             +  AG  DK   G TI        +T K P GV  QI+PWN+PL M SWK+   L AG
Sbjct: 138 YIRSAAGYADKLG-GRTINTGDGYANFTYKEPLGVCGQIIPWNFPLMMLSWKIAPALVAG 196

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTV++KP+  + L+ L+FA L  EAG P GVVNI+PG G  VGD ++ HP + KI+FTGS
Sbjct: 197 NTVILKPASPTPLNALFFASLCKEAGIPAGVVNIVPGPGRSVGDTITNHPKIRKIAFTGS 256

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T +G +V  ++ +SNLK VTLE GGKS  ++F+DAN+++ +     GIF N+GQ C++ S
Sbjct: 257 TDIGRDVAIKAAQSNLKKVTLELGGKSAHLVFEDANIKKTIPNLVNGIFKNAGQICSSGS 316

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           RI VQ  I+D+ + +FK Y + +   GS   PFD+      + ++ Q+E I  Y+    G
Sbjct: 317 RIYVQDTIYDQLLSEFKTYLETEIKVGS---PFDESNFQAAINNKAQFETILNYIDI--G 371

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                S +         GYFI PT++ NV +D +  KEEIFGP V IS+F   DEA++LA
Sbjct: 372 KKEGASILTGGERVGNKGYFIKPTVFYNVKEDMRIVKEEIFGPVVTISKFSTVDEAVALA 431

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ +GL A + TENI +A + A+ + AGTVW+NT N  D  +PFGG+K SG GRE+G  
Sbjct: 432 NDSEFGLGAGIETENISVALKVAKRLKAGTVWINTYNDFDAAVPFGGYKQSGYGREMGEE 491

Query: 484 GVESFMQTKTVQINI 498
             ES+ Q K V+I +
Sbjct: 492 AFESYTQIKAVRIKL 506

>YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehyde
           dehydrogenase [1563 bp, 520 aa]
          Length = 520

 Score =  412 bits (1058), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 301/486 (61%), Gaps = 9/486 (1%)

Query: 16  QPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKT 75
           QP GLFI+ EFV S      D  NP+ +EK+T+ Y   E DV+ AV AA+ ++   WS  
Sbjct: 42  QPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFETKWSIV 101

Query: 76  SPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKF 135
            PE R   L  LA LVE+ +E LA+IE+ D+GK  +  A  D+ ++ K  +   G  DK 
Sbjct: 102 EPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFC-ARGDVALVSKYLRSCGGWADKI 160

Query: 136 TTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSS 195
             G  I        Y++K P GV  QI+PWN+PL M SWK+   LA GNTVV+KP+E + 
Sbjct: 161 Y-GNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTP 219

Query: 196 LSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSG 255
           LS L+ +QL  EAG P GVVNI+PG G VVG+ LS HPDV KI+FTGST  G ++++ + 
Sbjct: 220 LSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMKVAA 279

Query: 256 KSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEF 315
            + +K VTLE GGKSP ++F DA+L++AVK  + GIF+NSG+ C A SRI +Q  +++E 
Sbjct: 280 DT-VKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEV 338

Query: 316 VHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYP 375
           + K KDYT+     G   DPFD++   G   S KQ  KI +Y+   +     +  +    
Sbjct: 339 LQKLKDYTE-SLKVG---DPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARL--VTGGA 392

Query: 376 PDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVF 435
                GYF+ PT++ +V  D +  KEE+FGP V +S+F   DE +++AND+ YGLAA + 
Sbjct: 393 RHGSKGYFVKPTVFADVKGDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIH 452

Query: 436 TENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTVQ 495
           T +I  A + ++ + AGTVW+NT N     +PFGGF  SGIGRE+G   + ++ QTK+V+
Sbjct: 453 TNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSVR 512

Query: 496 INIRKP 501
           I I KP
Sbjct: 513 IAIDKP 518

>Kwal_23.5911
          Length = 538

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/487 (44%), Positives = 305/487 (62%), Gaps = 13/487 (2%)

Query: 16  QPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKT 75
           QP GLFI+ EFV S      +  NP+T++++   Y   E DV+VA+ AA+ ++   WS  
Sbjct: 60  QPTGLFINGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAIAAAKRAFEDKWSTA 119

Query: 76  SPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKF 135
            PE R+  L KLA LV++  EILA IE+ D+GK    +   D+D++ K  +  AG  DK 
Sbjct: 120 DPEFRSRCLYKLADLVDQHAEILAGIESLDNGKSLLCSRT-DVDLVAKYLRSCAGWADKI 178

Query: 136 TTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSS 195
             G TI       +YTL+ P GV AQI+PWN+PL M SWKL   LA GNTVV+KP+E + 
Sbjct: 179 F-GRTIDTGSGHFSYTLREPLGVCAQIIPWNFPLLMWSWKLGPALATGNTVVLKPAEATP 237

Query: 196 LSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSG 255
           LS LY +QL+ EAG P GVVNI+PG+G ++G+ L TH DV KI+FTGST  G +++ ++ 
Sbjct: 238 LSALYASQLVQEAGIPAGVVNILPGFGKLLGERLCTHKDVKKIAFTGSTATGRHIM-RTA 296

Query: 256 KSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEF 315
              +K VTLE GGKSP ++F DA+LE+AV+  + GIFFNSG+ C A SR+ VQ  +++E 
Sbjct: 297 AGTIKKVTLELGGKSPNIVFADADLEKAVRNIAFGIFFNSGEVCCAGSRVYVQDTVYEEV 356

Query: 316 VHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC--PEGCPVEVSHIID 373
           + KFK YT+     G   DPF +    G   SQ Q +KI +Y+     EG  V    I  
Sbjct: 357 LEKFKAYTE-TLKVG---DPFQEGVFQGSQTSQMQIDKILDYVQVGTAEGARV----ITG 408

Query: 374 YPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAA 433
                  GYF+ PTI+ +V +D +  KEEIFGP V IS+F   DE + +AND+ YGLAA 
Sbjct: 409 GERHGDKGYFVKPTIFADVTEDMRIVKEEIFGPIVTISKFSTVDEVIEMANDSEYGLAAG 468

Query: 434 VFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKT 493
           + T+++  A + +  + AGTVW+NT N    ++PFGGF  SGIGRE+G   ++++ Q K 
Sbjct: 469 IHTKDVNKAIDVSNRVKAGTVWINTYNNFHQSVPFGGFGQSGIGREMGAEALDNYTQVKA 528

Query: 494 VQINIRK 500
           V++ I +
Sbjct: 529 VRMAIDR 535

>KLLA0C07777g complement(682962..684506) highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 aldehyde
           dehydrogenase (NAD+), mitochondrial, start by similarity
          Length = 514

 Score =  409 bits (1050), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 217/500 (43%), Positives = 312/500 (62%), Gaps = 14/500 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           +++P + ++  QP GLFI+ EFV S      +  NP+ +E++T  Y   E DV++AV AA
Sbjct: 26  VQLP-NGITYEQPTGLFINGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIAVAAA 84

Query: 65  RTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKL 124
           + ++   WS   PE R   LLKLA L+++  E LASIE+ D+GK  +  +  D+ ++ K 
Sbjct: 85  KKAFNNGWSTAEPEDRAKCLLKLADLIDQHAETLASIESLDNGKSLFC-SRGDVALVAKY 143

Query: 125 TKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGN 184
            +  AG  DK   G+ I    +  +YT + P GV  QI+PWN+PL M SWK+   LA GN
Sbjct: 144 LRSCAGWADKIY-GKVIDTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPALATGN 202

Query: 185 TVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGST 244
           TVV+KP+E + LS LY  QL+ EAG P GVVNIIPG+G +VG+ + THPD+ K++FTGST
Sbjct: 203 TVVLKPAEATPLSALYACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAFTGST 262

Query: 245 KVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSR 304
             G ++++    S +K VTLE GGKSP ++F DA+L++AVK  + GIF+NSG+ C A SR
Sbjct: 263 ATGRHIMKTCADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEVCCAGSR 321

Query: 305 ILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC--PE 362
           I VQ  +++E + KFK Y +     G   +PF+++   G   SQ Q +KI  Y+     E
Sbjct: 322 IYVQDTVYEEVLEKFKQYAE-SLKVG---NPFEENVFQGAQTSQMQIDKILSYVDVGTSE 377

Query: 363 GCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSL 422
           G  V    I         GYFI PTI+ +V +D +  KEEIFGP V +S+F   DE ++ 
Sbjct: 378 GARV----ITGGERIGNKGYFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEVVAK 433

Query: 423 ANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGR 482
           AND+ YGLAA + T+++  A + +  + AGTVW+NT N     +PFGGF  SGIGRE+G 
Sbjct: 434 ANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGA 493

Query: 483 TGVESFMQTKTVQINIRKPN 502
             ++++ QTK V++ I  PN
Sbjct: 494 EALDNYTQTKAVRMAIDHPN 513

>Sklu_2369.5 YER073W, Contig c2369 5264-6808
          Length = 514

 Score =  408 bits (1048), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/491 (43%), Positives = 309/491 (62%), Gaps = 13/491 (2%)

Query: 12  LSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKT 71
           ++  QP GLFI+ EFV S      +  NP+ +E++T  Y   E DV++AV AA+ ++   
Sbjct: 32  ITYEQPTGLFINGEFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVDIAVAAAKKAFDNG 91

Query: 72  WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGS 131
           WS   PE R   L KLA L+E++ E LA IE+ D+GK  + +   D+ ++ K  +  AG 
Sbjct: 92  WSTAEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFCSRG-DVALVSKYLRSCAGW 150

Query: 132 TDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPS 191
           +DK   G+ I    +  AYT + P GV  QI+PWN+PL M SWK+   LA GNTVV+KP+
Sbjct: 151 SDKLF-GKVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPA 209

Query: 192 ENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVL 251
           E + LS LY +QL  EAG P GVVNIIPG+G +VG+ L THP+V K++FTGST  G +++
Sbjct: 210 EATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVGERLCTHPEVKKVAFTGSTATGRHIM 269

Query: 252 EQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDI 311
           + +  S +K VTLE GGKSP ++F DA+L++AVK  + GIFFNSG+ C A SR+ VQ  +
Sbjct: 270 KTAADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFFNSGEVCCAGSRVYVQDTV 328

Query: 312 FDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEY--MTCPEGCPVEVS 369
           ++E + KFK+YT+     G   +PF+     G   S+ Q +KI  Y  +   EG  +   
Sbjct: 329 YEEVLQKFKEYTE-SLKVG---NPFEDGVFQGAQTSKMQIDKILSYVDIGTKEGARI--- 381

Query: 370 HIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYG 429
            I         GYFI PTI+ +V +D +  KEEIFGP V +S+F   DE +++AND+ YG
Sbjct: 382 -ITGGEKKGEKGYFIKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVIAMANDSEYG 440

Query: 430 LAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFM 489
           LAA + T+++  A + +  I AGT+W+NT NA   ++PFGGF  SGIGRE+G   ++++ 
Sbjct: 441 LAAGIHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREMGAEALDNYT 500

Query: 490 QTKTVQINIRK 500
           Q K V++ I K
Sbjct: 501 QVKAVRMAIDK 511

>CAGL0J03212g 307754..309307 highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 or sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4, start by
           similarity
          Length = 517

 Score =  402 bits (1034), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 211/502 (42%), Positives = 306/502 (60%), Gaps = 16/502 (3%)

Query: 5   IEIP---QHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAV 61
           +E+P    + +   QP GLFI+ EFVKS +G   D  NP+T+E + + Y     DV++AV
Sbjct: 25  LEVPVTLPNGIKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAV 84

Query: 62  RAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMI 121
           +AA+ ++   WS+  PE R   L  LA LVE + E LA I++ D+GK    +   D+ ++
Sbjct: 85  KAAKEAFENHWSREDPEVRARALFNLADLVEANLETLAGIDSLDNGKSLLCSRA-DVALV 143

Query: 122 IKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLA 181
            K  +   G  DK   G+ I        Y++K P GV  QI+PWN+PL M SWK+   LA
Sbjct: 144 AKYLRSCGGWADKIY-GDVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALA 202

Query: 182 AGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFT 241
            GNTVV+KP+E + LS L+ ++L  EAG P GVVNIIPG G  VG+ + THPD+ K++FT
Sbjct: 203 TGNTVVLKPAELTPLSALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFT 262

Query: 242 GSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTA 301
           GST  G  +++ +  S +K VTLE GGKSP ++F DA+LE+AV+  + GIFFNSG+ C A
Sbjct: 263 GSTATGSRIMKTAADS-IKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCA 321

Query: 302 NSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC- 360
            SRI VQ   +DE + + K YT+     G   +PF  +   G   SQ+Q +KI EY+   
Sbjct: 322 GSRIYVQDKCYDEVLDRLKKYTE-SLKVG---NPFGDNTYQGSQTSQQQLDKILEYVDIG 377

Query: 361 -PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419
             EG  +    +         GYF  PT++ +V ++ +  K+EIFGP V +S+F   DE 
Sbjct: 378 KQEGARI----VTGGERIGEKGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEV 433

Query: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479
           +++AND+ YGLAA + T ++  A E +  + AGT+W+NT NA    +PFGGF  SGIGRE
Sbjct: 434 IAMANDSQYGLAAGIHTNDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGRE 493

Query: 480 LGRTGVESFMQTKTVQINIRKP 501
           +G   ++++ Q K+V++ I KP
Sbjct: 494 MGSAALDNYTQVKSVRMAITKP 515

>Kwal_27.11976
          Length = 526

 Score =  401 bits (1030), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/491 (43%), Positives = 304/491 (61%), Gaps = 11/491 (2%)

Query: 10  HHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYT 69
           + L+  QP GLFI+NEFVKS +G  I   +PAT++K+    +G++ DV  AV  A  ++ 
Sbjct: 44  NGLTYEQPTGLFINNEFVKSHNGATIAVEDPATEKKIVEVQSGTKEDVEYAVECAEKAFN 103

Query: 70  KTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFA 129
            +WS   P  R   LLKLA L+E+ KE+++SIE  D+GK  +  A  D+ ++I   +  A
Sbjct: 104 SSWSTGDPRVRARALLKLADLIEQRKELISSIECMDNGKALFL-AKNDVRIVIDYIRSSA 162

Query: 130 GSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIK 189
           G  DK   G TI      + YTL+ P GV  QI+PWN+PL M SWK+   LAAGNTV++K
Sbjct: 163 GFADKLD-GRTINTGDGYVNYTLREPVGVCGQIIPWNFPLLMLSWKIAPALAAGNTVILK 221

Query: 190 PSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCN 249
           P+  + L+ LYFA L  EAG P GVVNIIPG G  VG+ L+THP + KI+FTGST  G  
Sbjct: 222 PASPTPLNALYFASLCKEAGIPAGVVNIIPGPGRDVGETLTTHPKIRKIAFTGSTGTGKG 281

Query: 250 VLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQH 309
           +  ++ +SNLK VTLE GGKS  ++F DANLE+ +     GIF N+GQ C++ SRI VQ 
Sbjct: 282 IAVKAAQSNLKKVTLELGGKSAHMVFNDANLEKTIPNLVNGIFLNAGQICSSGSRIYVQE 341

Query: 310 DIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC--PEGCPVE 367
            I+D+ +  FK Y +     GS   PFD+    G + ++ Q++ I  Y+     EG  V 
Sbjct: 342 GIYDKLLPAFKKYVEEVITVGS---PFDESNFQGAINNKAQFDTIMNYVGIGKEEGAKV- 397

Query: 368 VSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTS 427
              +         GYFI PTI+ +V +D +  KEEIFGP V IS+F++ ++ +++AN++ 
Sbjct: 398 ---LTGGKRSGDQGYFIRPTIFYDVNEDMRIVKEEIFGPVVTISKFKEIEDGVAMANNSE 454

Query: 428 YGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVES 487
           +GL A + TE++  A + ++ + AGTVWVNT N  D ++PFGG K SG G E+G    +S
Sbjct: 455 FGLGAGIQTESVSTALKVSKMLKAGTVWVNTYNDFDSSVPFGGCKQSGYGSEMGIEAFDS 514

Query: 488 FMQTKTVQINI 498
           +  TK V+I +
Sbjct: 515 YTTTKAVRIKL 525

>Sklu_2315.3 YPL061W, Contig c2315 5950-7455
          Length = 501

 Score =  399 bits (1026), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/494 (42%), Positives = 303/494 (61%), Gaps = 8/494 (1%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I +P + LS  QP GLFI+NEF+KS D   +   NP+T+E +   Y+ ++ DV  AV  A
Sbjct: 15  ITLP-NGLSYEQPTGLFINNEFIKSQDQKTLKVENPSTEEIVAEVYSATKDDVEYAVECA 73

Query: 65  RTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKL 124
             ++  +WS   P  R   L KLA+LVE  KE+++SIE  D+GK     A  D+ +++  
Sbjct: 74  DKAFNSSWSTCDPRIRASYLFKLANLVEERKELISSIEALDNGKTLAL-ARGDVGLVVDY 132

Query: 125 TKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGN 184
            K  AG  DK   G TI      + YTL+ P GV  QI+PWN+PL M SWK+   LAAGN
Sbjct: 133 LKIAAGYADKLG-GRTINTGEGYVNYTLREPVGVCGQIIPWNFPLMMLSWKIAPALAAGN 191

Query: 185 TVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGST 244
           TVV+KP+  + L+ LYFA L  E G P GVVNI+PG G  VGD ++ HP + KI+FTGST
Sbjct: 192 TVVLKPASPTPLNALYFASLCKEVGIPDGVVNIVPGPGRSVGDTITNHPKIRKIAFTGST 251

Query: 245 KVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSR 304
           ++G +V  ++  SNLK VTLE GGKS  ++F D  LE+ ++    GIF N+GQ C++ SR
Sbjct: 252 EIGRDVAIKAAASNLKKVTLELGGKSAHLVFDDCKLEKTLQNLVNGIFKNAGQICSSGSR 311

Query: 305 ILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGC 364
           I VQ  I D  +  FK+Y +     GS   PFD+    G + ++ Q++ +  Y+   +  
Sbjct: 312 IYVQEGIHDRLLAAFKEYLENNIKVGS---PFDESNYQGAINNKSQFDTVINYINIGKEE 368

Query: 365 PVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLAN 424
             ++    +   D   GYFI PT++ +V +D +  KEEIFGP V IS+F+D ++ +++AN
Sbjct: 369 GAKLLTGGERVGD--KGYFIRPTVFYDVKEDMRIVKEEIFGPVVTISKFKDIEDGVAMAN 426

Query: 425 DTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTG 484
           D+ +GL A + TEN+  A + ++ + AGTVWVNT N  D ++PFGG K SG GRE+G   
Sbjct: 427 DSEFGLGAGIETENLSTALKVSKMLKAGTVWVNTYNDFDASVPFGGCKQSGYGREMGEEV 486

Query: 485 VESFMQTKTVQINI 498
            E++ Q K V+I +
Sbjct: 487 FEAYTQVKAVRIKL 500

>Scas_663.4
          Length = 520

 Score =  399 bits (1025), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/496 (42%), Positives = 307/496 (61%), Gaps = 11/496 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I++P + L   QP GLFI+N+ V S  G   +  NP+T++++   Y G E DV++AV+AA
Sbjct: 34  IKLP-NGLEFEQPTGLFINNKNVPSKQGKTFEVINPSTEDEICHIYEGREDDVDIAVKAA 92

Query: 65  RTSYTK-TWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             ++   +WS   P  R   L KLA L+E+DKEI+ASIE+ D+GK    +A  D+++++ 
Sbjct: 93  SDAFNNGSWSTIDPIYRGQALYKLAELIEKDKEIIASIESLDNGKAI-NSARGDVELVVN 151

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             K  AG  +K   G  I        YT + P GV  QI+PWN+PL M +WK+   L  G
Sbjct: 152 YLKSSAGMANKLD-GRLIDSGSNYFNYTKREPLGVCGQIIPWNFPLLMWAWKIAPALITG 210

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY A+ I EAG PPGVVNI+ G+G +VG+A+++HP + KI+FTGS
Sbjct: 211 NTVVLKTAESTPLSALYAAKYIPEAGIPPGVVNIVSGFGKIVGEAMTSHPLIKKIAFTGS 270

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++  Q+  ++LK VTLE GGKSP +IF DANL++AV+    GI++NSG+ C A S
Sbjct: 271 TATGKHIY-QNAAASLKKVTLELGGKSPNIIFADANLKKAVQNVITGIYYNSGEVCCAGS 329

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ VQ  I+DE + + K  ++         DPFD+    G   SQ Q  KI +Y+   + 
Sbjct: 330 RVYVQESIYDELIEEIKAASEAV----KVGDPFDETTFQGAQTSQMQLNKILKYVEIGKN 385

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
              ++  I         GYF+ PTI+  V +D +  KEEIFGP V IS+F+  DE + +A
Sbjct: 386 EGAQL--ITGGERVGKKGYFVKPTIFGGVQEDMRIVKEEIFGPVVTISKFKTLDEVVQMA 443

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA + T NI  A + A  + AGTVW+NT N     +PFGGF  SG+GRE+G  
Sbjct: 444 NDSEYGLAAGIHTSNINTATKVADRLKAGTVWINTYNDFHCNVPFGGFNASGLGREMGTE 503

Query: 484 GVESFMQTKTVQINIR 499
            +E+++Q+K V+  + 
Sbjct: 504 ALENYLQSKAVRCRLE 519

>Scas_701.14
          Length = 515

 Score =  398 bits (1022), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/492 (44%), Positives = 307/492 (62%), Gaps = 14/492 (2%)

Query: 12  LSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKT 71
           L   QP GLFI+ +FV S      +  NP+T+E +T  Y   E DV++AV AA+ +  K+
Sbjct: 34  LKYEQPTGLFINGDFVPSKQNKIFEVINPSTEEVITPVYEAMEDDVDIAVAAAKKA-FKS 92

Query: 72  WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGS 131
           WS   PE R   L KLA+LVE++ E+LASIET D+GK     +  D+ ++ K  +   G 
Sbjct: 93  WSIADPEVRASALFKLANLVEKNAELLASIETADNGKSLLC-SRGDVALVSKYLRSCGGW 151

Query: 132 TDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPS 191
            DK   G  I       AYT + P GV  QI+PWN+PL M SWK+   LA GNTVV+KP+
Sbjct: 152 ADKIN-GNVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPA 210

Query: 192 ENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVL 251
           E + LS L+ +QL +EAG P GVVNIIPG G VVG+ L  HPDV KI+FTGSTK G +++
Sbjct: 211 ETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVGEKLCKHPDVKKIAFTGSTKTGSHIM 270

Query: 252 EQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDI 311
           + +  + +K VTLE GGKSP ++F DA+L++A++  + GIF+NSG+ C A SRI VQ  +
Sbjct: 271 KTAADT-VKKVTLELGGKSPNIVFADADLDKAIENIAFGIFYNSGEVCCAGSRIYVQDTV 329

Query: 312 FDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC--PEGCPVEVS 369
           +D  ++KFK YT+     G   DPFD+    G   S+ Q  KI +Y+     EG  V   
Sbjct: 330 YDTVLNKFKKYTEN-LKVG---DPFDESTFQGAQTSKAQLTKILKYVKVGTDEGARV--- 382

Query: 370 HIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYG 429
            +         GYF+ PTI+ +V +D +  KEE+FGP V IS+F   DE + +AND+ YG
Sbjct: 383 -VTGGERFGNKGYFVKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEVIDMANDSQYG 441

Query: 430 LAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFM 489
           LAA + T+++  A   ++ I AGTVW+NT NA    +PFGGF  SGIGRE+G   ++++ 
Sbjct: 442 LAAGIHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGREMGAAALDNYT 501

Query: 490 QTKTVQINIRKP 501
           Q K+V++ I KP
Sbjct: 502 QVKSVRMAIEKP 513

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score =  395 bits (1015), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/495 (43%), Positives = 310/495 (62%), Gaps = 11/495 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I++P + +   QP GLFI+N+FV S  G   +  +P+T+E++   Y G E DV++AV AA
Sbjct: 33  IKLP-NGIEYEQPTGLFINNKFVPSKQGKTFEVISPSTEEEICHIYEGREEDVDLAVEAA 91

Query: 65  RTSYTK-TWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             ++   +WS   P  R + L KLA L+E+DKE +ASIE+ D+GK   T+A  DI +++ 
Sbjct: 92  DKAFKNGSWSTVDPLVRANALNKLADLIEKDKETIASIESLDNGKAI-TSARGDISLVVN 150

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             +  AG  DK   G  I       +YT + P  V  QI+PWN+PL M +WK+   LA G
Sbjct: 151 YLRSSAGYADKID-GRLINTGSTHFSYTRREPLCVCGQIIPWNFPLLMWAWKIAPALATG 209

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY +Q I +AG PPGVVNI+ G+G +VG+A++THP + K++FTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSQYIPKAGIPPGVVNIVSGFGKIVGEAITTHPKIKKVAFTGS 269

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++ + +G  NLK VTLE GGKSP +IF DANL+EAVK    GI+FNSG+ C A S
Sbjct: 270 TATGRHIYQNAG-VNLKKVTLELGGKSPNIIFADANLKEAVKNVILGIYFNSGEVCCAGS 328

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ V+  I+D+ V + K  ++     G   DPFD+    G   SQ Q +KI +Y+    G
Sbjct: 329 RVYVEESIYDKAVEEIKAASE-AVKVG---DPFDESTFQGAQTSQNQLDKILKYVEI--G 382

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                + +         GYFI PTI+++V ++ +  KEEIFGP V I++F+D ++ +  A
Sbjct: 383 RKEGATLVTGGERLGDKGYFIKPTIFSDVEENMRIVKEEIFGPVVTITKFKDVEDLVEKA 442

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA + T NI  A   +  + AGTVW+NT N    ++PFGGF  SGIGRE+G  
Sbjct: 443 NDSEYGLAAGIHTSNINNAINVSNRLNAGTVWINTFNDFHHSVPFGGFNASGIGREMGSE 502

Query: 484 GVESFMQTKTVQINI 498
            ++++ Q K V++ +
Sbjct: 503 ALDNYTQVKAVRVKL 517

>CAGL0D06688g 639883..641457 highly similar to sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4 or sp|P40047
           Saccharomyces cerevisiae YER073w ALD5, hypothetical
           start
          Length = 524

 Score =  395 bits (1015), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 210/495 (42%), Positives = 305/495 (61%), Gaps = 11/495 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I++P + L   QP GLFI+N+FV S      +  NP+T+E++   Y G E DV  AV+AA
Sbjct: 39  IKLP-NGLEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQAA 97

Query: 65  RTSYTK-TWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
            T++   +W+   P +R   L KLA L+E+DKEI+ASIE+ D+GK    +A  D+ ++I 
Sbjct: 98  DTAFKNGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAI-NSARGDVQLVIN 156

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             K  AG  DK   G  +        Y  K P GV  QI+PWN+PL M +WK+   L  G
Sbjct: 157 YLKSSAGVADKID-GRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTG 215

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY ++ I +AG PPGV+NI+ G+G +VG+AL+THP + KI+FTGS
Sbjct: 216 NTVVLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIAFTGS 275

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++   + ++ LK VTLE GGKSP ++F DA+L++AV+    GI++NSG+ C A S
Sbjct: 276 TATGKHIYSSAAQT-LKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVCCAGS 334

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ V+  I+DEF  +FK  ++     G   +PFD+    G   SQ Q +KI  Y+    G
Sbjct: 335 RVYVEESIYDEFAQEFKTASE-ALKVG---NPFDESTFQGAQTSQMQLDKILSYVEI--G 388

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                + I         GYFI PTI+ +V +D +  KEEIFGP V +++F+D D  + +A
Sbjct: 389 KKEGATLITGGERIGEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHVVQMA 448

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA + T NI  A + A  + AGTVWVNT N     +PFGGF  SG+GRE+ + 
Sbjct: 449 NDSEYGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGREMSKE 508

Query: 484 GVESFMQTKTVQINI 498
            ++ ++Q K V++ +
Sbjct: 509 ALDGYLQAKAVRVKL 523

>Kwal_26.6752
          Length = 522

 Score =  395 bits (1014), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 214/495 (43%), Positives = 305/495 (61%), Gaps = 11/495 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           +++P + +   QP GLFI+N+FV++  G   +  +PAT+E++T  Y   E DV  A+ AA
Sbjct: 33  VKMP-NGIEYEQPTGLFINNKFVRAKQGKTFEVISPATEEEITHVYEAREDDVEDAIAAA 91

Query: 65  RTSY-TKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             ++ +  WS+  P  R   L KLA L+E D E +ASIET D+GK   T+A  D+ ++  
Sbjct: 92  DQAFKSGVWSQVDPLVRAKALNKLAELIEDDLETIASIETLDNGKAI-TSARGDVQLVAN 150

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             +  AG  DK   G  I       +YT++ P GV  QI+PWN+PL M +WK+   LA G
Sbjct: 151 YLRSCAGWCDK-VDGRLINTGSTHFSYTVRQPLGVCGQIIPWNFPLLMWAWKVGPALATG 209

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY +Q I +AG PPGVVNII G+G ++G+AL+THP + KI+FTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSQFISKAGIPPGVVNIISGFGKIIGEALTTHPKIKKIAFTGS 269

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++ + +G SNLK VTLE GGKSP ++F DA+L++AV+    GI++NSG+ C A S
Sbjct: 270 TATGRHIYQNAG-SNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGEVCCAGS 328

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ V+  ++D+F+ +FK   +         DPFD     G   SQ Q  KI +Y+    G
Sbjct: 329 RVYVEESVYDQFLEEFKAAAENV----KVGDPFDDATFQGAQTSQMQLSKILKYVEI--G 382

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                + +         G+FI PTI+ NV +D +  KEEIFGP V +S+F+  DE +  A
Sbjct: 383 KEEGATLVTGGERIGNKGFFIKPTIFGNVEEDMRIVKEEIFGPVVTVSKFKTIDELIEKA 442

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA V T +I  A E +  + AGTVWVNT N     +PFGGF  SGIGRE+G  
Sbjct: 443 NDSEYGLAAGVHTSDINKALEVSNRVNAGTVWVNTFNDFHHCVPFGGFNASGIGREMGSE 502

Query: 484 GVESFMQTKTVQINI 498
            ++S+ Q K V+I +
Sbjct: 503 ALDSYTQVKAVRIKL 517

>CAGL0H05137g complement(495715..497208) highly similar to sp|P54115
           Saccharomyces cerevisiae YPL061w ALD6, hypothetical
           start
          Length = 497

 Score =  392 bits (1008), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/501 (42%), Positives = 311/501 (62%), Gaps = 17/501 (3%)

Query: 3   KTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVR 62
           KTI++P + L+  QP GLFI+NEFV+SSDG  +   NP+T+E +   ++ ++ DV+ AV 
Sbjct: 9   KTIKLP-NGLTYEQPTGLFINNEFVESSDGKTMTIENPSTQEPIVDVFSATKEDVDYAVD 67

Query: 63  AARTSYTKT-WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALL--DID 119
            A  ++ K+ W+   P+ R   L KLA L+E   E++ASIET D+GK   T AL   D+ 
Sbjct: 68  CAERAFEKSDWATQDPKVRARYLSKLADLMEEQLELIASIETLDNGK---TIALSRGDVQ 124

Query: 120 MIIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSC 179
           + I   +  A   DK   G +I      + YT++ P GV AQI+PWN+PL M SWK+   
Sbjct: 125 LSINCIRDAASYADK-VDGRSIDTGDGYMNYTIREPIGVCAQIIPWNFPLMMLSWKVGPA 183

Query: 180 LAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKIS 239
           LA GN +V+KP+  + L+ LYF+ L  + G P GVVNIIPG G +VG AL+THP V K++
Sbjct: 184 LAMGNCIVLKPASATPLNALYFSSLCKQVGIPAGVVNIIPGPGGMVGTALTTHPKVRKVA 243

Query: 240 FTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNC 299
           FTGST +G ++  ++  SNLK +TLE GGKS  ++F DANLE+ +     GIF N+GQ C
Sbjct: 244 FTGSTDIGKDIAVKASASNLKKITLELGGKSAHLVFNDANLEKTLPNLVNGIFKNAGQIC 303

Query: 300 TANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMT 359
           ++ SRI  Q  I+D  + +FK Y ++    G   +PFD+    G + +++QY  I +Y+ 
Sbjct: 304 SSGSRIYAQAGIYDRLLKEFKAYIEKNIKVG---NPFDESNFQGAITNKEQYNTILKYIN 360

Query: 360 C--PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYD 417
               EG  V    +         GYFI PT++ +V +D +  KEEIFGP V IS+F + +
Sbjct: 361 IGKEEGAKV----LTGGETAAEKGYFIKPTVFYDVKEDMRVVKEEIFGPCVTISKFEEIE 416

Query: 418 EALSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIG 477
           + +++AND+ +GL A + TEN+  A + A+ + +GTVW+NT N  D  +PFGG+K SG G
Sbjct: 417 DGVAMANDSEFGLGAGIETENLSTALKVAKMLHSGTVWINTYNDFDSRVPFGGYKQSGYG 476

Query: 478 RELGRTGVESFMQTKTVQINI 498
           RE+G    E + QTK V+I +
Sbjct: 477 REMGSEVYECYTQTKAVRIKL 497

>KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomyces
           cerevisiae YOR374w ALD4 aldehyde dehydrogenase,
           mitochondrial, start by similarity
          Length = 522

 Score =  392 bits (1008), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 207/496 (41%), Positives = 309/496 (62%), Gaps = 11/496 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           +++P + +S  QP GLFI+N+FV S  G   +  +P+T+E++T  Y G E DV+ AV AA
Sbjct: 37  VDLP-NGISYEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEAA 95

Query: 65  RTSY-TKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             ++ +  WSK  P  R+  L KLA  +E+D + +ASIE+ D+GK   ++A  D+ +++ 
Sbjct: 96  DKAFKSGVWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAI-SSAKGDVQLVVN 154

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             +  AG  DK   G  I       +YT++ P GV  QI+PWN+PL M +WK+   LA G
Sbjct: 155 YLRSAAGYADK-VDGRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALATG 213

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY +Q I +AG P GVVNI+ G+G +VG+A++THP + K++FTGS
Sbjct: 214 NTVVLKTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVAFTGS 273

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++ + +G  NLK VTLE GGKSP V+F DANL+ AV+ +  GI++NSG+ C A S
Sbjct: 274 TATGRHIYQNAG-VNLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGEVCCAGS 332

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ V+  I+D+F+ + K  ++     G   DPFD +   G   SQ Q +KI +Y+    G
Sbjct: 333 RLYVEESIYDDFLKEIKSASE-ALKVG---DPFDAETFQGAQTSQNQLDKILKYVEI--G 386

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                + I         GYF+ PTI+ +V +  +  KEEIFGP V +++F+  DE +  A
Sbjct: 387 KNEGATLITGGERIGDKGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDELIEKA 446

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA + T NI  A + +  + AGTVW+NT N     +PFGGF  SGIGRE+G  
Sbjct: 447 NDSEYGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGREMGSE 506

Query: 484 GVESFMQTKTVQINIR 499
            ++++ Q K V++ + 
Sbjct: 507 ALDNYTQVKAVRVKLE 522

>YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial
           aldehyde dehydrogenase [1560 bp, 519 aa]
          Length = 519

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 307/495 (62%), Gaps = 11/495 (2%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I++P + L   QP GLFI+N+FV S      +  NP+T+E++   Y G E DV  AV+AA
Sbjct: 33  IKLP-NGLEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAA 91

Query: 65  RTSYTK-TWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             +++  +W+   P  R   L +LA L+E+DK+++ASIET D+GK   +++  D+D++I 
Sbjct: 92  DRAFSNGSWNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAI-SSSRGDVDLVIN 150

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             K  AG  DK   G  I       +YT + P GV  QI+PWN+PL M +WK+   L  G
Sbjct: 151 YLKSSAGFADKID-GRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTG 209

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV+K +E++ LS LY ++ I +AG PPGV+NI+ G+G +VG+A++ HP + K++FTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGS 269

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T  G ++  QS  + LK VTLE GGKSP ++F DA L++AV+    GI++NSG+ C A S
Sbjct: 270 TATGRHIY-QSAAAGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGS 328

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           R+ V+  I+D+F+ +FK  ++     G   DPFD+    G   SQ Q  KI +Y+    G
Sbjct: 329 RVYVEESIYDKFIEEFKAASE-SIKVG---DPFDESTFQGAQTSQMQLNKILKYVDI--G 382

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
                + I         GYFI PT++ +V +D +  KEEIFGP V +++F+  DE +++A
Sbjct: 383 KNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMA 442

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           ND+ YGLAA + T NI  A + A  + AGTVW+NT N     +PFGGF  SG+GRE+   
Sbjct: 443 NDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVD 502

Query: 484 GVESFMQTKTVQINI 498
            +++++Q K V+  +
Sbjct: 503 ALQNYLQVKAVRAKL 517

>ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH]
           complement(1457469..1458992) [1524 bp, 507 aa]
          Length = 507

 Score =  380 bits (975), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 210/495 (42%), Positives = 301/495 (60%), Gaps = 15/495 (3%)

Query: 4   TIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRA 63
           TI++P + +   QP GLFI+NEFV+S  G  ++   PAT+E +T  Y G+  DV++AV A
Sbjct: 21  TIKLP-NGVEYEQPTGLFINNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVDIAVSA 79

Query: 64  ARTSY-TKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMII 122
           A+ ++ +  W    P  R   L KLA L+E D E++ASIE  D+GK  +++A  DI M++
Sbjct: 80  AQKAFKSGKWFGADPMVRVKALSKLADLIEEDLEVIASIEFLDNGK-VFSHARFDIGMVV 138

Query: 123 KLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAA 182
              +  AG  DK   G +I      L YT + P GV  QI+PWN+PL M +WK+   LA 
Sbjct: 139 NYLRCCAGLADK-VDGRSIDTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVGPALAT 197

Query: 183 GNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTG 242
           GNTVV+K +E + LS LY +  + +AG P GVVNII GYG  VG+A+  HP V KI+FTG
Sbjct: 198 GNTVVLKTAEFTPLSALYVSNHVRKAGIPAGVVNIISGYGKTVGEAIIRHPGVKKIAFTG 257

Query: 243 STKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTAN 302
           ST  G ++ E + K +LK V+LE GGKSP +IF DA+L++A +     IFFN G+ C A 
Sbjct: 258 STATGRHIYEVAAK-DLKKVSLELGGKSPNIIFADADLKKAAQNVLNSIFFNGGEVCCAG 316

Query: 303 SRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC-- 360
           SR+ ++  I++EF+ + K   +         DP  KD   G   SQ Q +KI  Y+    
Sbjct: 317 SRMYIEEPIYEEFLQEIKAVAESV----KVGDPSWKDTFQGAQTSQMQLDKILSYIEIGK 372

Query: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420
            EG  V    +         GY++ PTI+ +V +D +  KEEIFGP V +++F + D+ L
Sbjct: 373 QEGARV----VTGGERLGEKGYYVKPTIFADVREDMRIVKEEIFGPVVTVTKFTNIDDLL 428

Query: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGREL 480
            +ANDT YGLAA V++ +++ A + A  + AGTVW+NT N    ++PFGG+K SG GRE+
Sbjct: 429 EMANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINTYNDFHCSVPFGGYKGSGFGREM 488

Query: 481 GRTGVESFMQTKTVQ 495
           G   VE++ Q K V+
Sbjct: 489 GAEVVENYTQVKAVR 503

>Scas_664.24
          Length = 499

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/500 (40%), Positives = 303/500 (60%), Gaps = 18/500 (3%)

Query: 4   TIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRA 63
           TI +P + ++  QP GLFI+NEF+KS D   I   NPAT E +    +G+  DV  AV +
Sbjct: 13  TITLP-NGITYNQPTGLFINNEFMKSQDYKTIKVENPATAEIVCEVSSGTSEDVEYAVES 71

Query: 64  ARTSYTKT-WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALL--DIDM 120
           A  ++  T W+   P+ R   L KLA L+E + E++ASIET D+GK   T AL   D+ +
Sbjct: 72  AEHAFNDTDWATQDPKIRGRYLSKLADLMEENLELMASIETLDNGK---TLALSRGDVGL 128

Query: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180
            I   +  A   DK   G TI      + +T+K P GV  QI+PWN+PL M SWK+   L
Sbjct: 129 AINCIRDAASYADKIN-GRTINSGDGYMNFTVKEPIGVCGQIIPWNFPLMMLSWKIAPAL 187

Query: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           A GN +++KP+  + L+ L+FA L  + G P GVVNIIPG G  VG+A++THP + K +F
Sbjct: 188 AMGNVIILKPASATPLNALFFASLCKKVGIPAGVVNIIPGPGRTVGNAITTHPRIRKAAF 247

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
           TGST++G ++  ++  SNLK +TLE GGKS  ++F DAN+E+ +     GIF N+GQ C+
Sbjct: 248 TGSTEIGKDIAIKASGSNLKKITLELGGKSAHLVFDDANIEKTLPNLVNGIFKNAGQICS 307

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTC 360
           + SRI VQ  I+D+ +  FK Y +     G   DPFD+    G + +++QYE I +Y+  
Sbjct: 308 SGSRIYVQEGIYDKLMPAFKKYVEN-LKVG---DPFDESNFQGAITNREQYETILKYIKI 363

Query: 361 --PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDE 418
              EG  +    +         GYFI PTI+ +V +D +  +EEIFGP V +S+F+D ++
Sbjct: 364 GKEEGAKI----LTGGETIGNKGYFIKPTIFYDVKEDMEIVREEIFGPVVTVSKFKDIED 419

Query: 419 ALSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGR 478
            +++AN + +GL A + TEN+  A + A+ + +GTVW+NT N  D  +PFGG K SG GR
Sbjct: 420 GVAMANASEFGLGAGIETENLSTALKVAKMLKSGTVWINTYNDFDSRVPFGGVKQSGYGR 479

Query: 479 ELGRTGVESFMQTKTVQINI 498
           E+G    + + + K ++I +
Sbjct: 480 EMGEEVYDCYTEVKAIRIKL 499

>ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH]
           complement(286308..287849) [1542 bp, 513 aa]
          Length = 513

 Score =  363 bits (931), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/488 (41%), Positives = 297/488 (60%), Gaps = 14/488 (2%)

Query: 13  SIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTW 72
           S  QP GLFI  +FV S      +  +P T+E++T  Y   E DV+ AV AA+ ++   W
Sbjct: 33  SYEQPTGLFIDGKFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVDAAVAAAKRAFLP-W 91

Query: 73  SKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGST 132
           S+  PE R   L KLA L+E+ +E LA+IE+ D+GK     +  D+ ++ +  +   G  
Sbjct: 92  SRADPEVRAQCLFKLADLIEKHQETLANIESLDNGKSLLC-SRGDVALVARYLRTCGGWA 150

Query: 133 DKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSE 192
           DK   G  +    +  +YT + P GV  QI+PWN+PL M SWK+   LA GNTVV+KP+E
Sbjct: 151 DKIY-GNVMETGPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAE 209

Query: 193 NSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLE 252
           ++ LS LY   L  EAG P GV+NI+PG+G +VG+ L THPDV K++FTGST  G +++ 
Sbjct: 210 STPLSALYVCNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKKVAFTGSTATGRHIMR 269

Query: 253 QSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIF 312
              ++ +K VTLE GGKSP ++F DA++++AVK    GIF+N+G+ C A SR+ VQ  ++
Sbjct: 270 TCAET-VKKVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGEVCCAGSRVYVQDSVY 328

Query: 313 DEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEY--MTCPEGCPVEVSH 370
           DE + KFK +++     G   +PF++    G   SQ Q +KI  Y  +   EG  +    
Sbjct: 329 DEVLEKFKQFSE-NLKVG---NPFEEGVFQGAQTSQMQVDKILSYVDIGVKEGARI---- 380

Query: 371 IIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGL 430
           +         G+FI PTI+ +V ++ +  K+EIFGP V +S+F   DE +++AN++ YGL
Sbjct: 381 VAGGERLGRKGFFIKPTIFADVNENMRVVKDEIFGPVVTVSKFSTVDEVIAMANNSQYGL 440

Query: 431 AAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQ 490
           AA + T +I  A + +  I AGTVWVNT N     +PFGGF  SGIG E+G   ++++ Q
Sbjct: 441 AAGIHTTDINKAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFGQSGIGSEMGVQALDNYTQ 500

Query: 491 TKTVQINI 498
           TK V++ I
Sbjct: 501 TKAVRMAI 508

>YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldehyde
           dehydrogenase [1503 bp, 500 aa]
          Length = 500

 Score =  342 bits (877), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/495 (37%), Positives = 289/495 (58%), Gaps = 9/495 (1%)

Query: 5   IEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAA 64
           I +P + L+  QP GLFI+N+F+K+ DG      +P+T+  +    + +  DV  A+  A
Sbjct: 14  ITLP-NGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECA 72

Query: 65  RTSYTKT-WSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIK 123
             ++  T W+   P +R  LL KLA  +E   ++++SIE  D+GK     A  D+ + I 
Sbjct: 73  DRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLAL-ARGDVTIAIN 131

Query: 124 LTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAG 183
             +  A   DK   G TI      + +T   P GV  QI+PWN+P+ M +WK+   LA G
Sbjct: 132 CLRDAAAYADK-VNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMG 190

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           N  ++KP+  + L+ LYFA L  + G P GVVNI+PG G  VG AL+  P + K++FTGS
Sbjct: 191 NVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTGS 250

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANS 303
           T+VG +V   S +SNLK +TLE GGKS  ++F DAN+++ +     GIF N+GQ C++ S
Sbjct: 251 TEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGS 310

Query: 304 RILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEG 363
           RI VQ  I+DE +  FK Y + +   G   +PFDK    G + +++Q++ I  Y+   + 
Sbjct: 311 RIYVQEGIYDELLAAFKAYLETEIKVG---NPFDKANFQGAITNRQQFDTIMNYIDIGKK 367

Query: 364 CPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLA 423
              ++    +   D   GYFI PT++ +V +D +  KEEIFGP V +++F+  +E + +A
Sbjct: 368 EGAKILTGGEKVGD--KGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEEGVEMA 425

Query: 424 NDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRT 483
           N + +GL + + TE++    + A+ + AGTVW+NT N  D  +PFGG K SG GRE+G  
Sbjct: 426 NSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEE 485

Query: 484 GVESFMQTKTVQINI 498
              ++ + K V+I +
Sbjct: 486 VYHAYTEVKAVRIKL 500

>KLLA0F12628g complement(1170396..1171910) similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase P9.1.f7. 1, start by
           similarity
          Length = 504

 Score =  251 bits (642), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/478 (32%), Positives = 253/478 (52%), Gaps = 13/478 (2%)

Query: 21  FISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQR 80
           FI+ ++ ++ D  +    NP+T + +        +D N A+  A  ++  T+ +T+  +R
Sbjct: 32  FINGKWTETDD--KFAVTNPSTGDTIREVTNCGVSDFNKAIEIAHDAFG-TFRQTNVRER 88

Query: 81  TDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGET 140
             +L  + +L+  +K+ LA I T ++GKPY  ++L +I       K+FA    +   G+ 
Sbjct: 89  AQILDNIYNLMLENKQDLAKILTLENGKPY-KDSLGEIVYSAMFFKWFAEEAPRIY-GDI 146

Query: 141 IP--IDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSL 198
           IP  +  +   +T++ P GV+  + PWN+P AM + KL   +A GNT VIKP+  + LS 
Sbjct: 147 IPSAVSSDQKIFTIRQPLGVIGILTPWNFPSAMIARKLAPVIATGNTCVIKPAHETPLSA 206

Query: 199 LYFAQLIVEAGFPPGVVNIIP-GYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKS 257
           L    +  +AG P GV NI+P  + + +G+ +  H  V KI+FTGSTK+G  ++ QS K 
Sbjct: 207 LALGVIAEKAGLPAGVCNILPTNHTSEIGEYVCEHELVKKITFTGSTKIGQLLMGQSSKG 266

Query: 258 -NLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFV 316
            N+K  ++E GG +P ++FKDA+L+ A+       F  SGQ C   +RI V  D++DEF 
Sbjct: 267 KNIKKFSMELGGNAPYIVFKDADLDRALDGIIGCKFRQSGQTCICANRIFVHEDLYDEFS 326

Query: 317 HKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPP 376
            +  D   + +  G   D F    T GP+I  K  +K+   +   +    +V  I     
Sbjct: 327 KRLVDKIDKTFKLG---DGFQDGVTHGPLIHDKSIDKVASLVQDAKTKGADV-LIGGSRA 382

Query: 377 DDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVFT 436
             +   F  PT+  NV +      EEIFGP   + +F+D DE +  ANDT  GLA   ++
Sbjct: 383 SSLGPLFYQPTVLGNVTESMDIFYEEIFGPVAPLIKFKDVDEVIKRANDTDVGLAGYFYS 442

Query: 437 ENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTV 494
           +NI    + A  +  G V VNT    +  +PFGG K SG+G+E  + G++ + + K +
Sbjct: 443 QNISTIFDAAEKLNVGMVGVNTGEISEPAVPFGGVKNSGLGKEGSKYGIDDYTELKAI 500

>Sklu_2087.3 , Contig c2087 4336-5856
          Length = 506

 Score =  248 bits (634), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/463 (32%), Positives = 244/463 (52%), Gaps = 16/463 (3%)

Query: 39  NPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEIL 98
           NP+T+E++         + N A+  A+ S+ KT  +TS  +R+ +L  +  L++  K+ L
Sbjct: 49  NPSTQEEIAQIANCGVGEYNNAINFAQQSF-KTHRETSLRERSQILYNIYDLIQEHKKDL 107

Query: 99  ASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGETIPIDHETLA--YTLKVPF 156
           A + T ++GKP   ++L +I+      ++FA    +   G  IP    +    +T++ P 
Sbjct: 108 ARLITLENGKPI-KDSLGEIEYSASYFRWFAEEAPRIY-GNIIPSSGSSKKQIFTIRQPL 165

Query: 157 GVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVN 216
           GVV  + PWN+P AM + KL  C+A GN+ VIKP+  + LS L F  L+ +AG   G+ N
Sbjct: 166 GVVGILTPWNFPSAMIARKLAPCIATGNSCVIKPAHETPLSALAFGWLVEQAGLAAGLCN 225

Query: 217 IIPG-YGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSN--LKDVTLECGGKSPAV 273
           I+P  Y +V G+ + +H  + K++FTGST VG  ++ Q  K +  +K +++E GG +P +
Sbjct: 226 ILPTTYTSVTGEYICSHDLIRKVTFTGSTAVGKALMGQCLKDSKVIKKISMELGGNAPFI 285

Query: 274 IFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKF 333
           +FKDA+L  ++       F  SGQ C   +RI V  DI+DEF  K  +  +  +  G  F
Sbjct: 286 VFKDADLMRSIDGLIGCKFRQSGQTCICANRIFVHEDIYDEFAKKLVERIETSFTLGDGF 345

Query: 334 DPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTN 391
           DP     T GP+I +   +K+ + +     +G  V            +   F  PT+ + 
Sbjct: 346 DP---KVTHGPLIHESAVDKVVKLVHDAKTKGAQVLTG---GTRASSLGPLFYRPTVLSG 399

Query: 392 VPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVFTENIRIAHEFARDILA 451
           V +       EIFGP   + +F+  DE +  AN T  GLA   ++ N++   + A  +  
Sbjct: 400 VNESMDIFHTEIFGPVASLVKFKSVDEVIERANATDVGLAGYFYSSNLQTVFDVATRLEV 459

Query: 452 GTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTV 494
           G V VN+S   D  +PFGG K SGIGRE    G+E + + K+V
Sbjct: 460 GMVGVNSSAISDAAMPFGGIKNSGIGREGSMFGIEDYTELKSV 502

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score =  237 bits (605), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 242/487 (49%), Gaps = 25/487 (5%)

Query: 19  GLFISNEFVKSSDGNQIDTFNPATKE---KLTSFYAGSETDVNVAVRAARTSYTKTWSKT 75
           G +I+ E++ S+     +  +PAT +   +L  F +G       A  A+  SY     KT
Sbjct: 19  GAYINGEWITSAK-ESFNVTDPATDQVIAELPDFDSGEAEAALKAAHASFQSY----KKT 73

Query: 76  SPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKF 135
           SP QR++ L  L  L+  + E LA+I T ++GK     AL++I       K+F+    + 
Sbjct: 74  SPTQRSEWLRNLYDLIMENAEDLAAIVTWENGKSL-REALVEIRYGATFFKWFSEEALRL 132

Query: 136 TTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSS 195
                 P +    A+T++ P GV A I PWN+P AM S K    LAAG TV+IKP   + 
Sbjct: 133 YGTTIQPSNPGNRAFTIRQPVGVCALICPWNFPNAMISRKAAPALAAGCTVIIKPDPQTP 192

Query: 196 LSLLYFAQLIVEAGFPPGVVNIIP--GYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQ 253
           LS L  A L  +AGFPPGV+N++P   Y   +G  L     V K+SFTGST VG  +L Q
Sbjct: 193 LSSLALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTGSTAVG-KILMQ 251

Query: 254 SGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFD 313
              S +K V+ E GG +P +I  DA++E+ V+      F   GQ C   +R+ V   I D
Sbjct: 252 QAASTVKKVSFELGGNAPVIIMGDADMEKTVEEVLATKFRGMGQTCICANRLYVHRSIID 311

Query: 314 EFVHKF-KDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHII 372
           +F  +  K     K   G     F +  T G +I+    EK++ +        +E    +
Sbjct: 312 DFSSRLVKKVEGLKLGNG-----FQEGVTHGSLINNAAIEKVERHAKDA----IERGAKV 362

Query: 373 DYP---PDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYG 429
             P     ++  +F  PT+ ++V  DS   +EE FGP   +  F   +E +  ANDT YG
Sbjct: 363 LLPGGRAPELGPHFYSPTVLSDVKPDSVLTREETFGPLCAMIPFDTVEEVVGYANDTQYG 422

Query: 430 LAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFM 489
           LA+ VF+ENI+  +  A  +  G V  NT    D  +PFGG K SG G E    G+  + 
Sbjct: 423 LASYVFSENIKTVYSIAEALDFGMVACNTGLFSDSMVPFGGIKESGFGIEGSLHGINDYT 482

Query: 490 QTKTVQI 496
             KTV I
Sbjct: 483 VLKTVTI 489

>Scas_716.63
          Length = 494

 Score =  232 bits (592), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/465 (33%), Positives = 238/465 (51%), Gaps = 14/465 (3%)

Query: 36  DTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDK 95
           D  +PA+  K+ +    + +DV  A+ AA  ++ KT+  T+P QR   L  + +L+  + 
Sbjct: 33  DVTDPASGSKIATLPEQTSSDVEQAIDAAAKAF-KTYKNTTPRQRAQWLRNMFNLMMENL 91

Query: 96  EILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKF--TTGETIPIDHETLAYTLK 153
           E LA + + ++GK   + +  +I       +++A    +   TT +T    +    +TL+
Sbjct: 92  EDLAKLISWENGKAL-SESRGEIKYAASFFEWYAEEAPRIYGTTIQTATASNRV--FTLR 148

Query: 154 VPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPG 213
            P GV   I PWN+P AM + K+ + L AG TV++KP   + LS L    L+ EAGFP G
Sbjct: 149 QPVGVCGIICPWNFPSAMITRKVAAALTAGCTVIVKPDSQTPLSGLALGYLLEEAGFPEG 208

Query: 214 VVNIIPGYGT--VVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSP 271
           V N+I  +      G  L   P V KISFTGST VG  +++QS  S LK ++ E GG +P
Sbjct: 209 VCNVILSHKNTPACGLTLCESPVVKKISFTGSTSVGKILMKQSA-STLKKLSFELGGNAP 267

Query: 272 AVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNFGS 331
            ++F+DA+LE AV+ T    F   GQ C  ++RI V   I D+F         RK+  G 
Sbjct: 268 VIVFEDADLEVAVEQTIASKFRGLGQTCVCSNRIYVHSSIIDKFAELVAAKV-RKFTIGP 326

Query: 332 KFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTN 391
                    T G +I+ K  EK++ ++        ++       P  +   F  P + ++
Sbjct: 327 GLS---DGVTHGCIINGKAIEKVESHVNDAITKGAQIIEKGGLIPS-LGPNFYAPVVLSH 382

Query: 392 VPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVFTENIRIAHEFARDILA 451
           V +D+   KEE FGP   I  F   +E +  ANDT +GLAA +F+++I   +  A  + A
Sbjct: 383 VTKDALVAKEETFGPLCPIFSFDTLEEVIGYANDTEFGLAAYIFSKDIDTVYTAAEALEA 442

Query: 452 GTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTVQI 496
           G V  NT    D  +PFGG K SG GRE    G+E +   K+V I
Sbjct: 443 GMVSCNTGIFSDCAMPFGGVKESGFGREGSLHGIEDYTVLKSVTI 487

>YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyde
           dehydrogenase (4-Aminobutyrate catabolic enzyme) [1494
           bp, 497 aa]
          Length = 497

 Score =  231 bits (590), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 160/491 (32%), Positives = 245/491 (49%), Gaps = 24/491 (4%)

Query: 21  FISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYT--KTWSKTSPE 78
           +I  ++VK +D    +  +PA+ E +       E  V+V   A   +Y   KT+  T+P 
Sbjct: 22  YIDGKWVKGTD-EVFEVVDPASGEIIARV---PEQPVSVVEEAIDVAYETFKTYKNTTPR 77

Query: 79  QRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTG 138
           +R   L  + +L+  + + LA+I T ++GK     A  +I       +++A    +    
Sbjct: 78  ERAKWLRNMYNLMLENLDDLATIITLENGKAL-GEAKGEIKYAASYFEWYAEEAPRLYGA 136

Query: 139 ETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSL 198
              P++     +T++ P GV   I PWN+P AM + K  + LA G TVVIKP   + LS 
Sbjct: 137 TIQPLNPHNRVFTIRQPVGVCGIICPWNFPSAMITRKAAAALAVGCTVVIKPDSQTPLSA 196

Query: 199 LYFAQLIVEAGFPPGVVNIIPGYGTV--VGDALSTHPDVDKISFTGSTKVGCNVLEQSGK 256
           L  A L  +AGFP G  N+I  +     +G  L   P V K++FTGST VG  +++QS  
Sbjct: 197 LAMAYLAEKAGFPKGSFNVILSHANTPKLGKTLCESPKVKKVTFTGSTNVGKILMKQS-S 255

Query: 257 SNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFV 316
           S LK ++ E GG +P ++F+DA+L++A++      F   GQ C   +R+ V   I D+F 
Sbjct: 256 STLKKLSFELGGNAPFIVFEDADLDQALEQAMACKFRGLGQTCVCANRLYVHSSIIDKFA 315

Query: 317 HKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPV--EVSHII 372
               +  K K+  G   DP     T G VI+    EK++ +      +G  V  E   + 
Sbjct: 316 KLLAERVK-KFVIGHGLDP---KTTHGCVINSSAIEKVERHKQDAIDKGAKVVLEGGRLT 371

Query: 373 DYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAA 432
           +  P+     F  P I ++VP  +   KEE FGP   I  F   +E +  ANDT +GLAA
Sbjct: 372 ELGPN-----FYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLAA 426

Query: 433 AVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTK 492
            VF++N+   +  +  +  G V  NT    D ++PFGG K SG GRE    G+E +   K
Sbjct: 427 YVFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLYGIEDYTVLK 486

Query: 493 TVQINIRKPNS 503
           T+ I    PNS
Sbjct: 487 TITIG-NLPNS 496

>CAGL0C04191g complement(409544..411019) highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, hypothetical start
          Length = 491

 Score =  221 bits (562), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 161/482 (33%), Positives = 239/482 (49%), Gaps = 19/482 (3%)

Query: 21  FISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYT--KTWSKTSPE 78
           +I+ E+VK S+    +  +P+T E +       E D+ V  RA   +Y   + +  T P 
Sbjct: 16  YINGEWVKDSN-EFFEVDDPSTGEIIAKL---PEHDIAVVDRAVDAAYDAFQKYKNTLPR 71

Query: 79  QRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTG 138
           QR   L  L +L+  + E LA I T ++GK    ++  +I       +++A    +    
Sbjct: 72  QRATWLRNLFNLMTENAEDLAKIITWENGKSL-PDSRAEIKYAASYYEWYAEEAPRIYGA 130

Query: 139 ETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSL 198
              P        T + P GV   I PWN+P AM + K+ + LAAG TVV+KP  ++ LS 
Sbjct: 131 TIQPSIPNNRVITKRQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVVKPDSHTPLSA 190

Query: 199 LYFAQLIVEAGFPPGVVNIIPGYGTV--VGDALSTHPDVDKISFTGSTKVGCNVLEQSGK 256
           L    L+ +AGFP GV N++        +G  L  HP V K++FTGST++G  ++EQ+  
Sbjct: 191 LAMTVLVEKAGFPKGVFNVVLSQHNTPKLGKRLCEHPKVKKVTFTGSTRIGKTLMEQA-S 249

Query: 257 SNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFV 316
           S LK  + E GG +P ++F DA+L+ AV       F   GQ C   +R  VQ  I DEF 
Sbjct: 250 STLKKCSFELGGNAPFIVFDDADLDLAVDQAIASKFRGMGQTCVCTNRFYVQDTIADEFA 309

Query: 317 HKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVEVSHIIDY 374
            K     K+ +  G   D   +  T G + + KQ +K+ E+      +G  V +      
Sbjct: 310 EKLVTKVKQ-FKIG---DGMKEGVTHGCLTNAKQADKVDEHKKDAIEKGAKVLLEG--GR 363

Query: 375 PPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAV 434
            PD +   F  P +  NVPQ +   KEE FGP   I  F+  +E L  ANDT  GLA+ V
Sbjct: 364 MPD-LGKNFYAPVVLKNVPQSAMVAKEETFGPLCPIFTFKTVEEVLGYANDTELGLASYV 422

Query: 435 FTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTV 494
           FT+N+      +  + AG V  NT    D ++PFGG K SG GRE    G++ +   K++
Sbjct: 423 FTKNVNTLFTVSEALEAGMVSCNTGLFSDSSVPFGGVKESGFGREGSLYGIDDYTTVKSI 482

Query: 495 QI 496
            I
Sbjct: 483 II 484

>Kwal_56.23106
          Length = 495

 Score =  217 bits (552), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 162/484 (33%), Positives = 246/484 (50%), Gaps = 21/484 (4%)

Query: 21  FISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQR 80
           F++ +++K S G + +  +PA  E +          V+ A+ AA  ++ +++ KT+  +R
Sbjct: 20  FVNGKWIKDS-GAEFEVTDPANGEVIAKLPDQDVGIVDEAIDAAYEAF-QSFKKTTGRER 77

Query: 81  TDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGET 140
             LL K+ SL+  + E L  I + ++GKP     + +I       +++A    +   G T
Sbjct: 78  ATLLRKMHSLMLENVEDLGKILSWENGKPL-AEGIGEIKYAASFYEWYAEEAPRIN-GTT 135

Query: 141 IPIDHET-LAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLL 199
           I     T   +T + P GV   I PWN+P AM + K+ + LAAG TVVIKP   + LS L
Sbjct: 136 INSAISTNRVFTERQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVIKPDSQTPLSAL 195

Query: 200 YFAQLIVEAGFPPGVVNIIPGYGTV--VGDALSTHPDVDKISFTGSTKVGCNVLEQSGKS 257
             A L  +AG P GV N++  +      G  L   P V K+SFTGST VG  +++QS  S
Sbjct: 196 ALAHLAEKAGVPAGVFNVVLSHTKTPEFGLKLCESPKVKKVSFTGSTNVGKILMKQSA-S 254

Query: 258 NLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVH 317
            +K ++ E GG +P ++F+DA+L++AV+      F   GQ C   +R+ VQ  I DEF  
Sbjct: 255 TMKKLSFELGGNAPFIVFEDADLDKAVEQAIACKFRGLGQTCVCANRLYVQKSILDEFET 314

Query: 318 KFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPV--EVSHIID 373
           +F +    K N       F +  T G +I+ K  EK++ +      +G  V  E   + D
Sbjct: 315 RFAE----KVNQFVIGHAFKEGVTHGCLINPKAIEKVEAHTKDAIEKGAKVVVEGGRLPD 370

Query: 374 YPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAA 433
             P      F  PT+ + VPQD+    +E FGP   I  F   +E +  ANDT  GLAA 
Sbjct: 371 LGPS-----FYAPTVVSQVPQDAIVASQETFGPLCAIIPFETTEEVVRWANDTEVGLAAY 425

Query: 434 VFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKT 493
           VF++NI   +  +  +  G V  NT    +  +PFGG K SG GRE    G+E +   K+
Sbjct: 426 VFSKNIDTIYTVSEALETGMVSCNTGVFSECAVPFGGVKESGFGREGSLHGIEDYTVIKS 485

Query: 494 VQIN 497
           V I 
Sbjct: 486 VVIG 489

>KLLA0E17545g 1553982..1555475 highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, start by similarity
          Length = 497

 Score =  216 bits (549), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 161/497 (32%), Positives = 254/497 (51%), Gaps = 34/497 (6%)

Query: 19  GLFISNEFVKSSDGNQIDTFN---PATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKT 75
           G F+  ++++++     +TFN   PAT E + +    S   ++ A+ +A  ++ + + KT
Sbjct: 20  GAFVDGQWLETAS----ETFNVTDPATLEVIATLPDQSIEVIHEAIDSAAEAF-RLFKKT 74

Query: 76  SPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKF 135
           +P+ R+  L  L +L+  + + LA I T ++GK   + A  ++       +++A    + 
Sbjct: 75  TPKTRSTWLRNLYNLMMENVDDLAKIITWENGKAL-SEAQGEVKYAASYFEWYAEEAVRM 133

Query: 136 TTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSS 195
                 P +    A+T++ P GV   I PWN+P AM + K  + LAAG TVV+KP   + 
Sbjct: 134 YGTTIQPNNGSNRAFTVRQPVGVCGIICPWNFPSAMITRKAGAALAAGCTVVVKPDSQTP 193

Query: 196 LSLLYFAQLIVEAGFPPGVVNII------PGYGTVVGDALSTHPDVDKISFTGSTKVGCN 249
           LS L  A L  +AGFP GV N++      P +G     AL   P V KISFTGST VG  
Sbjct: 194 LSALALAHLAEKAGFPKGVFNVVLTATRTPEFGL----ALCESPKVKKISFTGSTNVGKI 249

Query: 250 VLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQH 309
           +++QS  S +K ++ E GG +P ++F DA+LE+AV  T    F   GQ C   +RI VQ 
Sbjct: 250 LMKQSA-STMKKLSFELGGNAPVIVFDDADLEQAVTQTILSKFRGLGQTCVCANRIYVQR 308

Query: 310 DIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVE 367
            I D F  K      ++ N        D   T G +I++   +K++ ++     +G    
Sbjct: 309 TIIDSFAEKLA----KQVNEFVIGHGLDSKTTHGCLINENAIKKVEAHVKDALEKGAKTV 364

Query: 368 VS--HIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLAND 425
           V+   + +  P+     F  PT+ ++VP  +   K+E FGP   +  F   +E +  AND
Sbjct: 365 VAGGRLPELGPN-----FYAPTVLSHVPSTAVVNKDETFGPLCALIPFDTMEEVVGYAND 419

Query: 426 TSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGV 485
           T  GLA+ VF++NI   +  A  +  G V  NT    + T+PFGG K SG GRE    G+
Sbjct: 420 TELGLASYVFSKNIDTVYTVAEALETGMVSCNTGLFSECTIPFGGVKESGFGREGSLHGI 479

Query: 486 ESFMQTKTVQI-NIRKP 501
           E +   KT+ I N+  P
Sbjct: 480 EDYTVIKTITIGNLPAP 496

>AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH]
           complement(213684..215597) [1914 bp, 637 aa]
          Length = 637

 Score =  169 bits (427), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 133/478 (27%), Positives = 222/478 (46%), Gaps = 22/478 (4%)

Query: 35  IDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVERD 94
           I  + PAT + L SF + S+ D++    AA  +   +W+KTS  QR  +L  +   V  +
Sbjct: 107 IQNYCPATGQFLGSFRSMSKEDIDERFAAAAKAQV-SWAKTSFAQRRQVLKTMQKFVLEN 165

Query: 95  KEILASIETQDSGKPYYTNALLDIDMIIKLTKYF--AGSTDKFTTGETIPIDHETLAY-- 150
           +E+LA +  +DSGK     +L +I + ++  ++    G      +    P +     Y  
Sbjct: 166 QEMLARVACRDSGKTMLDASLGEIMVTMEKLQWMIKHGERTLRPSKRAGPANFFMKLYKG 225

Query: 151 --TLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEA 208
                 P GVV  +V WNY        + +   AGN VVIK SE    S  +F +L  E+
Sbjct: 226 GEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTFAGNGVVIKCSEQVVWSSEFFVKLARES 285

Query: 209 ----GFPPGVVNII----PGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLK 260
               G  P +V +     P       +  ++HP +  ++F GS  V  +VL  + KS L 
Sbjct: 286 LKVCGHDPELVQLCYCFPPSETDDTANYFTSHPSLRHLTFIGSKPVAHHVLACAAKS-LT 344

Query: 261 DVTLECGGKSPAVIFKDA-NLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKF 319
            V +E GGK   V+   A +LE        G F ++GQNC    R++V    +D  V K 
Sbjct: 345 PVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQSAGQNCIGIERVIVCQKNYDALV-KI 403

Query: 320 KDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVEVSHIIDYPPD 377
            ++   +   G+  D  + D  VG +IS  +++ ++E +     +G  +         P 
Sbjct: 404 LEHRISELRVGADIDNLE-DVDVGAMISDNRFDYMEELIQDAVSQGARLLHGGSRYTHPK 462

Query: 378 DINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVFTE 437
              G++  PT+  +V  D +  + E+FGP + + + +D ++ + +ANDT +GL  +VF +
Sbjct: 463 YPQGHYFQPTLLVDVTTDMRISQNEVFGPVLTVMKAKDIEDCIRIANDTPFGLGGSVFGK 522

Query: 438 NIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSGIGRELGRTGVESFMQTKTV 494
           N +  +  A  +  G V +N      V  LPFGG   SG GR  G  G+     +K++
Sbjct: 523 NRKDCNYVANHMNVGNVAINDFATYYVCQLPFGGIGSSGYGRFGGEEGLLGLCNSKSI 580

>KLLA0C10615g complement(912077..913999) similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, start by similarity
          Length = 640

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/480 (26%), Positives = 218/480 (45%), Gaps = 22/480 (4%)

Query: 33  NQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVE 92
           + I ++ PAT + L SF + S+TD++  V  A  +  + W+KTS ++R  +LL L + + 
Sbjct: 108 HMIQSYCPATGQFLGSFKSMSDTDIDEIVLLAERAQLQ-WAKTSLKERLQVLLSLKNFIL 166

Query: 93  RDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGETIP------IDHE 146
            ++E +A +  +DSGK     ++ +I + ++  ++     +        P      +   
Sbjct: 167 ENQEAIARVACRDSGKTMLDASMGEILVTLEKIQWIIEHGEDVLKPSARPGPTNFFMKWY 226

Query: 147 TLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIV 206
             A     P GVV  IV WNYP       + + +  GN VV+K SE    S  +F  L+ 
Sbjct: 227 KGAEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVWSSKFFTLLVQ 286

Query: 207 EA----GFPPGVVNII----PGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSN 258
           EA    G  P +V +     P       +  ++HP    ++F GS  V  +VL+ +  S 
Sbjct: 287 EALKACGHDPNLVQLCYCLPPTGNDDAANYFTSHPVFKHLTFIGSKPVAHHVLKAAADS- 345

Query: 259 LKDVTLECGGKSPAVIFKDA-NLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVH 317
           L  V +E GGK   ++     +L+        G F ++GQNC    R++V    +D  V 
Sbjct: 346 LTPVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQSAGQNCIGIERVIVSAKNYDALVS 405

Query: 318 KFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMT--CPEGCPVEVSHIIDYP 375
              D    +   GS  D  + D  +G +IS  ++ +++  ++    +G  +         
Sbjct: 406 ILNDRVG-QLRLGSDIDNLE-DVDMGAMISDNRFGQLENLISDALSKGAKLLHGGSRYNH 463

Query: 376 PDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAVF 435
           P+   G+F  PT+  +V +D +    E+FGP + +   +D D+ + LAN   +GL  ++F
Sbjct: 464 PNYPQGHFFQPTLLVDVTEDMQISHNEVFGPILTVMRAKDTDDCIRLANAAPFGLGGSIF 523

Query: 436 TENIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSGIGRELGRTGVESFMQTKTV 494
             +    +  A  +  G V +N      V  LPFGG   SG G+  G  G+      K+V
Sbjct: 524 GADFGECNRVANSLTTGNVAINDFATFYVCQLPFGGLNGSGYGKFGGEEGLLGLCNAKSV 583

>Kwal_23.5699
          Length = 641

 Score =  156 bits (395), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 223/485 (45%), Gaps = 24/485 (4%)

Query: 29  SSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLA 88
           S   ++I  + PAT + L S+ + +E D++  V  A  +  K W+KT+ E+RT +L+ L 
Sbjct: 105 SESPDRIQCYCPATGQFLGSYPSMNEDDIDQLVSKATEAQVK-WAKTTLEERTRVLVSLQ 163

Query: 89  SLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFT--TGETIPIDHE 146
             +  +++ +A +  +DSGK     ++ +I + ++  ++   + +K    +  + P +  
Sbjct: 164 DYILENQDSIARVACRDSGKTMLDASMGEILVTLEKLQWIIKNGEKALQPSKRSGPTNFF 223

Query: 147 TLAY----TLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFA 202
              Y        P GVV  +V WNYP       + + +  GN +VIK SE    S  +FA
Sbjct: 224 MKWYKGAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIFTGNAIVIKCSEQVVWSSEFFA 283

Query: 203 QLIVEA----GFPPGVVNII----PGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQS 254
            +  +     GF P ++ +     P       +  S+HP +  ++F GS  V  +VL  +
Sbjct: 284 SMCKKCLESNGFDPNLIQLCYCRPPSATDNAANHYSSHPGLKHLTFIGSKPVAHHVLAAA 343

Query: 255 GKSNLKDVTLECGGKSPAVIFKDA--NLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIF 312
            KS L  V +E GGK  A+I  D+  +L         G F +SGQNC    R++V    +
Sbjct: 344 SKS-LTPVVVELGGKD-ALIALDSVKDLPALSSIIMRGTFQSSGQNCIGIERVIVSAKNY 401

Query: 313 DEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVEVSH 370
           DE V   +     +   GS  D  + D  +G +IS  ++E+++  +     +G  +    
Sbjct: 402 DELVSILEKRVG-QLRLGSDIDNLE-DVDMGAMISDNRFEELERMVQDAIKQGARLLHGG 459

Query: 371 IIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGL 430
                P+   G++  PT+  +V    +  + E+FGP + +    D  + + LAN   +GL
Sbjct: 460 SRYKHPNYPQGHYFQPTLLVDVTPLMEIAQNEVFGPIMTVMRAEDTQDCIRLANSAPFGL 519

Query: 431 AAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSGIGRELGRTGVESFM 489
             +VF  +    +  A  +  G V +N      V  LPFGG   SG G+  G  G+    
Sbjct: 520 GGSVFGSDYAECNYVANHLTTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLTGLC 579

Query: 490 QTKTV 494
             K++
Sbjct: 580 NAKSI 584

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score =  152 bits (385), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 218/481 (45%), Gaps = 22/481 (4%)

Query: 33  NQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVE 92
           N I    PAT + L SF + +E D++  V  A  + + TW  +   +R  +L  L   + 
Sbjct: 110 NFIQCHCPATGQYLGSFPSKTEADIDEMVSKAGKAQS-TWGNSDFSRRLRVLASLHDYIL 168

Query: 93  RDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGETIP------IDHE 146
            +++++A +  +DSGK     ++ +I + ++  ++      +       P      +   
Sbjct: 169 NNQDLIARVACRDSGKTMLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKWY 228

Query: 147 TLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLI- 205
             A     P GV++ IV WNYP       + + L  GN +V+K SE    S  +F +LI 
Sbjct: 229 KGAEIRYEPLGVISSIVSWNYPFHNLLGPIIAALFTGNAIVVKCSEQVVWSSEFFVELIR 288

Query: 206 --VEA-GFPPGVVNII----PGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSN 258
             +EA    P +V +     P       +  ++HP    I+F GS  V   +L+ + KS 
Sbjct: 289 KCLEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYILKCAAKS- 347

Query: 259 LKDVTLECGGKSPAVIFKDA-NLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVH 317
           L  V +E GGK   ++   A NL+        G F +SGQNC    R++V  + +D+ V 
Sbjct: 348 LTPVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDDLVK 407

Query: 318 KFKD-YTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TCPEGCPVEVSHIIDY 374
              D  T      GS  D  + +  +G +IS  ++++++  +     +G  +        
Sbjct: 408 ILNDRMTANPLRQGSDIDHLE-NVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFK 466

Query: 375 PPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYGLAAAV 434
            P    G++  PT+  +V  + K  + E+FGP +V+ + ++ D  + LAN   +GL  +V
Sbjct: 467 HPKYPQGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSV 526

Query: 435 FTENIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSGIGRELGRTGVESFMQTKT 493
           F  +I+  +  A  +  G V +N      V  LPFGG   SG G+  G  G+      K+
Sbjct: 527 FGADIKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAKS 586

Query: 494 V 494
           V
Sbjct: 587 V 587

>Scas_690.26
          Length = 651

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 123/495 (24%), Positives = 217/495 (43%), Gaps = 40/495 (8%)

Query: 30  SDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLAS 89
           S+ N I  + PAT + + SF + ++T+++  ++ A  + +K WS +S E+R  +L  L  
Sbjct: 110 SNPNHIQCYCPATGQYIASFPSKTKTELDDMIQRAEIAQSK-WSTSSMERRLRVLTSLRE 168

Query: 90  LVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFA-------------GSTDKFT 136
            +  ++E++ASI  +DSGK     ++ +I + ++  ++               G T+ F 
Sbjct: 169 YILSNQEMIASIACRDSGKTKLDASMGEILVTLEKLQWLITHGPSVLKPSRRPGPTNFFM 228

Query: 137 TG-ETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSS 195
              +   I +E        P GVV+ IV WNYP       +   L  GN +V+K SE   
Sbjct: 229 KWYKGAEIRYE--------PLGVVSAIVSWNYPFHNLWGPIIDSLFTGNAIVMKCSEQVV 280

Query: 196 LSLLYFAQL----IVEAGFPPGVV--------NIIPGYGTVVGDALSTHPDVDKISFTGS 243
            S   F QL    +++ G  P ++        N+         +  ++H     I+F GS
Sbjct: 281 WSSEIFVQLLRECLIQCGEDPELIQLFYCLPPNLEEDSNEETANYFTSHKAFKSITFIGS 340

Query: 244 TKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDA-NLEEAVKWTSEGIFFNSGQNCTAN 302
            +V   +L  + ++ +  V +E GGK   ++     +L+        G F +SGQNC   
Sbjct: 341 QQVSHQILRCAAEA-ITPVVVELGGKDAFIVLDSVKDLQSISSIILRGTFQSSGQNCIGI 399

Query: 303 SRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM--TC 360
            R++V    +   V    +                 D  VG +IS  ++++++  +    
Sbjct: 400 ERVIVSEKNYATLVEILSNRMNASPMRQGSDIDSIDDIDVGAMISDNRFDELELLVKDAV 459

Query: 361 PEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL 420
            +G  +         P    G +  PT+  +V  D K  + E+FGP +V+    D +  +
Sbjct: 460 SKGARLLCGGSRFQHPKYPQGNYFQPTLLVDVTPDMKIAQNEVFGPILVMMRANDTEHCI 519

Query: 421 SLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSGIGRE 479
            LAN   +GL  +VF  N++  +  A ++  G V +N      V  LPFGG   SG G+ 
Sbjct: 520 KLANSAPFGLGGSVFGSNMQECNYVANELKTGNVAINDFATFYVCQLPFGGIHGSGYGKF 579

Query: 480 LGRTGVESFMQTKTV 494
            G  G+      K+V
Sbjct: 580 GGEEGLLRLCNAKSV 594

>CAGL0F08965g complement(880296..882215) highly similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, hypothetical start
          Length = 639

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 117/499 (23%), Positives = 218/499 (43%), Gaps = 42/499 (8%)

Query: 25  EFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLL 84
           + V  S    I ++ PAT + L  F + +  +++  V  A  +  K W+++S  +R ++L
Sbjct: 97  KLVDDSKPRHIQSYCPATGQYLGEFKSMTADEIDELVGNANAAQMK-WAESSIAKRLEVL 155

Query: 85  LKLASLVERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFA-------------GS 131
             L   +  +++++A +  +DSGK     ++ +I + ++  ++               G 
Sbjct: 156 ATLQKFILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKHGPSTLEPSRRPGP 215

Query: 132 TD---KFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVI 188
           T+   KF  G  +  +          P GV++ IV WNYP       + + +  GN +++
Sbjct: 216 TNFFMKFYKGAEVRYE----------PLGVISSIVSWNYPFHNLMGPIIASIFTGNAIIV 265

Query: 189 KPSENSSLSLLYFAQLI--------VEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240
           K SE    S  +F +++        V++        + P       +  ++HP +  I+F
Sbjct: 266 KCSEQVVWSSEFFIEMVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGIKHITF 325

Query: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDA-NLEEAVKWTSEGIFFNSGQNC 299
            GS  V  ++L  + KS L  V +E GGK   ++     +L+        G F +SGQNC
Sbjct: 326 IGSQSVASHILNCASKS-LTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSSGQNC 384

Query: 300 TANSRILVQHDIFDEFVHKFKDYTKRK-WNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM 358
               R++V    +D+ V+  +   K      GS  D  +    +G +IS  +++ ++  +
Sbjct: 385 IGIERVIVSEKNYDQLVNILEKRMKETPLRQGSDIDHLEV-VDMGAMISDNRFKTLEALI 443

Query: 359 --TCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDY 416
                +G  +         P    G++  PT+  +V  D    + E+FGP +V+ + +D 
Sbjct: 444 QDAVSKGARLLYGGSQYNHPKYPQGHYFQPTLLVDVTPDMDIAQNEVFGPVLVMMKAKDT 503

Query: 417 DEALSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVT-LPFGGFKMSG 475
              + LAN   +GL  +VF  +    +  A  +  G V +N      V  LPFGG   SG
Sbjct: 504 SNCIELANAAPFGLGGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFGGINGSG 563

Query: 476 IGRELGRTGVESFMQTKTV 494
            G+  G  G+      K+V
Sbjct: 564 YGKFGGEEGLLGLCNAKSV 582

>KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1
           Kluyveromyces lactis delta 1-pyrroline-5-carboxylate
           dehydrogenase, start by similarity
          Length = 576

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 224/500 (44%), Gaps = 45/500 (9%)

Query: 31  DGNQIDTF---NPATK-EKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLK 86
           DG +   F   NPA   E L +    +  DV  A++A++ +  K W K    +R  + +K
Sbjct: 75  DGGKRGIFQQLNPANHSEVLANVTQATNEDVKAAIQASKQAKDK-WYKLPYYERASVFMK 133

Query: 87  LASLV---ERDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYF---AGSTDKFTTGET 140
            A L+    R   + A++  Q  GK  Y     +ID I +L  +F       ++    + 
Sbjct: 134 AADLICTKYRYDMLAATMLGQ--GKNVYQ---AEIDCITELADFFRFNVKYANELYAQQP 188

Query: 141 IPIDHETLAYTLKVPF-GVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLL 199
           I             P  G V  + P+N+  A+A   + +    GNTVV KPS+N++LS  
Sbjct: 189 IESSPGVWNRAEYRPLEGFVYAVTPFNF-TAIAGNLIGAPALMGNTVVWKPSQNANLSNY 247

Query: 200 YFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLE--QSGKS 257
               ++ EAG P GVVN +PG    V   + +  +   + FTGST V   +    Q G  
Sbjct: 248 LLLTVLEEAGLPNGVVNFVPGNAVEVTKEVLSDSEFAALHFTGSTAVFKQLYGDIQKGVV 307

Query: 258 N--LKD---VTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIF 312
           N   +D   +  E GGK+  +I   AN+  +V  T  G F   GQ C+A SR+ +     
Sbjct: 308 NGLYRDYPRIVGETGGKNFHLIHPSANIPHSVLSTLRGAFEFQGQKCSATSRVYLPESKS 367

Query: 313 DEFVHKFKDY------TKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPV 366
           +EF   F+D        +      SK +  D    +GPVI +  ++K+ + +   +  P 
Sbjct: 368 EEF---FRDLGGVLSEVQPVNTSASKINGGDLHGFIGPVIHEGSFDKLAKVIDDAKNDP- 423

Query: 367 EVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRD--YDEALSLAN 424
           E+  +     D   GY+I PTI         +  +E FGP + + E+ D  +++   L +
Sbjct: 424 ELEIVFGGFHDKSKGYYIQPTIIKTTNPRHPYLSQEFFGPILTVYEYPDAKFEDVCELVD 483

Query: 425 DTS-YGLAAAVFT---ENIRIAHEFARDILAGTVWVNTSNAEDVTLP--FGGFKMSGIGR 478
            TS YGL  ++F    E I+IA E  +   AG  ++N  +   V     FGG +MSG   
Sbjct: 484 STSQYGLTGSIFARDREAIKIADEKLK-YSAGNFYINDKSTGAVVAQQWFGGARMSGTND 542

Query: 479 ELGRTGV-ESFMQTKTVQIN 497
           + G   +   F+  + ++ N
Sbjct: 543 KAGSGNILNRFVSVRNIKEN 562

>Kwal_23.5714
          Length = 576

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 144/490 (29%), Positives = 216/490 (44%), Gaps = 42/490 (8%)

Query: 39  NPATKEK-LTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVE---RD 94
           NPA   + L +    S+ DV  A++A++ +  K W K     R  + LK A L+    R 
Sbjct: 83  NPAKHSQVLANVTQASKKDVLDAIQASKDAKAK-WYKMPFYDRAAVFLKAADLISTKYRY 141

Query: 95  KEILASIETQDSGKPYYTNALLDIDMIIKLTKYF------AGSTDKFTTGETIPIDHETL 148
             + A++  Q  GK  Y     +ID I +L  +F      A         E+ P      
Sbjct: 142 DMLAATMLGQ--GKNVYQ---AEIDCITELADFFRFNVKYASELYNQQPCESSPGVWNKA 196

Query: 149 AYTLKVPF-GVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVE 207
            Y    P  G V  + P+N+  A++   + +    GNTVV KPS+ + LS      ++ E
Sbjct: 197 EYR---PLEGFVYAVTPFNF-TAISGNLIGAPALMGNTVVWKPSQAACLSNYLLLTVLEE 252

Query: 208 AGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKD------ 261
           AG P GVVN IPG    V DA+    +   + FTGST V   +  +  +  + D      
Sbjct: 253 AGLPHGVVNFIPGNPVEVTDAVLADKEFAALHFTGSTAVFKQLYGKIQQGVVNDLYRDYP 312

Query: 262 -VTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFK 320
            +  E GGK+  ++   A++  AV  T  G F   GQ C+A SR+ +      EF+    
Sbjct: 313 RIVGETGGKNFHLVHPSASIPHAVLSTLRGAFEYQGQKCSAASRLYLPASRSAEFLEDLA 372

Query: 321 DYTK--RKWNF-GSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPPD 377
              K  R  N   SK +  D    +GPVI Q+ +EK+   +   +  P E+  I     D
Sbjct: 373 GTLKEVRTVNTSASKLNGGDLHGFMGPVIHQQSFEKLANALEEAKNDP-ELEIICGGECD 431

Query: 378 DINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYD---EALSLANDTSYGLAAAV 434
             NG+FI PT+        K+   E FGP + + E+ D +      ++   TSYGL  AV
Sbjct: 432 KSNGWFIEPTVVKTTNPLHKFMSTEFFGPLLTVCEYPDAEFTQVCETIDKTTSYGLTGAV 491

Query: 435 FTEN---IRIAHEFARDILAGTVWVNTSNAEDVTLP--FGGFKMSGIGRELGRTGVES-F 488
           F  +   I IA E  +   AG  ++N      V     FGG +MSG   + G   + S F
Sbjct: 492 FARDRDAIAIADEKLK-YSAGNFYINDKCTGAVVGQQWFGGARMSGTDDKAGSGNILSRF 550

Query: 489 MQTKTVQINI 498
           +  + V+ N 
Sbjct: 551 VSIRNVKENF 560

>CAGL0D03982g 397039..398763 highly similar to sp|P07275
           Saccharomyces cerevisiae YHR037w PUT2
           1-pyrroline-5-carboxylate dehydrogenase, start by
           similarity
          Length = 574

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 146/523 (27%), Positives = 242/523 (46%), Gaps = 63/523 (12%)

Query: 20  LFISNEFVKSSDGNQI-DTFNPATKEK-LTSFYAGSETDVNVAVRAARTSYTKTWSKTSP 77
           L I+ E V +  G  +    NPA  E+ L +    +  D+  A+ AA+ +  K W     
Sbjct: 62  LVINGERVYADRGRAVFAQTNPANHEQVLANVAQATRDDIKSAIGAAKQAKEK-WYNMPF 120

Query: 78  EQRTDLLLKLASLVE---RDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGST-- 132
             R  + +K A L+    R   + A++  Q  GK  Y     +ID I +L+ +F  +   
Sbjct: 121 YDRAAIFMKAADLISTKYRYDMLAATMLGQ--GKNVYQ---AEIDCITELSDFFRFNVKY 175

Query: 133 --DKFTTG--ETIPIDHETLAYTLKVPF-GVVAQIVPWNYPLAMASWKLQSCLAAGNTVV 187
             + + T   E++P       Y    P  G V  + P+N+  A+A+  + +    GNTVV
Sbjct: 176 ADELYATQPIESVPGIWNRAEYR---PLEGFVYAVSPFNF-TAIAANLIGAPALMGNTVV 231

Query: 188 IKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVG 247
            KPS+ ++LS      ++ EAG P GV+N +PG    + D +    D   + FTGST V 
Sbjct: 232 WKPSQTAALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLASRDFSALHFTGSTAVF 291

Query: 248 CNVLE--QSGKSNLK-----DVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300
             +    QSG +  K      +  E GGK+  ++   AN+  AV  T  G F   GQ C+
Sbjct: 292 KQLYGKIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHAVFNTIRGAFEFQGQKCS 351

Query: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCT----------VGPVISQKQ 350
           A SR+ +   + +EF   F+D      N  +K  P +   +          +GPVI ++ 
Sbjct: 352 ATSRLYLPKSMSEEF---FRDMFGTLSN--NKVVPVNTSASAISGGNLHGFMGPVIHEQS 406

Query: 351 YEK----IQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGP 406
           + K    I+E    PE   +E+ +   Y  D   G++I PTI      + K+   E FGP
Sbjct: 407 FNKLSAAIEEAKKDPE---LEILYGGQY--DKSQGWYIGPTIIRTTNPNHKFLTTEFFGP 461

Query: 407 AVVISEFRD--YDEALSLANDTS-YGLAAAVFTENIRIAHEFARDIL---AGTVWVNTSN 460
            + + E++D  + +   L N+T  YGL  ++F+ + R A  +A + L   AG  ++N   
Sbjct: 462 ILTVYEYQDSQFKDICELINETGEYGLTGSIFSRD-RDAIIYASEKLRFSAGNFYINDKC 520

Query: 461 AEDVTLP--FGGFKMSGIGRELGRTGVES-FMQTKTVQINIRK 500
              V     FGG +MSG   + G   + S F+  ++++ N+++
Sbjct: 521 TGAVVAQQWFGGARMSGTNDKAGGPSILSRFVSIRSIKENMQE 563

>Scas_690.41
          Length = 581

 Score =  128 bits (321), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 214/469 (45%), Gaps = 45/469 (9%)

Query: 39  NPAT-KEKLTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVE---RD 94
           NPA  K+ L +    +E DV  A++AA+ + +K W +     R  + LK A L+    R 
Sbjct: 90  NPACHKQVLANVTQATELDVKDAIQAAKEAKSK-WYQLPFYDRAAVFLKAADLISTKYRY 148

Query: 95  KEILASIETQDSGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKV 154
             + A++  Q  GK  Y     +ID I +L+ +F  +         +           K 
Sbjct: 149 DMLAATMLGQ--GKNVYQ---AEIDCITELSDFFRFNVKYAHDLYNLQPVQSAQGVWNKA 203

Query: 155 PF----GVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGF 210
            +    G +  + P+N+  A+A+  + +    GNTV+ KPS++++LS      ++ EAG 
Sbjct: 204 EYRPLEGFIYAVSPFNF-TAIAANLIGAPALMGNTVIWKPSQSAALSNYLLLTVLEEAGL 262

Query: 211 PPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLE--QSGKSN--LKD---VT 263
           P GV+N +PG   +V D L    +   + FTGST+V   +    Q+G  N   +D   + 
Sbjct: 263 PKGVINFVPGDPILVTDQLLASKEFGGLHFTGSTQVFKQLYGKIQTGVVNGLYRDYPRIV 322

Query: 264 LECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYT 323
            E GGK+  +I K AN+  AV  T  G F   GQ C+A SR+ +     +EF        
Sbjct: 323 GETGGKNFHLIHKSANIPNAVFSTIRGAFEFQGQKCSATSRLYIPQSKSEEFFRDLIGTL 382

Query: 324 KRKW-----NFGSKFDPFDKDCTVGPVISQKQYEK----IQEYMTCPEGCPVEVSHIIDY 374
           +++         S     D    +GPVI ++ Y K    I+E  T PE   +E+ +   Y
Sbjct: 383 QQQKVTPVNTAASPISGGDLHGFMGPVIHEQSYNKLIKVIEEAKTDPE---LEIIYGGQY 439

Query: 375 PPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRD--YDEALSLANDTS-YGLA 431
             D   G+F+ PTI        K+   E FGP + + E+ D  + E   L + TS YGL 
Sbjct: 440 --DKGEGWFVGPTIIKCKDPKHKFMTTEFFGPILSVYEYPDNKFSETCDLIDQTSMYGLT 497

Query: 432 AAVFT---ENIRIAHEFARDILAGTVWVNTSNAEDVTLP--FGGFKMSG 475
            +VF    E I +A E  +    G  ++N      V     FGG +MSG
Sbjct: 498 GSVFAKDREAINLADEKLK-FSCGNFYINDKCTGAVVAQQWFGGARMSG 545

>AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH]
           (223170..224891) [1722 bp, 573 aa]
          Length = 573

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 228/517 (44%), Gaps = 51/517 (9%)

Query: 18  IGLFISNEFVKSSDGNQIDTF---NPATKEK-LTSFYAGSETDVNVAVRAARTSYTKTWS 73
           + L I+ E +  +D  + + F   NPA   + L      S  DV  AVRAA+ +  K W 
Sbjct: 59  VPLVINGERIYFNDAGKRELFKQVNPARHTQVLAHVTQASREDVRAAVRAAQDAKQK-WY 117

Query: 74  KTSPEQRTDLLLKLASLVE---RDKEILASIETQDSGKPYYTNALLDIDMIIKLTKYF-- 128
           +T    R  + LK A LV    R   + A++  Q  GK        +ID I +L  +F  
Sbjct: 118 ETPFYDRAAVFLKAADLVATKYRYDMLAATMLGQ--GKNVQQ---AEIDCITELADFFRF 172

Query: 129 ----AGSTDKFTTGETIPIDHETLAYTLKVPF-GVVAQIVPWNYPLAMASWKLQSCLAAG 183
               A    +    E+ P       Y    P  G V  + P+N+  A+A   + +    G
Sbjct: 173 NVKYAEELYQQQPAESSPGVWNRSEYR---PLEGFVYAVSPFNF-TAIAGNLVGAPALMG 228

Query: 184 NTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISFTGS 243
           NTVV KPS+N++LS      ++ EAG P GV+N +PG    V + +     +  + FTGS
Sbjct: 229 NTVVWKPSQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLADKALGGLHFTGS 288

Query: 244 TKVGCNV---LEQSGKSNL-KD---VTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSG 296
           T V   +   ++Q   S L +D   +  E GGK+  ++   ANL  AV  T  G F   G
Sbjct: 289 TAVFKQLYGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPHAVLSTLRGAFEFQG 348

Query: 297 QNCTANSRILVQHDIFDEFVHKFKD---YTKRKWNFGSKFDPFDKDCTVGPVISQKQYEK 353
           Q C+A SR+ +     D F+          K      S  +  D    +GPVI ++ ++K
Sbjct: 349 QKCSAASRLYLPQSKADAFLADLAGTLAAIKPANTSASSINGGDLHAFMGPVIHEQSFDK 408

Query: 354 ----IQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVV 409
               I+   T PE   +E+ +  D+      GYF+ PT+         +   E FGP + 
Sbjct: 409 LAAAIERARTDPE---LEILYGGDHSKS--QGYFVGPTVVRTSNPRHDFMTAEFFGPILT 463

Query: 410 ISEFRD--YDEALSLANDTS-YGLAAAVFTENIRIAHEFARDI--LAGTVWVNTSNAEDV 464
           + E+ D  +D+   L + TS YGL  AVF  +        R +   AG  ++N      V
Sbjct: 464 VYEYPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKYAAGNFYINDKATGAV 523

Query: 465 TLP--FGGFKMSGIGRELGRTGVES-FMQTKTVQINI 498
                FGG +MSG   + G   V S F+  ++V+ N 
Sbjct: 524 VAQQWFGGARMSGTNDKAGSPNVLSRFVSVRSVKENF 560

>KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces
           cerevisiae YMR110c, start by similarity
          Length = 521

 Score =  125 bits (315), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 127/445 (28%), Positives = 192/445 (43%), Gaps = 28/445 (6%)

Query: 62  RAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDI--- 118
           R AR + +K+   T   +R   L KL   V+ ++E L +  ++D  +       +++   
Sbjct: 26  RQARLAQSKSPRATDINERIRSLQKLYWAVKDNEERLIAAASKDFHRARSETLTIELVPL 85

Query: 119 -DMIIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQ 177
            + I+ L K      +      ++        +  K+  G V  I P+N+P+ +A   L 
Sbjct: 86  YNNILYLIKNMKKEIEPKKIKVSLLAHWFGTTFVEKIALGTVLVISPFNFPILLALDPLA 145

Query: 178 SCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDK 237
             +A GN+VV KPSE +        ++  EA F  G V  + G G     AL      DK
Sbjct: 146 GAIAGGNSVVFKPSELTPACAEVMEEICNEA-FEKGQVETVQG-GAEETSALVESGKFDK 203

Query: 238 ISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVI---FKDANLEEAVKWTSEGIFFN 294
           I +TGST VG  + E++ KS L    LE GGKSP  I      +  E A++        N
Sbjct: 204 IFYTGSTTVGTIIAEKAAKS-LTPCVLELGGKSPVFISPNLPKSQWETAIRRIYYSSMGN 262

Query: 295 SGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDP-FDKDCTVGPVISQKQYEK 353
           +GQ C A   +L    I+DEFV    D  K+  N   +F P    D     +I ++ Y +
Sbjct: 263 AGQICVAADYVLCPDSIYDEFV----DSCKKVLN---EFYPSVTSDTEYTHMIHERAYNR 315

Query: 354 IQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEF 413
           IQ  +   +G      H  + PP       IPPTI ++V  D      E FGP + I  +
Sbjct: 316 IQTVIETTKGQKTVAQHSDNLPP-----LCIPPTIISDVSWDDPSMTGENFGPILPIMRY 370

Query: 414 RDYDEAL-SLANDTSYGLAAAVFTENI-RIAHEFARDILAGTVWVNTS--NAEDVTLPFG 469
            D DE + +L       L   +FT +   I H   R I +G   VN +  +      PFG
Sbjct: 371 TDLDETIDTLIKRFDTPLVQYIFTNSKDEIDHILTR-IRSGACVVNDTLLHVGIEEAPFG 429

Query: 470 GFKMSGIGRELGRTGVESFMQTKTV 494
           G   SG G   G    ++F   +T+
Sbjct: 430 GIGTSGYGNYHGPYTFKTFTHERTI 454

>Kwal_26.7595
          Length = 524

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 117/470 (24%), Positives = 210/470 (44%), Gaps = 46/470 (9%)

Query: 56  DVNVAVRAARTSYTKTWSKTSPEQ---RTDLLLKLASLV-------ERDKEILASIETQD 105
           +++  V + + SY K   + +  +   + DL L+L +L        +R+++I+ +++ +D
Sbjct: 10  EIDAIVASCKNSYLKRQKEVANSRDPLKKDLELRLKALKSLYYGIKDREEDIIQALQ-KD 68

Query: 106 SGKPYYTNALLDIDMIIKLTKYFAGSTDKFTTGETIPIDHETLAYTL----KVPFGVVAQ 161
             +      L+++ ++     +       +   E I    E   ++     +   G V  
Sbjct: 69  FRRSRQETVLMELIVLYNHILHAIEQLPNWIKPEKISEGSEFFRFSKVSVERTSLGAVLV 128

Query: 162 IVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLI---VEAGFPPGVVNII 218
           I P+NYP+ ++   +   +A GN+VV KPSE    + +   Q++   + + +   V   I
Sbjct: 129 ISPFNYPVLLSLDPIAGAIAGGNSVVWKPSELVPATSIILEQILKDSLGSDWISVVQGAI 188

Query: 219 PGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVI---F 275
           P    ++ +A       DKI +TGST VG  V  ++GK NL   TLE GGKSP  I   F
Sbjct: 189 PETTKLIKNA-----QFDKIFYTGSTAVGSIVALEAGK-NLVPYTLELGGKSPVFITEHF 242

Query: 276 KDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKF-KDYTKRKWNFGSKFD 334
             + +  A+     G F NSGQ C A+  +LV H   +E V +  ++     W       
Sbjct: 243 SKSKIRAALSRVYFGAFSNSGQTCVASDYVLV-HSSQEELVKQLTREILDEFW------P 295

Query: 335 PFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQ 394
             D++     +I ++ Y    + +    G  +  S++   P        IPPT+  +V  
Sbjct: 296 QLDENTEYTSMIHERAYNNTVKKLENTNGIKILPSNVGSLPER-----CIPPTVVFDVDW 350

Query: 395 DSKWCKEEIFGPAVVISEFRDYDEALS-LANDTSYGLAAAVFTENIRIAHEFARDILAGT 453
           D    KEE F P +    + + D A+S +    +Y LA  +F++N R   +    I +G 
Sbjct: 351 DDALMKEENFAPVLPFVTYSNLDSAISKVVELHNYPLALYIFSDNRREIDQIMFQIKSGG 410

Query: 454 VWVNTS--NAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTVQINIRKP 501
             +  +  +   +  PFGG + SG G   G+    +F   +TV   +R+P
Sbjct: 411 CVIGDTVIHVAAMDAPFGGIRSSGSGNYHGKWSFSTFTHERTV---VRQP 457

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score =  116 bits (290), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 161/354 (45%), Gaps = 28/354 (7%)

Query: 153 KVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPP 212
           K+  G V  I P+N+P+ +A   +   L+AGNTV++KPSE +    L    ++     P 
Sbjct: 122 KISRGNVLVISPFNFPVLLALAPVACALSAGNTVILKPSEMTPHCALVLEDIVKSCQLPE 181

Query: 213 GVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPA 272
           GV+ I+ G G      L     +D I +TGS +VG +++ Q+   NL    LE GGKSP 
Sbjct: 182 GVLQIVQG-GVEQTTKLINSESLDMIFYTGSPRVG-SIVAQAAAKNLVPCVLELGGKSPT 239

Query: 273 VI---FKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNF 329
            I    +  NLE A+K    G F N+GQ C +   +LV   I+D+ V +     K     
Sbjct: 240 FITGSLQKKNLETALKRIFFGAFGNAGQICVSPDYLLVHESIYDDVVKESGKVMKE---- 295

Query: 330 GSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPPDDING-YFIPPTI 388
              +   ++      +I +  Y+K  E +   +G  V  +   D   D+ +G   IPPTI
Sbjct: 296 --LYPDLNEHTEYTHMIHKASYDKTLEKLQKTKGRKVSAA---DVKIDNTSGKLMIPPTI 350

Query: 389 YTNVPQDSKWCKEEIFGPAVVISEFRDYDEAL-SLANDTSYGLAAAVFTENIR-IAHEFA 446
             +   D    +EE F P + + ++ D D  +  + +     L   +F+E  + I H  A
Sbjct: 351 VFDSDWDDALMEEENFAPVLPVIKYTDIDATIDKILSKHDTPLVQYIFSEKQKEIDHILA 410

Query: 447 R------DILAGTVWVNTSNAEDVTLPFGGFKMSGIGRELGRTGVESFMQTKTV 494
           R       I   T+ V   +A     PFGG   SG G   G  G ++F   + V
Sbjct: 411 RLRSGDCIICDTTIHVGIKDA-----PFGGIGQSGYGNYGGVYGFDAFSHERIV 459

>YHR037W (PUT2) [2324] chr8 (181969..183696)
           Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C
           dehydrogenase), carries out the second step in proline
           degradation, allows proline to be used as a nitrogen
           source [1728 bp, 575 aa]
          Length = 575

 Score =  116 bits (290), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 133/495 (26%), Positives = 222/495 (44%), Gaps = 50/495 (10%)

Query: 39  NPATKEK-LTSFYAGSETDVNVAVRAARTSYTKTWSKTSPEQRTDLLLKLASLVE---RD 94
           NPA  ++ L +    +E DV +    A     K W       R+ + LK A L+    R 
Sbjct: 83  NPANHQQVLANVTQATEKDV-MNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRY 141

Query: 95  KEILASIETQDSGKPYYTNALLDIDMIIKLTKYF----AGSTDKFTTGETIPIDHETLAY 150
             + A++  Q  GK  Y     +ID I +L+ +F      ++D +        D      
Sbjct: 142 DMLAATMLGQ--GKNVYQ---AEIDCITELSDFFRYYVKYASDLYAQQPVESADGTWNKA 196

Query: 151 TLKVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGF 210
             +   G V  + P+N+  A+A+  + +    GNTVV KPS+ ++LS      ++ EAG 
Sbjct: 197 EYRPLEGFVYAVSPFNF-TAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGL 255

Query: 211 PPGVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLE--QSG--KSNLKD---VT 263
           P GV+N IPG    V D +    D   + FTGST V  ++    QSG  +   +D   + 
Sbjct: 256 PKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRII 315

Query: 264 LECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYT 323
            E GGK+  ++   AN+  AV  T  G F   GQ C+A SR+ +     +EF+       
Sbjct: 316 GETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGIL 375

Query: 324 KRKWNFGSKFDPFDKDCT----------VGPVISQKQYEKIQEYMTCPEGCP-VEVSHII 372
           + +        P +   +          +GPVI ++ ++K+ + +   +  P +E+ +  
Sbjct: 376 QSQ-----NVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPELEILYGG 430

Query: 373 DYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRD--YDEALSLANDTS-YG 429
            Y  D   G+F+ PT+      D  +   E FGP + + E+ D  ++E   + ++TS Y 
Sbjct: 431 QY--DKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNTSQYA 488

Query: 430 LAAAVFTENIRIAHEFARDIL---AGTVWVNTSNAEDVTLP--FGGFKMSGIGRELGRTG 484
           L  A+F ++ R A E+A + L   AG  ++N      V     FGG +MSG   + G   
Sbjct: 489 LTGAIFAKD-RKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPN 547

Query: 485 VES-FMQTKTVQINI 498
           + S F+  +  + N 
Sbjct: 548 ILSRFVSIRNTKENF 562

>Scas_717.74
          Length = 522

 Score =  110 bits (274), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 151/327 (46%), Gaps = 25/327 (7%)

Query: 153 KVPFGVVAQIVPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPP 212
           K+  G V  I P+N+P+ +A   +   + AGN+V++KPSE ++ + L   ++I EAGFP 
Sbjct: 121 KIARGNVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEAGFPD 180

Query: 213 GVVNIIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPA 272
           G+V ++ G        L T  D+D I +TGS  VG +++ Q    NL    LE GGKSP 
Sbjct: 181 GLVQVVQG-AIDETQRLITSKDLDMIFYTGSPTVG-SIIAQEAAKNLTPCVLELGGKSPT 238

Query: 273 VI---FKDANLEEAVKWTSEGIFFNSGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNF 329
            I   F D NL+ A+K    G F NSGQ C +   +LV    +++     K+        
Sbjct: 239 FITENFNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHESKYNKVAALAKEV------L 292

Query: 330 GSKFDPFDKDCTVGPVISQKQYEKIQEYMTCPEGCPVEVSHIIDYPPDDINGYFIPPTIY 389
              F   +       +IS+  Y    + +    G   +    +     D N   +PPT+ 
Sbjct: 293 IEMFPEVNDSTEFTHLISETAYNTTLKKLEATSGEKFQAKSDL----SDTN-ICVPPTLI 347

Query: 390 TNVPQDSKWCKEEIFGPAVVISEFRDYDEALSLANDTSYG-LAAAVFTE-NIRIAHEFAR 447
            N   +    ++E F P + + ++ + D+ L     T    L   +F++ N  I+H   R
Sbjct: 348 FNCQWEDSTMQQENFAPILPVLKYSNLDDTLDKIIATHNNPLVQYIFSDSNEEISHILLR 407

Query: 448 DILAGTVWVNTS----NAEDVTLPFGG 470
            + +G   +N +      +D   PFGG
Sbjct: 408 -LKSGDCVINDTILHVGIQDA--PFGG 431

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 186/392 (47%), Gaps = 40/392 (10%)

Query: 118 IDMIIKLTK--YFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWK 175
           I+++ KL K    + S+  F  G+TI           K+  G V  I P+N+PL +A   
Sbjct: 98  IEILPKLIKPRRVSDSSPPFMFGKTI---------VEKISRGSVLIIAPFNFPLLLAFAP 148

Query: 176 LQSCLAAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDV 235
           L + LAAGNT+V+KPSE +  + +    L+  AGFP G++ ++ G        L      
Sbjct: 149 LAAALAAGNTIVLKPSELTPHTAVVMENLLTTAGFPDGLIQVVQGAIDETTRLLDCG-KF 207

Query: 236 DKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVI---FKDANLEEAVKWTSEGIF 292
           D I +TGS +VG  V E++ KS L    LE GGKSP  I   FK +N++ A+K    G F
Sbjct: 208 DLIFYTGSPRVGSIVAEKAAKS-LTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAF 266

Query: 293 FNSGQNCTANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDP-FDKDCTVGPVISQKQY 351
            NSGQ C +   +LV   I+ + +       K   +  ++F P FD+      +I +  Y
Sbjct: 267 GNSGQICVSPDYLLVHKSIYPKVI-------KECESVLNEFYPSFDEQTDFTRMIHEPAY 319

Query: 352 EKIQEYMTCPEGCPVEVSHI-IDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVI 410
           +K    +    G  +  S I I+   +D+    +PPTI  N+  D    K+E F P + I
Sbjct: 320 KKAVASINSTNGSKIVPSKISINSDTEDL--CLVPPTIVYNIGWDDPLMKQENFAPVLPI 377

Query: 411 SEFRDYDEALS-LANDTSYGLAAAVF----TENIRIAHEF-ARDILAG--TVWVNTSNAE 462
            E+ D DE ++ +  +    L   +F    TE  RI     + D + G   + V  ++A 
Sbjct: 378 IEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCVVGDTVIHVGITDA- 436

Query: 463 DVTLPFGGFKMSGIGRELGRTGVESFMQTKTV 494
               PFGG   SG G   G  G  +F   +T+
Sbjct: 437 ----PFGGIGTSGYGNYGGYYGFNTFSHERTI 464

>YDL185W (TFP1) [687] chr4 (126788..130003) Catalytic subunit
           (subunit A) of the vacuolar H(+) ATPase V1 complex,
           generated upon protein splicing of the full-length
           unspliced precursor protein by ligation of the
           N-terminal and C-terminal extein moieties [3216 bp, 1071
           aa]
          Length = 1071

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 199 LYFAQLIVEAGFP--PGVVNIIPG-YG---TVVGDALSTHPDVDKISFTGSTKVGCNVLE 252
           L   Q +++A FP   G    IPG +G   TV+  +LS + + D I + G    G NVL 
Sbjct: 234 LLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAIIYVGCFAKGTNVLM 293

Query: 253 QSGKSNLKDVTLECGGKSPAVIFKDANLEEAVK 285
             G     +  +E G K   V+ KD    E +K
Sbjct: 294 ADGSIECIE-NIEVGNK---VMGKDGRPREVIK 322

>YPL149W (ATG5) [5298] chr16 (271309..272193) Protein involved in
           autophagy and nutrient starvation [885 bp, 294 aa]
          Length = 294

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 163 VPWNYPLAMASWKLQSCLAAGNTVVIKPSENSSLSLLYFAQ--LIVEAGFPPGVVNI 217
           +PWNYP+ +    L  CLA  +       EN    +L F +  L++    PP ++ I
Sbjct: 81  IPWNYPVGV----LFDCLAGKSATFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPI 133

>Sklu_2381.2 YPR072W, Contig c2381 3614-5344
          Length = 576

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 41  ATKEKLTSFYAGSETDVNVAVRAART--SYTKTW-SKTSPEQRTDLLLKLASLVERDKEI 97
           AT    TS+    E D+   ++  +      KTW SK   + +  +L++   L+E   E 
Sbjct: 33  ATDSSNTSYREKLEADLKREIKKLQKHREQIKTWLSKEDVKDKQHVLMENRRLIENGMER 92

Query: 98  LASIETQDSGKPYYTNALLDIDMI 121
             S+E     K + T AL + DMI
Sbjct: 93  FKSVEKLMKTKQFSTEALTNPDMI 116

>Scas_608.4
          Length = 115

 Score = 28.5 bits (62), Expect = 6.2,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 248 CNVLEQSGK----SNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGI 291
           C+ +E+ G      NL  V     GK+P   + DAN+++ V+W  + +
Sbjct: 29  CHTVEEGGPHKVGPNLHGVFGRHSGKAPGYSYTDANVKKDVEWNEQNM 76

>Kwal_23.5623
          Length = 276

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 217 IIPGYGTVVGDALSTHPDVDKISFTGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFK 276
           ++P   T +   LS  PD +   F+GS K+   V + S K++++  TLE    S  +   
Sbjct: 10  VLPTNVTPLHYDLSVEPDFETFKFSGSVKIDLKVNDAS-KNSVELNTLEIDIHSAQI--- 65

Query: 277 DANLEEAVKWTSE 289
               E+AVKW ++
Sbjct: 66  --GSEKAVKWETD 76

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 23  SNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETD----VNVAVR-AARTSYTKTWSKTSP 77
           SN  V+   G  +  F     +++  +Y+ S+ D     +VAV  +AR+SYTK       
Sbjct: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQ------ 62

Query: 78  EQRTDLLLKLASLVERDKEILASIET 103
           E  T  LLK   L  +D+E    IET
Sbjct: 63  EGTTSRLLKCCDLASQDQEYSDIIET 88

>KLLA0B09196g complement(803259..805031) some similarities with
           sp|Q12514 Saccharomyces cerevisiae YPR072w NOT5
           component of the NOT protein complex, hypothetical start
          Length = 590

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 48  SFYAGSETDVNVAVRAART--SYTKTW-SKTSPEQRTDLLLKLASLVERDKEILASIETQ 104
           S+    E+D+   ++  +      K W SK   + R D+L++   L+E   E   SIE  
Sbjct: 40  SYREKLESDLKREIKKLQKHREQIKNWLSKDDIKDRADVLMENRRLIESGMERFKSIEKI 99

Query: 105 DSGKPYYTNALLDIDMI 121
              K + T AL + D+I
Sbjct: 100 MKTKKFSTEALTNPDLI 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,380,149
Number of extensions: 792457
Number of successful extensions: 2165
Number of sequences better than 10.0: 66
Number of HSP's gapped: 2013
Number of HSP's successfully gapped: 66
Length of query: 503
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 397
Effective length of database: 12,926,601
Effective search space: 5131860597
Effective search space used: 5131860597
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)