Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_669.1295895847760.0
CAGL0F07821g92198115550.0
Kwal_23.348190898814480.0
ADL280W93397913201e-167
KLLA0E14740g90665310411e-126
Scas_717.6032593573631e-34
AER304C32583853594e-34
Kwal_47.1838932293583424e-32
YDR457W (TOM1)32683583301e-30
CAGL0K06303g32473583255e-30
KLLA0B01804g32423683245e-30
Kwal_47.173027873613162e-29
KLLA0E13607g8193613046e-28
ADL055C8173592965e-27
Scas_627.28353592912e-26
YER125W (RSP5)8093542894e-26
CAGL0K02255g8223542804e-25
KLLA0E22660g8063592733e-24
AEL068W8393682502e-21
YGL141W (HUL5)9101512422e-20
Kwal_26.786914494362395e-20
YKL010C (UFD4)14834492395e-20
Scas_668.2114283932324e-19
KLLA0B13585g14674462163e-17
Kwal_34.160648493612153e-17
ABR013W14243772083e-16
YJR036C (HUL4)8923571912e-14
CAGL0M10175g14763951877e-14
Scas_549.38423761822e-13
Sklu_2101.24114511765e-13
CAGL0I01672g8583831652e-11
KLLA0F21208g177476751.0
KLLA0A01782g52881694.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_669.12
         (958 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_669.12                                                          1844   0.0  
CAGL0F07821g complement(762977..765742) similar to sp|P53119 Sac...   603   0.0  
Kwal_23.3481                                                          562   0.0  
ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH] complement(...   513   e-167
KLLA0E14740g complement(1316238..1318958) similar to sp|P53119 S...   405   e-126
Scas_717.60                                                           144   1e-34
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...   142   4e-34
Kwal_47.18389                                                         136   4e-32
YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required f...   131   1e-30
CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces c...   129   5e-30
KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyce...   129   5e-30
Kwal_47.17302                                                         126   2e-29
KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces...   121   6e-28
ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH] (584035..58...   118   5e-27
Scas_627.2                                                            116   2e-26
YER125W (RSP5) [1555] chr5 (410185..412614) Essential ubiquitin-...   115   4e-26
CAGL0K02255g complement(199719..202187) highly similar to sp|P39...   112   4e-25
KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces...   109   3e-24
AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH] complement(...   100   2e-21
YGL141W (HUL5) [1846] chr7 (238356..241088) Putative ubiquitin-p...    98   2e-20
Kwal_26.7869                                                           97   5e-20
YKL010C (UFD4) [3246] chr11 complement(421067..425518) Ubiquitin...    97   5e-20
Scas_668.21                                                            94   4e-19
KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces...    88   3e-17
Kwal_34.16064                                                          87   3e-17
ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH] complement(4...    85   3e-16
YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative ...    78   2e-14
CAGL0M10175g complement(1014414..1018844) similar to sp|P33202 S...    77   7e-14
Scas_549.3                                                             75   2e-13
Sklu_2101.2 YGL141W, Contig c2101 1350-2581                            72   5e-13
CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces c...    68   2e-11
KLLA0F21208g 1975203..1980527 similar to sp|P42945 Saccharomyces...    33   1.0  
KLLA0A01782g complement(157216..158802) some similarities with s...    31   4.9  

>Scas_669.12
          Length = 958

 Score = 1844 bits (4776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 912/958 (95%), Positives = 912/958 (95%)

Query: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60
           MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC
Sbjct: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60

Query: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120
           QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA
Sbjct: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120

Query: 121 TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFMQNGLIPFLNHFEHVNETEATVSLIFEYLC 180
           TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFMQNGLIPFLNHFEHVNETEATVSLIFEYLC
Sbjct: 121 TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFMQNGLIPFLNHFEHVNETEATVSLIFEYLC 180

Query: 181 SWYKDDFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSVFSHLLREPMRVLEN 240
           SWYKDDFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSVFSHLLREPMRVLEN
Sbjct: 181 SWYKDDFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSVFSHLLREPMRVLEN 240

Query: 241 YFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCLPTKDAYHIK 300
           YFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCLPTKDAYHIK
Sbjct: 241 YFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCLPTKDAYHIK 300

Query: 301 NLFESKFIDTFLEKRPSYEHEVHFMGWYKFLQLADMCNKKTSVLLNFLSNKSLMFELFTS 360
           NLFESKFIDTFLEKRPSYEHEVHFMGWYKFLQLADMCNKKTSVLLNFLSNKSLMFELFTS
Sbjct: 301 NLFESKFIDTFLEKRPSYEHEVHFMGWYKFLQLADMCNKKTSVLLNFLSNKSLMFELFTS 360

Query: 361 IDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTKSLKDLVFHNLWDLS 420
           IDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTKSLKDLVFHNLWDLS
Sbjct: 361 IDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTKSLKDLVFHNLWDLS 420

Query: 421 KDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEIKDPNITTSKDFWATDDQNF 480
           KDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEIKDPNITTSKDFWATDDQNF
Sbjct: 421 KDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEIKDPNITTSKDFWATDDQNF 480

Query: 481 LKINIYKILSNYDDAYRSKAXXXXXXXXXXXXXXXXXXTMKKRSLKLEVFEEMSRNQTRN 540
           LKINIYKILSNYDDAYRSKA                  TMKKRSLKLEVFEEMSRNQTRN
Sbjct: 481 LKINIYKILSNYDDAYRSKAELNEDNNEEEAGMENENNTMKKRSLKLEVFEEMSRNQTRN 540

Query: 541 ETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLDDPDRNMMFELAMPWMSNGM 600
           ETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLDDPDRNMMFELAMPWMSNGM
Sbjct: 541 ETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLDDPDRNMMFELAMPWMSNGM 600

Query: 601 GRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSE 660
           GRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSE
Sbjct: 601 GRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSE 660

Query: 661 EGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720
           EGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK
Sbjct: 661 EGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720

Query: 721 KLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780
           KLLNYSNNFQ             YMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP
Sbjct: 721 KLLNYSNNFQLSFDDLSSLDSSLYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780

Query: 781 NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXX 840
           NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQM  
Sbjct: 781 NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMLI 840

Query: 841 XXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900
                        NNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG
Sbjct: 841 SGGGKDIDLDDLKNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900

Query: 901 FQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGARFDLS 958
           FQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGARFDLS
Sbjct: 901 FQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGARFDLS 958

>CAGL0F07821g complement(762977..765742) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase, start by similarity
          Length = 921

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/981 (39%), Positives = 555/981 (56%), Gaps = 83/981 (8%)

Query: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60
           M+NFTGQTR+RNVNLG +  TTKK++L RA+LER++RA+++ +  +A  IQ  IR  L+C
Sbjct: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60

Query: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120
           ++    ++    +   +H+ P  G ++L Y     L  +L ++K ++  + + +  N+  
Sbjct: 61  KKTALLNLTSPKV---VHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGT-ALGNW-- 114

Query: 121 TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFMQNGLI----PFLNHFEHVNETEAT-VSLI 175
            KLL+    C  ++     I+   L++   + +G+I     F++  E +  T    + +I
Sbjct: 115 -KLLNIYSDCHDVNIANMCIN--CLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVI 171

Query: 176 FEYLCSWYKDDFEAKSIVQLEIFQLNIHRCKSRE----FIEFLLLNSFLTFESSVFSHLL 231
              L +W K  F         +F++   +C   E    F E L+LN  L       S +L
Sbjct: 172 APVLSAW-KVQFSQN---YRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVL 227

Query: 232 REPMRVLENYFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCL 291
                 LEN   +Y +L +          +N +  +++ + V ++ Y            +
Sbjct: 228 ------LENMSYLYSKLKH----------ANQHLYNIIRQCVTNVRY----------EPV 261

Query: 292 PTKDAYHIKNLFESKFIDTFLEKRPSYEHEVHFMG-WYKFLQLADMCNKKTSVLLNFLSN 350
             +   ++  +++  FI ++L+   S     +F      F++ A    ++ SV ++ LS 
Sbjct: 262 NIRMRGYVTEIYQKDFIYSYLD---SINIHTNFSSDLLNFIENAPSEAERDSVYVSLLSR 318

Query: 351 KSLMFELF-----------TSIDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMN 399
           ++ +  L            T  D      AF+LL +L+ + L +STD +LL + ++I + 
Sbjct: 319 ENFVENLLNIFSRFQDPEQTYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLE 378

Query: 400 QLISFTKSLKDLVFHNLWDLSKDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGH 459
           QL+ FT  +KD+VF+++W    +D       AL LL  +YLRDSR+ F  K  N D    
Sbjct: 379 QLVLFTDGIKDMVFNDMWTKPTNDSFLYTNEALPLLKIIYLRDSRMKFC-KSSNGD---- 433

Query: 460 EIKDPNITTSKDFWATDDQNFLKINIYKILSNYDDAYRSKAXXXXXXXXXXXXXXXXXXT 519
                     K++W   + +FLK  IYK + +Y+D YRS                     
Sbjct: 434 ----------KEYWTVYNTDFLKTAIYKQIQDYEDYYRSYKDNYDDLYDSDDEDNNDKEI 483

Query: 520 MKKRSLKLEVFEEMSRNQTRNETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLN 579
               +LK      M      N  KQ RKL ILL  PF++PF +RV++FYTLI LDK+RLN
Sbjct: 484 NDIMNLKANYLVNMEVKP--NNIKQFRKLKILLEAPFYVPFEQRVEMFYTLIELDKRRLN 541

Query: 580 LDDPDRNMMFELAMPWMSNGMGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEF 639
           LDD D ++M ++      +   RQ   ISR++VLEDA++S+N  GERFK +LSVTF NEF
Sbjct: 542 LDD-DSSLMMDVLNALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEF 600

Query: 640 GPEAGIDGGGITKEFLTSVSEEGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKI 699
           GPEAGIDGGGITKEFLTSV+EEGFK  +YKLF+TN  YELYPS++V   K+KY +F+GK+
Sbjct: 601 GPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGKV 660

Query: 700 VGKCLYEHVLIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQ 759
           +GKC+Y+ VLID+ F +F LKKLLN SN++              Y NL KLLAM+  +++
Sbjct: 661 LGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLE 720

Query: 760 SLGLTFEMT--SSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHG 817
           SL L FE+   S+ K++  ELIPNGS   VTK NVLQYL  ++++KLN S+ +Q  + H 
Sbjct: 721 SLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHR 780

Query: 818 GLSTMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAE 877
           GLS MI P W EMFNS ELQ                +N  YGGFS    TI   W+I+ E
Sbjct: 781 GLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEE 840

Query: 878 CNTEERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQD 937
              ++RL  +KFVTSVPQAPLQGF ALEP+FGIRN+G E DRLPTA+TCVNLLKLPDY D
Sbjct: 841 FEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYAD 900

Query: 938 KELLREKLLYAIKSGARFDLS 958
           KELLR+KLLYAI +GA FDLS
Sbjct: 901 KELLRQKLLYAINAGAGFDLS 921

>Kwal_23.3481
          Length = 908

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/988 (37%), Positives = 535/988 (54%), Gaps = 110/988 (11%)

Query: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60
           M+NFTGQT+RRNVNLG +   TK++LL  A+ ERE+RA  R     A  IQS IR + + 
Sbjct: 1   MLNFTGQTKRRNVNLGNKSGRTKQELLNEARKERERRALIRRNEENAVIIQSAIRRYESS 60

Query: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFR-NYF 119
           +  +   I   D + +  +  AY     +   EE   ++L            G +  N  
Sbjct: 61  KSSYTAFINNLDQDIARSLIIAYPVSTFHTLGEEVTQRVLNCVT------NEGQYVLNLR 114

Query: 120 ATKLLSRIKTC-CMLSTVLDIIDKDTLSMKTFMQNGLIPFLNHFEHVNETEAT-VSLIFE 177
            T+LLS + +  C  + +  ++ K            L+P       +N  +A  V  I +
Sbjct: 115 ITRLLSELGSRECSETFINTVLSK------------LVP-------INPPKAEYVQSIIK 155

Query: 178 YLCSWYKDDFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSVFSHLLREPMRV 237
            L S     +E  + +   I QL +H     E     LL S    +S V S++ R+ +++
Sbjct: 156 LLTSA---TYEFSAAILSHIVQL-VHDFNIWESQLLTLLFSIPIEDSKVASNI-RQFLQL 210

Query: 238 LENYFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFP--------------LV 283
           L        Q +++DT          ++ HL++ L     YI+               L 
Sbjct: 211 LSK--TCPPQDLSEDT----------SSRHLVDNLA----YIYTAAVDSAKPKLADAVLK 254

Query: 284 SKDSMTCLPTKDAYHIKNLFESKFIDTFLEKRPSYEHEVHFMGWYK----FLQLADMCNK 339
           S      L   D  H   L+   F+D  +  R S +      G+Y      +  A   ++
Sbjct: 255 SLKPFRGLVLGDCPHFSGLYTRSFVDVVM--RSSSD------GFYDKMSDLISQAPDVDR 306

Query: 340 KTSVLLNFLSNKSLMFELFTSIDQSDSKMAFQ-----LLIELMDLWLLVSTDFDLLSDSS 394
           K +VL+  L+    + + +      +S+MA +     LL+E+++L+L V++D+++L +  
Sbjct: 307 KNNVLIALLAKPGALSQAYNQAIDKNSEMASKPKNALLLVEMLNLYLSVASDYEILHNVE 366

Query: 395 KISMNQLISFTKSLKDLVFHNLWDLSKDDRSENF-ETALHLLNKLYLRDSRIHFVTKKRN 453
              +  L   T  LK++ F NLWD S   R E   +  L  L K++LRDSR+HF ++   
Sbjct: 367 TFPLQYLQKATVFLKNVCFENLWDESG--RQEVLADCYLSTLKKIHLRDSRLHFCSQ--- 421

Query: 454 HDEKGHEIKDPNITTSKDFWATDDQNFLKINIYKILSNYDDAYRSKAXXXXXXXXXXXXX 513
                            DFW+  D+ FL +NI   + +Y+  YR                
Sbjct: 422 -------------NNKIDFWSVLDEGFLNVNITNYIKDYESFYRDH----LNAVENENDE 464

Query: 514 XXXXXTMKKRSLKLEVFEEMSRN-QTRNETKQLRKLSILLRVPFFLPFNERVDLFYTLIA 572
                +MK+  L+ +       +   R  T+Q RKL+IL   PF++PF +RVD  Y LI+
Sbjct: 465 KGYEDSMKRSDLRRDFLSAAQVSFSNRPTTRQYRKLNILFNAPFYIPFQQRVDWLYLLIS 524

Query: 573 LDKQRLNLDDPDRNMMFELAMPW-MSNGMGRQTAVISREHVLEDAFNSYNKIGERFKSRL 631
           LD QRL+L    +N +  +  PW M     +Q A ISRE++LEDAF +YN IGE FKS+L
Sbjct: 525 LDHQRLDLS---QNGLGSVFSPWNMRPNFDKQNATISRENLLEDAFAAYNPIGESFKSKL 581

Query: 632 SVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKSEYKLFETNDQYELYPSTDVT-PEKL 690
           S+TFVNEFGPEAGIDGGGITKEFLTS++++ FK  +Y+LF+ N  +E+YP++++     +
Sbjct: 582 SITFVNEFGPEAGIDGGGITKEFLTSITDKAFKDDKYQLFKHNKNHEIYPASNLNDSANV 641

Query: 691 KYLWFMGKIVGKCLYEHVLIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKL 750
            Y+WF+GK++GKCLY+HVL+DV+FA+FFLKKLLN+ NN               Y NL KL
Sbjct: 642 NYVWFLGKVLGKCLYDHVLVDVTFADFFLKKLLNF-NNSNSSFDDLASLDPDLYSNLAKL 700

Query: 751 LAMTDEEIQSLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFR 810
           L M  +E+Q+LGL FE+T     + +EL+PNGS + V K NVL +L  VS++KLN  +  
Sbjct: 701 LVMNSDELQALGLLFEITDEDTHRTVELVPNGSSLRVDKSNVLHFLLAVSDFKLNKKLRV 760

Query: 811 QCVSFHGGLSTMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVA 870
              +F GGL TMI P W+EMFNS ELQM               NN EYG ++   +TI  
Sbjct: 761 GTRAFTGGLYTMIPPHWIEMFNSAELQMLISGGGKDIDLEDLQNNTEYGDYTYKHQTIKD 820

Query: 871 LWEIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLL 930
            WEI+AEC+ E+RL F+KFVTSVP+APLQGF +L PRFGIRNAG +  RLPTASTCVNLL
Sbjct: 821 FWEILAECSPEDRLKFVKFVTSVPRAPLQGFGSLSPRFGIRNAGQDTSRLPTASTCVNLL 880

Query: 931 KLPDYQDKELLREKLLYAIKSGARFDLS 958
           KLPDY++KE+LR KLLYAI + ARFDLS
Sbjct: 881 KLPDYRNKEILRAKLLYAINAEARFDLS 908

>ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH]
           complement(209353..212154) [2802 bp, 933 aa]
          Length = 933

 Score =  513 bits (1320), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 334/979 (34%), Positives = 486/979 (49%), Gaps = 67/979 (6%)

Query: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60
           M+NF+G T+RRNVNLG+     K +L+ +A+LERE+RA+++    +   IQ   R     
Sbjct: 1   MLNFSGSTKRRNVNLGSSKKINKSELIEKARLERERRAQEKRIQESTLCIQRCARRWTAR 60

Query: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120
           ++       ++  E+   I  A+G  IL+Y   + ++ +++      +D  +  +R    
Sbjct: 61  RRVLGSLDGVAAREYGTQILVAFGAGILHYARGDAVAAVVEACS---VDSATAYWR---C 114

Query: 121 TKLLSRIKTCCMLSTVLDIIDK-DTLSMKTFMQNGLIPFLNHFEHVNETEATVSLIFEYL 179
           T+LL ++        V  ++DK +    +     G  P     + +         + E +
Sbjct: 115 TELLEQVARGGETGLVRQLLDKLNAAGARPLTDAGAAPG-GRLQRIERLVGARLRVLEAM 173

Query: 180 CSWYKDDFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSVFSHLL---REPMR 236
               + +   + +  L     +    +  E +++  L         V ++LL   RE  +
Sbjct: 174 ----RGELTRRDMNALLAVVPSGGEMRGDEAVQWAALYGVEQARVRVRANLLCYLRELAQ 229

Query: 237 VLENYFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFPLVSKDSMTCLPTKDA 296
            L    ++     + DT+    YL         ERL +D   I+ ++      C+    +
Sbjct: 230 RLSPEVVLQQGPCSVDTIYYLTYL-------FAERLGRDPDAIYAVLC----ACIDQHKS 278

Query: 297 YHIKNLFESKFIDTFLEKRPSYEHEVHFMGWYK-------------FLQLADMCNKKTSV 343
           +   +     F   ++E   SY       G+ +             FL  A    +   +
Sbjct: 279 FEFDS---GSFFFQYVEGIYSYRTASLLAGYLRTHSVPTASQYAKVFLDRAPSPRQAEVL 335

Query: 344 LLNFLSNKSLMFELFTSIDQSDS--KMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQL 401
           LL  +++   M  L      S +    +F LL E +D++L    D  LL   S   +  L
Sbjct: 336 LLGIVADADAMQRLVQECKTSGAVTSASFSLLTECLDIYLSYVNDTVLLGPKSNFPLEDL 395

Query: 402 ISFTKSLKDLVFHNLWDLSKDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEI 461
           + F   ++D +   L     D        AL LL KLY+RD R +F++  +         
Sbjct: 396 VVFCNLVRDAISQAL-RAEHDYEVNKMRRALSLLQKLYIRDRRTNFLSAAKG-------- 446

Query: 462 KDPNITTSKDFWATDDQNFLKINIYKILSNYDDAYRSKAXXXXXXXXXXXXXXXXXXTMK 521
                    DFW   D      +I  +L  +D+ YR +                      
Sbjct: 447 --------DDFWVIADTTVKNCDITSLLLYFDEFYREQLDLFLAQGRARHEVPSGDLVAW 498

Query: 522 KRSLKLEVFEEMSRNQTRNETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLD 581
           +  +K++ F E S       +  LRK  ++LR PF LPF ERV  F TLI  D++RL   
Sbjct: 499 ENDIKVKFFSEKSSKHASWGSLALRKFELVLRAPFLLPFRERVAYFETLIHHDRRRLQ-- 556

Query: 582 DPDRNMMFELAMPWMS-NGMGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFG 640
              R+    L +P +      RQ A+ISR ++LEDA+ +YN +GE FK +L+VTF+NEFG
Sbjct: 557 --GRHTGPALRLPDLYFPSSRRQRAIISRNNILEDAYEAYNPLGEDFKDQLAVTFINEFG 614

Query: 641 PEAGIDGGGITKEFLTSVSEEGFKKSEYKLFETNDQYELYPSTDVT-PEKLKYLWFMGKI 699
           PEAGIDGGGITKEFLTSVS+EGF K +Y+LF+ N  YELYPS   T P++L+YL F+GK+
Sbjct: 615 PEAGIDGGGITKEFLTSVSDEGFNKDKYRLFKANSVYELYPSDAATSPQQLQYLHFLGKV 674

Query: 700 VGKCLYEHVLIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQ 759
           +GKCLYE VLIDV FA+FFL KLL+ S N               Y NL KL  M+  E+Q
Sbjct: 675 LGKCLYEKVLIDVHFADFFLHKLLSTSKNMACSFDNLPSFDRELYDNLNKLFDMSTAELQ 734

Query: 760 SLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGL 819
            L L  E+      K +EL+P GS IPVT  NV QY   V++Y++N  + R    F  G+
Sbjct: 735 LLDLRMEIVDENTMKIVELVPGGSQIPVTTTNVRQYALAVASYRMNSQLARATFYFQTGM 794

Query: 820 STMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECN 879
           + +I P W+ +F+S EL                  NV YGG+   D TI  LW+++ E  
Sbjct: 795 AVIIPPHWIAIFSSSELSKLISGGGRDIDLADLRANVTYGGYVESDPTIQHLWQLLLEFT 854

Query: 880 TEERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKE 939
            E+R  FIKF TSVP+APL GFQ L P+FGIRNAGT+ +RLPTASTCVNLLKLPDYQDK+
Sbjct: 855 PEQRCKFIKFATSVPRAPLLGFQMLNPKFGIRNAGTDYNRLPTASTCVNLLKLPDYQDKD 914

Query: 940 LLREKLLYAIKSGARFDLS 958
           LLREKLLYAI S ARFDLS
Sbjct: 915 LLREKLLYAINSEARFDLS 933

>KLLA0E14740g complement(1316238..1318958) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase (E3), start by similarity
          Length = 906

 Score =  405 bits (1041), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 244/653 (37%), Positives = 359/653 (54%), Gaps = 39/653 (5%)

Query: 309 DTFLEKRPSYEHEVHFMGWYKFLQLADMCNKKTSVLLNFLSNKSL---MFELFTSIDQSD 365
           D   E+  SY   +HF       QL  M  ++ S+L++ L+N  +   + EL      + 
Sbjct: 290 DWLKEESSSYWKGIHFF----LSQLPSM--QRNSILMSILTNTHIRNDLLELLCDDSVAA 343

Query: 366 SKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTKSLKDLVFHNLWDLSKDDRS 425
           +  AF +  ++++ ++ +S D  L    + I+ ++L + + ++  L+  ++        S
Sbjct: 344 NLNAFSVCSQMLNFYIPLSPDDQLFK--TIITRDRLQALSINIAKLLISSILGSDTFIPS 401

Query: 426 ENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEIKDPNITTSKDFWATDDQNFLKINI 485
           +  +T + L+  L   DSR+ F+ K                  +  FW    +    +NI
Sbjct: 402 QELDTFIELMWNLIYLDSRVQFLKKG-----------------TSTFWDLVPEEMHNLNI 444

Query: 486 YKILSNYDDAYRSKAXXXXXXXXXXXXXXXXXXTMKKRSLKLEVFEEMSRNQTRNETKQL 545
            K +  ++  YR+                     + + ++K +  +++ +++ R  + ++
Sbjct: 445 KKEILEFEQYYRAYLVRFEEMDLNEDEMFDKKKFIDQ-NIKGQYLDDL-KSKRRGSSSKI 502

Query: 546 RKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLDDPDRNMMFELAMPWMSNGMGRQTA 605
           RKL +L + PF + F ERVD F  LI  DK R+      RN  F +  P    G  R  +
Sbjct: 503 RKLELLFKFPFMIKFFERVDYFNDLIEADKIRIY----SRNSFFGV-FP----GENRLRS 553

Query: 606 VISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
            I REH LEDA+N+Y  +GE FK +L + FVNEFGPEAGIDGGGITKEFL ++ +EGF  
Sbjct: 554 TIRREHALEDAYNAYGAVGEMFKEKLGIQFVNEFGPEAGIDGGGITKEFLQTLVQEGFIN 613

Query: 666 SEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKKLLNY 725
             +KLF+T    +LYPS +V+P+ LKY+ FMGKI+GKCLYE++L+DV  A+FFLKK+LN 
Sbjct: 614 QPFKLFDTTSFNKLYPSKNVSPQNLKYISFMGKILGKCLYENILVDVELADFFLKKILNV 673

Query: 726 SNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIPNGSHI 785
            NN               Y NL KLL M++ E+  + L FE+  +   K I LI +G   
Sbjct: 674 ENNMNVPFNDLYSLDPEYYRNLMKLLEMSENELAYMDLYFEVPDAPNGKRIPLIKDGLST 733

Query: 786 PVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXXXXXXX 845
            VT++NV +Y+T++S+YKLN+ ++     F  GLS MI   W+ MF S EL+        
Sbjct: 734 KVTQKNVFEYITRISHYKLNLQLYTVTSRFITGLSYMIPAHWLRMFTSYELKTLISGSEK 793

Query: 846 XXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQGFQALE 905
                    N  YGGFS    TI   W++++    EER  F+KFV SVP APL+GF +L 
Sbjct: 794 DFDLEDLKKNTSYGGFSESSVTIQHFWQVLSSFTPEERRKFLKFVFSVPTAPLKGFHSLN 853

Query: 906 PRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGARFDLS 958
           P FGIRNAG E DRLPTASTC+NLLKLPDYQ+   LREKLL AI S +RF+LS
Sbjct: 854 PLFGIRNAGDETDRLPTASTCINLLKLPDYQNYHTLREKLLTAINSDSRFELS 906

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 1  MMNFTGQTRRRNVNLGTR-PLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLT 59
          MMNF GQ  RRNVN+G+R P  T+  +L  A+LER +R ++R  INA   IQ ++R  ++
Sbjct: 1  MMNFNGQVTRRNVNMGSRAPRKTRDTILKNAELERARRQRERAEINAVLTIQRYMRKRIS 60

Query: 60 CQQFF 64
              F
Sbjct: 61 NNLIF 65

>Scas_717.60
          Length = 3259

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 169/357 (47%), Gaps = 21/357 (5%)

Query: 607  ISREHVLEDAFNS--YNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFK 664
            + R+ V  D++ +  + K  E   S+L +TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2906 VRRDQVFLDSYRALFFKKDEEIKDSKLEITFKGE----SGVDAGGLTREWYQVLSRQMFN 2961

Query: 665  KSEYKLF--ETNDQYELYP--STDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720
              +Y LF    +D+   +P  ++ + PE L +  F+G ++GK + +   +D  F+    K
Sbjct: 2962 -PDYALFLPVASDKTTFHPNRTSGINPEHLSFFKFIGMVIGKAIRDQCFLDCHFSREVYK 3020

Query: 721  KLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780
             +L    + +             Y +L  +L     +I     + E+    + K I+LI 
Sbjct: 3021 NILGKPVSLRDMESLDPDY----YKSLVWILENDITDIIEETFSVELDDYGEHKTIDLIE 3076

Query: 781  NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXX 840
            NG++IPVT+EN  +Y+ K+  YKLN S+  Q  +F  G   +I    + +F+  EL++  
Sbjct: 3077 NGANIPVTEENKQEYVKKIVEYKLNTSVKEQMDNFLRGFYALIPLNLISIFDEQELEL-L 3135

Query: 841  XXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900
                         NN  Y  ++  D+ I   W  +   + EER   ++FVT   + PL G
Sbjct: 3136 ISGLPDIDVDDWKNNTNYVNYTISDREIGYFWRAVRSFDGEERAKLLQFVTGTSKVPLNG 3195

Query: 901  FQALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSG 952
            F+ L       +F I       +RLP++ TC N L LP Y   E LR  LL AI  G
Sbjct: 3196 FKELGGVNGVCKFSIHKDYGSTERLPSSHTCFNQLNLPAYNSYETLRGSLLIAINEG 3252

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
            (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 179/385 (46%), Gaps = 23/385 (5%)

Query: 580  LDDPDRNMMFELAMPWMSNGMGRQTAVISREHVLEDAFNS-YNKIGERFK-SRLSVTFVN 637
            LD  ++   F   +  +++   + +  + REHV  D++ S + K  E  K S+L ++F  
Sbjct: 2878 LDFDNKRYYFTAQLRAITHDRPKLSISVRREHVFLDSYRSLFFKSNEDIKISKLEISFKG 2937

Query: 638  EFGPEAGIDGGGITKEFLTSVSEEGFKKSEYKLF--ETNDQYELYP--STDVTPEKLKYL 693
            E    AG+D GGIT+E+   +S + F   +Y LF    +D+    P  ++ + PE L + 
Sbjct: 2938 E----AGVDAGGITREWYQVLSRQMFNP-DYALFIPVASDKTTFRPNRTSGINPEHLSFF 2992

Query: 694  WFMGKIVGKCLYEHVLIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAM 753
             F+G I+GK + +   +D  F+    K +L      +             Y +L  +L  
Sbjct: 2993 KFIGMIIGKAISDQCFLDCHFSREVYKNILGKPVALKDMESLDLDY----YKSLIWILEN 3048

Query: 754  TDEEIQSLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCV 813
               +I     + E     + K IELI NG+H+ VT++N   Y+ K+  YKL  S+  Q  
Sbjct: 3049 DITDIIEETFSVETDDYGEHKVIELIENGAHVAVTEQNKHDYVKKIVEYKLQTSVKDQME 3108

Query: 814  SFHGGLSTMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWE 873
            +F  G   +I    + +F+  EL++               NN  Y  ++   K I   W 
Sbjct: 3109 NFLQGFYAIIPKDLISIFDEQELEL-LVSGLPDIDVDDWKNNTIYVNYTPTCKQINYFWR 3167

Query: 874  IMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGI------RNAGTELDRLPTASTCV 927
             +   + EER   ++FVT   + PL GF+ L    GI      R+ G+ +DRLP++ TC 
Sbjct: 3168 AVRSFDKEERAKLLQFVTGTSKVPLNGFKELSGVNGISKFSIHRDYGS-IDRLPSSHTCF 3226

Query: 928  NLLKLPDYQDKELLREKLLYAIKSG 952
            N L LP Y   E LR  LL AI  G
Sbjct: 3227 NQLDLPAYDSYETLRGSLLLAINEG 3251

>Kwal_47.18389
          Length = 3229

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 168/358 (46%), Gaps = 23/358 (6%)

Query: 607  ISREHVLEDAFNS-YNKIGERFK-SRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFK 664
            + R+ V  D++ S + K  E  K S+L +TF  E    AG+D GG+T+E+   +S + F 
Sbjct: 2876 VRRDQVFLDSYRSLFFKSNEDIKNSKLEITFKGE----AGVDAGGVTREWYQVLSRQMFN 2931

Query: 665  KSEYKLF--ETNDQYELYP--STDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720
              +Y LF    +D+   +P  ++ + PE L +  F+G I+GK + +   +D  F+    K
Sbjct: 2932 -PDYALFLPVASDKTTFHPNRTSSINPEHLSFFKFIGMIIGKAICDQCFLDCHFSREVYK 2990

Query: 721  KLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780
             +L      +             Y +L  +L     +I     + E     + K I+LI 
Sbjct: 2991 NILGKPVALKDMESLDLDY----YKSLIWILENDITDIIEESFSVETDDYGEHKVIDLIE 3046

Query: 781  NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXX 840
            NG +I VT++N  +Y+ K+  YKL+ S+  Q  +F  G   +I    V +F+  EL++  
Sbjct: 3047 NGRNILVTEQNKQEYVKKIVEYKLHTSVKEQMDNFLLGFYAIIPKELVAIFDEQELEL-L 3105

Query: 841  XXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900
                         NN  Y  ++   K I   W  +   ++EER   ++FVT   + PL G
Sbjct: 3106 ISGLPDIDVDDWKNNTNYVNYTPTCKQINYFWRAVRSFDSEERAKLLQFVTGTSKVPLSG 3165

Query: 901  FQALEPRFGI------RNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSG 952
            F+ L    GI      R+ G   DRLP++ TC N L LP Y   E LR  LL A+  G
Sbjct: 3166 FKELTGVNGISKFSIHRDYGA-TDRLPSSHTCFNQLDLPAYDSYETLRGSLLLAVNEG 3222

>YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required for
            the G2/M transition, has similarity to Rsp5p, a
            ubiquitin-protein ligase (E3 enzyme) [9807 bp, 3268 aa]
          Length = 3268

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 165/358 (46%), Gaps = 23/358 (6%)

Query: 607  ISREHVLEDAFNS-YNKIGERFK-SRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFK 664
            + RE V  D++ + + K  +  K S+L +TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2915 VRREQVFLDSYRALFFKTNDEIKNSKLEITFKGE----SGVDAGGVTREWYQVLSRQMFN 2970

Query: 665  KSEYKLF--ETNDQYELYP--STDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720
              +Y LF    +D+   +P  ++ + PE L +  F+G I+GK + +   +D  F+    K
Sbjct: 2971 -PDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYK 3029

Query: 721  KLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780
             +L    + +             Y +L  +L     +I     + E     + K I LI 
Sbjct: 3030 NILGRPVSLKDMESLDPDY----YKSLVWILENDITDIIEETFSVETDDYGEHKVINLIE 3085

Query: 781  NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXX 840
             G  I VT+ N   Y+ KV  YKL  S+  Q  +F  G   +I    + +F+  EL++  
Sbjct: 3086 GGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELEL-L 3144

Query: 841  XXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900
                         NN  Y  +++  K +   W  +   + EER   ++FVT   + PL G
Sbjct: 3145 ISGLPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVPLNG 3204

Query: 901  FQALEPRFGI------RNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSG 952
            F+ L    G+      R+ G+  +RLP++ TC N L LP Y+  E LR  LL AI  G
Sbjct: 3205 FKELSGVNGVCKFSIHRDFGSS-ERLPSSHTCFNQLNLPPYESYETLRGSLLLAINEG 3261

>CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces
            cerevisiae YDR457w ubiqitin ligase, start by similarity
          Length = 3247

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 164/358 (45%), Gaps = 23/358 (6%)

Query: 607  ISREHVLEDAFNS-YNKIGERFK-SRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFK 664
            + R+ V  D++ + + K  E  K SRL +TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2894 VRRDQVFLDSYRALFFKSNEEIKNSRLEITFKGE----SGVDAGGVTREWYQVLSRQMFN 2949

Query: 665  KSEYKLFE--TNDQYELYP--STDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLK 720
               Y LF    +D+    P  ++ V PE L +  F+G ++GK + +   +D  F+    K
Sbjct: 2950 PG-YALFTPVASDKTTFRPNRASGVNPEHLSFFKFVGMVIGKAIRDQCFLDCHFSREVYK 3008

Query: 721  KLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIP 780
             +L      +             Y +L  +L     +I     + E     + K I+LI 
Sbjct: 3009 SILGKPVALKDMESLDLDY----YKSLVWILENDITDIIEETFSVETDDYGEHKIIDLID 3064

Query: 781  NGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXX 840
            NG ++ VT+ N   Y+ K+  YKL+ S+  Q  +F  G   +I    + +F+  EL++  
Sbjct: 3065 NGRNVSVTESNKQDYVRKIVEYKLHTSVKEQMDNFLSGFYALIPKDVISIFDEQELEL-L 3123

Query: 841  XXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQG 900
                         NN  Y  ++   K +   W  +   + EE+   ++FVT   + PL G
Sbjct: 3124 ISGLPDIDVDDWKNNTTYVNYTESCKQVSYFWRAVRSFDAEEKAKLLQFVTGTSKVPLNG 3183

Query: 901  FQALEPRFGI------RNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSG 952
            F+ L    G+      R+ G+  +RLP++ TC N L LP Y   + LR  LL AI  G
Sbjct: 3184 FKELSGVSGVCKFSIHRDYGS-TERLPSSHTCFNQLNLPAYASYDTLRGSLLIAINEG 3240

>KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyces
            cerevisiae YDR457w TOM1 E3 ubiqitin ligase required for
            G2/M transition, start by similarity
          Length = 3242

 Score =  129 bits (324), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 102/368 (27%), Positives = 168/368 (45%), Gaps = 23/368 (6%)

Query: 598  NGMGRQTAVIS--REHVLEDAFNS-YNKIGERFKS-RLSVTFVNEFGPEAGIDGGGITKE 653
            N   RQ   I+  R+ V  D++ + + K  +  K+ +L +TF  E    AG+D GG+T+E
Sbjct: 2878 NTTTRQKLSITVLRDQVFLDSYRALFFKSNDEIKNCKLDITFKGE----AGVDEGGVTRE 2933

Query: 654  FLTSVSEEGFKKSEYKLF----ETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVL 709
            +   +S + F   +Y LF      N ++    ++ + PE L +  F+G I+GK + ++  
Sbjct: 2934 WYQVLSRQMFN-PDYALFIPVGTDNTKFRPNRTSGINPEHLSFFKFVGMIIGKAISDNCF 2992

Query: 710  IDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTS 769
            +D  F+    K +L    + +             Y +L  +L      +     + +   
Sbjct: 2993 LDCHFSREVYKNILGKPVSLKDMESLDLEY----YKSLNWMLENDITYVIDETFSVDTDD 3048

Query: 770  STKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVE 829
              + K I+LIPNG +IPVT+EN  +Y+ K+  YKL  S+     +   G   +I    + 
Sbjct: 3049 YGEHKTIDLIPNGRNIPVTEENKKEYVQKIVEYKLQESVKDHMQNLLQGFYAVIDKDLIS 3108

Query: 830  MFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKF 889
            +F+  EL++               NN  Y  ++   K I   W  +   + EER   ++F
Sbjct: 3109 IFDEQELEL-LISGLPDIDVDDWKNNTTYVNYTPTCKQINYFWRAVRSFDKEERAKLLQF 3167

Query: 890  VTSVPQAPLQGFQAL-----EPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREK 944
            VT   + PL GF+ L     + +F I       +RLP++ TC N L LP Y   E LR  
Sbjct: 3168 VTGTSKLPLNGFKDLSGINGDSKFSIHRDYGSTERLPSSHTCFNQLDLPAYDSYEQLRGS 3227

Query: 945  LLYAIKSG 952
            LL AI  G
Sbjct: 3228 LLLAINEG 3235

>Kwal_47.17302
          Length = 787

 Score =  126 bits (316), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 171/361 (47%), Gaps = 25/361 (6%)

Query: 607 ISREHVLEDAFNS-YNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
           + R+++ EDA+     +  E  K RL + F  E     G+D GG+++EF   +S E F  
Sbjct: 437 VRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGE----EGLDYGGVSREFFFLLSHEMFNP 492

Query: 666 SEYKLFE--TNDQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKK 721
             Y LFE   +D Y  ++ P + + PE L Y  F+G++VG  ++    +D  F     K 
Sbjct: 493 F-YCLFEYSAHDNYTIQINPKSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKM 551

Query: 722 LLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDK--PIELI 779
           +L+     Q             Y +L  +L  + E +  L LTF     T  +   ++L 
Sbjct: 552 MLHKKVVLQDMEGVDAEV----YNSLKWILENSIEGV--LDLTFSADDETFGEVMTVDLK 605

Query: 780 PNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMX 839
           P+G +I VT EN  +Y+   + +K    +  Q  +F  G + +I    V +F+  EL++ 
Sbjct: 606 PDGRNIEVTDENKKEYVELFTQWKTCSRVQEQFKAFMDGFNELIPEDLVNVFDERELELL 665

Query: 840 XXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQ 899
                          + +Y G+   D+TI   W+ ++E + E++   ++F T   + P+ 
Sbjct: 666 IGGIAEIDVEDWK-KHTDYRGYQESDETIKWFWKAISEWDNEQKARLLQFTTGTSRIPVN 724

Query: 900 GFQALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGAR 954
           GF+ L+      RF I  AG E+ +LP + TC N + LP Y D E L++KL  A++    
Sbjct: 725 GFKDLQGSDGPRRFTIEKAG-EIQQLPKSHTCFNRVDLPPYDDYESLKQKLTLAVEETIG 783

Query: 955 F 955
           F
Sbjct: 784 F 784

>KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces
           cerevisiae YER125w RSP5 hect domain E3 ubiquitin-protein
           ligase, start by similarity
          Length = 819

 Score =  121 bits (304), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 97/361 (26%), Positives = 169/361 (46%), Gaps = 25/361 (6%)

Query: 607 ISREHVLEDAFNSY-NKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
           + R+++ ED++     +  E  K RL +    +F  E G+D GG+++EF   +S E F  
Sbjct: 469 VRRKNIFEDSYQEIMRQTPEDLKKRLMI----KFDGEEGLDYGGVSREFFFLLSHEMFNP 524

Query: 666 SEYKLFE--TNDQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKK 721
             Y LFE   +D Y  ++ P++ + PE L Y  F+G++VG  ++    +D  F     K 
Sbjct: 525 F-YCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKM 583

Query: 722 LLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDK--PIELI 779
           +L      Q             Y +L  +L  + + I  L LTF +      +   ++L 
Sbjct: 584 MLRKKVVLQDMEGVDSEV----YNSLKWILENSIDGI--LDLTFNVDDERFGELVVVDLK 637

Query: 780 PNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMX 839
           PNG  I VT EN  +Y+   + +++   +  Q  +F  G + ++    V +F+  EL++ 
Sbjct: 638 PNGREIEVTDENKKEYVELYTQWRIADRVQEQFKAFMDGFNELVPEDLVNVFDERELELL 697

Query: 840 XXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQ 899
                          + +Y G+   D+ I   W+ + E + E+R   ++F T   + P+ 
Sbjct: 698 IGGIAEIDVEDWK-KHTDYRGYQESDEVIQWFWKCITEWDNEQRARLLQFTTGTSRIPVN 756

Query: 900 GFQALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGAR 954
           GF+ L+      RF I  AG E+ +LP + TC N + LP Y D E  ++KL  A++    
Sbjct: 757 GFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPPYTDYESFKQKLTLAVEETIG 815

Query: 955 F 955
           F
Sbjct: 816 F 816

>ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH]
           (584035..586488) [2454 bp, 817 aa]
          Length = 817

 Score =  118 bits (296), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 170/359 (47%), Gaps = 31/359 (8%)

Query: 607 ISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS 666
           + R+++ EDA   Y +I  +    L    + +F  E G+D GG+++EF   +S E F   
Sbjct: 467 VRRKNIFEDA---YQEIMRQSPDDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPF 523

Query: 667 EYKLFE--TNDQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKKL 722
            Y LFE  ++D Y  ++ P++ + PE L Y  F+G++VG  ++    +D  F     K +
Sbjct: 524 -YCLFEYSSHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 582

Query: 723 LNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDK------PI 776
           L      Q             Y +L  +L        S+    ++T S  D+       +
Sbjct: 583 LRKKVVLQDMEGVDSEV----YNSLKWILE------NSIAGILDLTFSADDERFGEVVTV 632

Query: 777 ELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIEL 836
           +L PNG +I VT +N  +Y+   + +K+   +  Q  +F  G + +I    V +F+  EL
Sbjct: 633 DLKPNGRNIDVTDDNKKEYVELFTQWKICSRVEDQFKAFIDGFNELIPEDLVNVFDEREL 692

Query: 837 QMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQA 896
           ++                + +Y G+   D+ I   W+ ++E + E++   ++F T   + 
Sbjct: 693 ELLIGGIAEIDVEDWK-KHTDYRGYQESDEVIKWFWKCISEWDNEQKARLLQFTTGTSRI 751

Query: 897 PLQGFQALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIK 950
           P+ GF+ L+      RF I  AG E+ +LP + TC N + LP Y D + L++KL  A++
Sbjct: 752 PVNGFKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPAYHDYDTLKQKLTLAVE 809

>Scas_627.2
          Length = 835

 Score =  116 bits (291), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 168/359 (46%), Gaps = 21/359 (5%)

Query: 607 ISREHVLEDAFNS-YNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
           + R+++ EDA+     +  E  K RL +    +F  E G+D GG+++EF   +S E F  
Sbjct: 485 VRRKNIFEDAYQEIMRQSPEDLKKRLMI----KFDGEEGLDYGGVSREFFFLLSHEMFNP 540

Query: 666 SEYKLFE--TNDQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKK 721
             Y LFE   +D Y  ++ P++ + PE L Y  F+G++VG  ++    +D  F     K 
Sbjct: 541 F-YCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKM 599

Query: 722 LLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIPN 781
           +L      Q             Y +L  +L  + + +  L  + +     +   ++L  N
Sbjct: 600 MLRKKVILQDMEGVDADV----YNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKEN 655

Query: 782 GSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXXX 841
           G  I VT EN  +Y+   + +K+   +  Q  +F  G + +I    V +F+  EL++   
Sbjct: 656 GRDIEVTDENKKEYVELFAQWKIVDRVQEQFRAFMDGFNELIPEDLVTVFDERELELLIG 715

Query: 842 XXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQGF 901
                        + +Y G+   D+ +   W+ ++E + E+R   ++F T   + P+ GF
Sbjct: 716 GIAEIDVEDWK-KHTDYRGYQESDEVVKWFWKCISEWDNEQRARLLQFTTGTSRIPVNGF 774

Query: 902 QALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIKSGARF 955
           + L+      RF I  AG E  +LP + TC N + LP Y+D + L++KL  A++    F
Sbjct: 775 KDLQGSDGPRRFTIEKAG-EAQQLPKSHTCFNRVDLPVYEDYDNLKQKLTLAVEETIGF 832

>YER125W (RSP5) [1555] chr5 (410185..412614) Essential
           ubiquitin-protein ligase (E3 enzyme), a member of HECT
           domain family of ligases, may be involved in the
           maintenance and remodeling of actin cytoskeleton during
           endocytosis [2430 bp, 809 aa]
          Length = 809

 Score =  115 bits (289), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 168/354 (47%), Gaps = 21/354 (5%)

Query: 607 ISREHVLEDAFNS-YNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
           + R+++ EDA+     +  E  K RL +    +F  E G+D GG+++EF   +S E F  
Sbjct: 459 VRRKNIFEDAYQEIMRQTPEDLKKRLMI----KFDGEEGLDYGGVSREFFFLLSHEMFNP 514

Query: 666 SEYKLFETN--DQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKK 721
             Y LFE +  D Y  ++ P++ + PE L Y  F+G++VG  ++    +D  F     K 
Sbjct: 515 F-YCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKM 573

Query: 722 LLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIPN 781
           +L      Q             Y +L  +L  + + +  L  + +     +   ++L P+
Sbjct: 574 MLRKKVVLQDMEGVDAEV----YNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKPD 629

Query: 782 GSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXXX 841
           G +I VT  N  +Y+   + +++   +  Q  +F  G + +I    V +F+  EL++   
Sbjct: 630 GRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIG 689

Query: 842 XXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQGF 901
                        + +Y G+   D+ I   W+ ++E + E+R   ++F T   + P+ GF
Sbjct: 690 GIAEIDIEDWK-KHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGF 748

Query: 902 QALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIK 950
           + L+      RF I  AG E+ +LP + TC N + LP Y D + +++KL  A++
Sbjct: 749 KDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVE 801

>CAGL0K02255g complement(199719..202187) highly similar to sp|P39940
           Saccharomyces cerevisiae YER125w Ubiquitin--protein
           ligase, start by similarity
          Length = 822

 Score =  112 bits (280), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 166/354 (46%), Gaps = 21/354 (5%)

Query: 607 ISREHVLEDAFNSY-NKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKK 665
           + R ++ EDA+     +  E  K RL +    +F  E G+D GG+++EF   +S E F  
Sbjct: 472 VRRNNIFEDAYQEIMRQTPEDLKKRLMI----KFDGEEGLDYGGVSREFFFLLSHEMFNP 527

Query: 666 SEYKLFE--TNDQY--ELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANFFLKK 721
             Y LFE   +D Y  ++  ++ + PE L Y  F+G++VG  ++    +D  F     K 
Sbjct: 528 F-YCLFEYSAHDNYTIQINSNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKM 586

Query: 722 LLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSLGLTFEMTSSTKDKPIELIPN 781
           +L      Q             Y +L  +L  + + +  L  + +     +   ++L P+
Sbjct: 587 MLRKKVALQDMEGVDADV----YNSLKWMLENSIDGVLDLTFSADDERFGEVVTVDLKPD 642

Query: 782 GSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEMFNSIELQMXXX 841
           G +I VT E   +Y+   S +++   +  Q  +F  G + +I    V +F+  EL++   
Sbjct: 643 GRNIEVTDEVKKEYVELYSQWRIVDRVSEQFKAFMDGFNELIPEDLVTVFDERELELLIG 702

Query: 842 XXXXXXXXXXXXNNVEYGGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQGF 901
                        + +Y G+   D+ I   W+ ++E + E+R   ++F T   + P+ GF
Sbjct: 703 GIAEIDIEDWK-KHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGF 761

Query: 902 QALEP-----RFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIK 950
           + L+      RF I  AG E+++LP + TC N + LP Y D + + +KL  A++
Sbjct: 762 KDLQGSDGPRRFTIEKAG-EVEQLPKSHTCFNRVDLPPYADYDSMAKKLTLAVE 814

>KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 806

 Score =  109 bits (273), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 164/359 (45%), Gaps = 25/359 (6%)

Query: 607 ISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS 666
           + R HV +D+  S  +     K  L V F NE     GID GG+ KE+   ++ E F  +
Sbjct: 450 VRRSHVTQDSLTSIQRHPHDLKKSLRVEFSNE----PGIDAGGLKKEWFLLLTRELFHPN 505

Query: 667 EYKLFETNDQYEL----YPSTDVT--PEKLKYLWFM-GKIVGKCLYEHVLIDVSFANFFL 719
            + LF+  ++  L    Y +T +    E    L+++ G ++G  +Y   ++D+ FA    
Sbjct: 506 -HGLFQYVEESRLSWFAYGNTGLKLHGENNNELYYLFGVVLGLAIYNSTILDLHFARAMY 564

Query: 720 KKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMT----SSTKDK 774
           KKL N    F+               NL K+L+ ++ +   + GL+FE T    +S  + 
Sbjct: 565 KKLCNERITFEDYEELYPETAR----NLKKMLSYSELDFSDIFGLSFETTYYDVASGINV 620

Query: 775 PIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWV-EMFNS 833
              L   G  IPVT EN  +++ +  N+ +N  +     +F  G + +I       MF S
Sbjct: 621 TKPLCDGGESIPVTSENKTEFVERWVNFYMNEGVSSSFSAFQSGFTRVIGDGLAFPMFKS 680

Query: 834 IELQMXXXXXXXXXXXXXXXNNVE--YGGFSSDDKTIVALWEIMAECNTEERLAFIKFVT 891
            E++                  V    GGF +    +  LWEI+ + + E++  F+ FVT
Sbjct: 681 CEVERLICGSIEQDMDFEQLRAVTKYQGGFHNQTPVVEWLWEILPQLSHEQQRQFLHFVT 740

Query: 892 SVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYAIK 950
              + P+ G   L  +     +G+  D+LPTA TC N L L +Y+ ++ L  +L+ A++
Sbjct: 741 GSDRVPVTGLATLPFKVTRTTSGSH-DQLPTAHTCFNELCLYEYESRDTLLLRLVTALE 798

>AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH]
           complement(505311..507830) [2520 bp, 839 aa]
          Length = 839

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 156/368 (42%), Gaps = 41/368 (11%)

Query: 607 ISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS 666
           + RE V  D+  S     +  K  L + FVNE     GID GG+ KE+   ++ + F  +
Sbjct: 481 VRREFVTTDSLRSIQNQQKDLKKSLRIEFVNE----PGIDAGGLRKEWFLLLTRDLFNPN 536

Query: 667 E-------------YKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVS 713
                         + + E+  ++EL      + E L YL+  G ++G  +Y   ++D+ 
Sbjct: 537 NGLFVYVPESRLCWFSIMES-IEHELLQGEGSSSE-LYYLF--GVVLGLAIYNSTILDLK 592

Query: 714 FANFFLKKLLN---YSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMT- 768
           F   F KK+       N+F                N+ K+L    E+ + +  LTFE   
Sbjct: 593 FPRAFYKKICGEVLSVNDFLELYPETGT-------NMLKMLEYDGEDFEDIFALTFETCF 645

Query: 769 ----SSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMIL 824
                 +K    +L P+GS   VT+EN  +Y     ++ LN S+     SF  G   +I 
Sbjct: 646 PDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYLNRSIAPGFESFRNGFFHVIE 705

Query: 825 PTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVE--YGGFSSDDKTIVALWEIMAECNTEE 882
                +F S EL+                 +V    GGF  +   +   WEI++E    +
Sbjct: 706 GNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFDDNSPVVQWFWEILSEMEYPQ 765

Query: 883 RLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLR 942
           +   + FVT   + P  G   +  R     +G   DRLP + TC N + L +Y+DKE LR
Sbjct: 766 QRKLLHFVTGSDRVPATGVTTIPFRISRIRSGA--DRLPLSHTCFNEICLHEYKDKETLR 823

Query: 943 EKLLYAIK 950
            KL+ A++
Sbjct: 824 NKLIIALE 831

>YGL141W (HUL5) [1846] chr7 (238356..241088) Putative
           ubiquitin-protein ligase, associated with 26S proteasome
           [2733 bp, 910 aa]
          Length = 910

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 90/151 (59%), Gaps = 4/151 (2%)

Query: 1   MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60
           M+NFTGQTRRRNVNLG R   +KKDLL +A+ ERE+RA+D+ + +A+  IQ  IR H + 
Sbjct: 1   MLNFTGQTRRRNVNLGNRTRNSKKDLLEKAKRERERRAQDKLKEDASKTIQKSIRRHFSN 60

Query: 61  QQFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFA 120
            + F +    S +   +H+ PAYG +++ Y ++ +L +LLKL+  ++  Y   S  N   
Sbjct: 61  VRLFKNTFTSSQL---VHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSY-PNSLGNRQL 116

Query: 121 TKLLSRIKTCCMLSTVLDIIDKDTLSMKTFM 151
             LL   +   +++  L  ++ D  ++  F+
Sbjct: 117 LSLLKLYQDDALVAETLSDLNMDCPTVDEFL 147

>Kwal_26.7869
          Length = 1449

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 114/436 (26%), Positives = 181/436 (41%), Gaps = 55/436 (12%)

Query: 555  PFFLPFNERVDLFYT-------LIALDKQRLNLDDPD-RNMMFELAMPWMSNGMGRQTAV 606
            PF  PF  R+    +       LI L K R + +  +  + + +L  P       R    
Sbjct: 1026 PFLFPFETRMFFLQSTSFGHGRLIQLWKNRTHTNKVNGADTLHQLGRPT------RHKLR 1079

Query: 607  ISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS 666
            +SR+ +L  A     K G    + L + + NE G      G G T EF   VS+E  +KS
Sbjct: 1080 VSRDDLLLSAIKILTKYGSS-PNILEIEYQNEVGT-----GLGPTLEFYAIVSKEFARKS 1133

Query: 667  -------EYKLFETNDQYE--LYPST--DVTPEK--LKYLWFMGKIVGKCLYEHVLIDVS 713
                    Y   +     E  LYP+       EK  L+    +G  V + + +  L+D  
Sbjct: 1134 LGLWRCDNYAFHDKTGFVEGLLYPAPLRAANDEKRILELFSQLGAFVSRSMLDDRLLDFR 1193

Query: 714  FANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMN-----LTKLLAMT-----DEEIQSLGL 763
            F   F +  L++                  Y++     LTK L        D++I+SL L
Sbjct: 1194 FNRAFFE--LSHMRCRGETLSFADLEFALQYLDMVDPQLTKSLRYVLGLKNDQDIESLAL 1251

Query: 764  TFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMI 823
            TF +        +EL+ NG + PVT  N+ +YL KV +  L   + +Q  SF  G S   
Sbjct: 1252 TFYLPGYD----VELVENGKNTPVTASNLREYLEKVLDQVLGTGVEKQISSFIQGFSQAF 1307

Query: 824  LPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYG-GFSSDDKTIVALWEIMAECNTEE 882
              + + +    EL                 + ++   G++ D + I  L  +M+     E
Sbjct: 1308 PYSSLLILTPDELTKLFGRIEEDWTTGTLLSYIDADHGYNQDSEIIHNLVTVMSSFTDSE 1367

Query: 883  RLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELD-----RLPTASTCVNLLKLPDYQD 937
            R  F++F+T  P+ P+ GF++L P+  +    TE +      LP+  TC N LKLP Y  
Sbjct: 1368 RRLFLQFLTGSPKLPIGGFKSLSPKLTVVRKHTEDNLEPDQYLPSVMTCANYLKLPKYSS 1427

Query: 938  KELLREKLLYAIKSGA 953
             E+LR +L+ A+  G 
Sbjct: 1428 LEVLRSRLIQAMTEGG 1443

>YKL010C (UFD4) [3246] chr11 complement(421067..425518)
            Ubiquitin-protein ligase (E3 enzyme) functioning in
            ubiquitin fusion degradation pathway [4452 bp, 1483 aa]
          Length = 1483

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 112/449 (24%), Positives = 193/449 (42%), Gaps = 67/449 (14%)

Query: 553  RVPFFLPFNERVDLFYTLIALDKQRL-----NLDDPDRNMMFELAMPWMSNGMGRQTAVI 607
            R PF  PF+ R+ LF    +    RL     N     +++  + A+  +   + R+   I
Sbjct: 1048 RFPFLFPFDTRM-LFLQCTSFGYGRLIQLWKNKSKGSKDLRNDEALQQLGR-ITRRKLRI 1105

Query: 608  SREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS- 666
            SR+ +    F +  KI  ++ S   V  + E+  EAG  G G T EF + VS+   +KS 
Sbjct: 1106 SRKTI----FATGLKILSKYGSSPDVLEI-EYQEEAGT-GLGPTLEFYSVVSKYFARKSL 1159

Query: 667  --------EYKLFETNDQYELYPSTDVTPEKL----------KYLWFMGKIVGKCLYEHV 708
                     Y+     D  + Y +T + PE L          +   ++G  V + L ++ 
Sbjct: 1160 NMWRCNSYSYRSEMDVDTTDDYITTLLFPEPLNPFSNNEKVIELFGYLGTFVARSLLDNR 1219

Query: 709  LIDVSFANFFLKKLLNYS--------NNFQXXXXXXXXXXXXXYMNLTKLLAMTDEE--I 758
            ++D  F+  F + L   S        ++ +               +L  ++A  D+   +
Sbjct: 1220 ILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMTL 1279

Query: 759  QSLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGG 818
            +SL LTF +     +  IELIP G +  +   NV +Y+  V +  L   + +Q  +F  G
Sbjct: 1280 ESLSLTFTVPG---NDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEG 1336

Query: 819  LST--------MILP-TWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIV 869
             S         ++ P   V++F  +E                   N E+G ++ D   I 
Sbjct: 1337 FSKVFSYERMLILFPDELVDIFGRVEEDWSMATLYTNL-------NAEHG-YTMDSSIIH 1388

Query: 870  ALWEIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGI-----RNAGTELDRLPTAS 924
                I++     ER  F++F+T  P+ P+ GF++L P+F +      +  T  + LP+  
Sbjct: 1389 DFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVM 1448

Query: 925  TCVNLLKLPDYQDKELLREKLLYAIKSGA 953
            TC N LKLP Y  K+++R +L  AI+ GA
Sbjct: 1449 TCANYLKLPKYTSKDIMRSRLCQAIEEGA 1477

>Scas_668.21
          Length = 1428

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 95/393 (24%), Positives = 166/393 (42%), Gaps = 51/393 (12%)

Query: 600  MGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVS 659
            M R    +SR+++         K G    S L + +++E G      G G T EF  S+S
Sbjct: 1042 MVRHKLRVSRKNMFLTGLKIIGKYGSS-PSVLEIEYIDEVGS-----GLGPTLEFYASIS 1095

Query: 660  EEGFKKSEYKLFETNDQYELYPSTD--VTPEKLKYLWF-------------------MGK 698
            +E F K+   L+ + D  +   +TD   + + +K L F                   +G 
Sbjct: 1096 KE-FAKNSLHLWRSEDFDKKANATDGESSSDYVKDLLFPAPLDSKCDNAKTLELFESLGT 1154

Query: 699  IVGKCLYEHVLIDVSFANFFLK---------KLLNYSNNFQXXXXXXXXXXXXXYMNLTK 749
             + + + +  ++D  F   F +          LL+   + +               +L  
Sbjct: 1155 FIARSMLDSRILDFRFNKLFFELLHKRFTKVALLDNLGDLKGMLQMLSRVDEQLAKSLEY 1214

Query: 750  LLAMTDEEI--QSLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVS 807
            L    D+ +  ++L LTF +        IELIP+G++  V   NV  ++ KV    L   
Sbjct: 1215 LYDHKDDSVSLEALSLTFVLPGYN----IELIPDGTNTFVNATNVEDFIQKVLESTLGRG 1270

Query: 808  MFRQCVSFHGGLSTMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXN--NVEYGGFSSDD 865
            + +Q  +F  G S +     + +    EL                 N  N ++G ++ D 
Sbjct: 1271 IEKQLDAFIDGFSKVFPYVALLILRPEELTELFGRIDEDWSTETLYNCMNADHG-YTMDS 1329

Query: 866  KTIVALWEIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGI-----RNAGTELDRL 920
            +TI  L  I+ +   +ER  F +F+T  P+ P+ GF+ L+P+F +      +  T    L
Sbjct: 1330 QTIHDLISIVTQFTVQERRLFCQFLTGSPKLPIDGFKGLKPKFTVVLKHAEDGLTPDQYL 1389

Query: 921  PTASTCVNLLKLPDYQDKELLREKLLYAIKSGA 953
            P+  TC N LKLP Y  ++++R ++L AI+ GA
Sbjct: 1390 PSVMTCANYLKLPKYSSRDVMRARILQAIEEGA 1422

>KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces
            cerevisiae YKL010c SOS1, start by similarity
          Length = 1467

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 112/446 (25%), Positives = 197/446 (44%), Gaps = 57/446 (12%)

Query: 548  LSILLRVPFFLPFNERVDL-------FYTLIALDKQRL---NLDDPDRNMMFELAMPWMS 597
            L I  +  F  PF  R++        +  LI   +++L   +  +P  N + +L      
Sbjct: 1033 LDITRKYGFLFPFETRMNFLQNTSYGYGRLIQYWREKLADQHHSNPTENPLHQLGR---- 1088

Query: 598  NGMGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTS 657
              + R    +SR+ +    F S  KI +++ S  +V  + E+  E G  G G T EF + 
Sbjct: 1089 --LTRHKLRVSRDSL----FLSGIKILKKYGSSPNVLEI-EYKDEEGT-GLGPTLEFYSL 1140

Query: 658  VSEEGFKKSEYKLFETN-----DQYE-----LYP-----STDVTPEK-LKYLWFMGKIVG 701
            +S+E F +   K+++TN     D+ E     L+P     +T+   EK LK    +G +V 
Sbjct: 1141 MSKE-FARKSLKMWKTNSDTSDDEEEYVTGALFPGPLLGTTEENNEKTLKLFENLGTLVA 1199

Query: 702  KCLYEHVLIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXY---MNLTKLLAMT---- 754
            + + ++ ++D  F   F + +     N +                 + L K LA      
Sbjct: 1200 RSMLDNRILDFRFNAVFFELMHKCCKNDRLDLEDFETCIHLVGQFDVQLGKSLAFLYDNR 1259

Query: 755  -DEEIQSLGLTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCV 813
             D+ I++L L F +        IEL+  GS I V   NV +YL +V +  L   +  Q  
Sbjct: 1260 HDDSIKNLDLYFMLPGYD----IELLEGGSKILVESFNVEEYLIRVFDQFLGKGVDMQLA 1315

Query: 814  SFHGGLSTMILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYG-GFSSDDKTIVALW 872
            +F  G S     + + +    EL                 +++    G+S D   I  L 
Sbjct: 1316 AFRNGFSKSFPYSSLLILTPTELSDLFGAVAEDWSVQTLYSSIHADHGYSMDSPIITDLI 1375

Query: 873  EIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGI----RNAGTELDR-LPTASTCV 927
            +I++  +T+++  F++F+T  P+ PL GF+ L+P+F +     +     D  LP+  TC 
Sbjct: 1376 DILSNFSTQQKRLFLQFITGSPKLPLGGFKNLKPKFTVVLKHPDGNISADHCLPSVMTCA 1435

Query: 928  NLLKLPDYQDKELLREKLLYAIKSGA 953
            N LKLP Y DK +L++++  A+  G+
Sbjct: 1436 NYLKLPKYSDKLVLKDRIAQAMTEGS 1461

>Kwal_34.16064
          Length = 849

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 90/361 (24%), Positives = 155/361 (42%), Gaps = 33/361 (9%)

Query: 607 ISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS 666
           + R+ + +D+           K  L + FV+E     GID GG+ KE+   ++ E F   
Sbjct: 495 VRRDSITQDSLRCIETNLSDLKKSLKIEFVDE----PGIDAGGLRKEWFLLLTRELFN-P 549

Query: 667 EYKLFETNDQYEL------YPSTDVTPEKLKYLWFM-GKIVGKCLYEHVLIDVSFANFFL 719
           +  LF   ++         Y   D   E    L+F+ G ++G  +Y   ++D+SF     
Sbjct: 550 DNGLFTVIEESRFSWFNIAYTDLDAGKENAHKLYFLLGVVLGLAIYNGTILDLSFPMALY 609

Query: 720 KKL----LNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMTSS---- 770
           KK+    L  ++  Q               NL KLL   +++ + +  LTFE+T      
Sbjct: 610 KKMKGEPLKRADFLQLYPISGN--------NLLKLLEYDNDDFEEIFSLTFEITYPGAWD 661

Query: 771 TKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPTWVEM 830
           T     EL   GS   VT+EN  +Y+    ++ +  ++    V+F  G   ++     E+
Sbjct: 662 TWLHKKELCSGGSTRHVTRENREEYINLWMDFHMTQAIGESFVNFSNGFQRVVDNHAFEL 721

Query: 831 FNSIELQMXXXXXXXXXXXXXXXNNV-EYG-GFSSDDKTIVALWEIMAECNTEERLAFIK 888
           F   E+++                +V +Y  G + + + +  LWEI+   +  ER   ++
Sbjct: 722 FTPEEVELLLCGSHEKEIDVSVLKSVTKYSIGLNRESRIVQWLWEIIYMFSHAERCKLLE 781

Query: 889 FVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLREKLLYA 948
           FVT   + P  G   +   F I   G + + LP A TC N L + +Y+  E LR KL+ A
Sbjct: 782 FVTGSDRIPATGISTVP--FKITRLGPDSENLPLAHTCFNELCIYEYKSMEKLRVKLILA 839

Query: 949 I 949
           +
Sbjct: 840 M 840

>ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH]
            complement(412721..416995) [4275 bp, 1424 aa]
          Length = 1424

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 163/377 (43%), Gaps = 36/377 (9%)

Query: 602  RQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEE 661
            R    ISRE++    F S  KI  ++ S  SV  + E+  E GI G G T EF  SVS+E
Sbjct: 1053 RHKLRISRENM----FLSALKILSKYGSSPSVLEI-EYQDEVGI-GMGPTLEFYASVSKE 1106

Query: 662  GFKKSEYKLFETNDQYE------LYPSTDVTPEK-----LKYLWFMGKIVGKCLYEHVLI 710
              +KS      ++   +      L+P+  ++P++      +    +G  V + + ++ ++
Sbjct: 1107 FARKSLGMWHGSSVPGDDFLDGLLFPAP-LSPKRNGAKIYELFTHLGTFVARSMLDNRIL 1165

Query: 711  DVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYM---NLTKLLAMTDE-----EIQSLG 762
            D  F   F   +   +   +              +    L K LA   E     +++S+ 
Sbjct: 1166 DFRFNRVFFDLMHTAARREELDFAHPAKLLESLRLIDPQLAKSLAFVREPRNWPDLESMA 1225

Query: 763  LTFEMTSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTM 822
            L+F +     D    L+  G++ PVT  N   Y+ +V +  L   + +Q  +F  G S  
Sbjct: 1226 LSFTVPGYDFD----LVEGGANTPVTAANAELYVARVLDAFLGSGVRQQLRAFMKGFSRA 1281

Query: 823  ILPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYG-GFSSDDKTIVALWEIMAECNTE 881
               + + +    EL                 + +    G+S D  T+  L  +MA  +  
Sbjct: 1282 FPYSSLLVLTPDELSELYGRVEEDWSVETLYSYITADHGYSMDSPTLHDLIAVMAAFDQH 1341

Query: 882  ERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELD-----RLPTASTCVNLLKLPDYQ 936
             R  F++F+T  P+ P+ GF+ L+P   +     E D      LP+  TC N LKLP Y 
Sbjct: 1342 HRRLFLQFLTGSPKLPVGGFKNLKPHLTVVLKHPEGDLSPDQYLPSVMTCANYLKLPKYS 1401

Query: 937  DKELLREKLLYAIKSGA 953
             +E+LR ++++AI  G+
Sbjct: 1402 SREVLRARIVHAIHEGS 1418

>YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative
           ubiquitin-protein ligase [2679 bp, 892 aa]
          Length = 892

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 157/357 (43%), Gaps = 47/357 (13%)

Query: 624 GERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGF----------KKSEYKLFET 673
           G+  KS L + FVNE     GID GG+ KE+   +++  F          K+S    F  
Sbjct: 543 GDLLKS-LRIEFVNE----PGIDAGGLRKEWFFLLTKSLFNPMNGLFIYIKESSRSWFAI 597

Query: 674 NDQYELYPSTDVTPEK---LKYLWFMGKIVGKCLYEHVLIDVSFANFFLKKLLNYSNNFQ 730
           +      P+ D +  K   L+  +  G ++G  ++   ++D+ F     KKL +   +F+
Sbjct: 598 DP-----PNFDKSKGKNSQLELYYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFE 652

Query: 731 XXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMT------------SSTKDKPIE 777
                          NL K+L  T++  + +  LTFE T            SS +   +E
Sbjct: 653 DYSELFPETSR----NLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVE 708

Query: 778 LIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILPT-WVEMFNSIEL 836
           L  NG ++P+T+ N  +++ K   + L  S+  Q   F  G   +      +++FNS EL
Sbjct: 709 LCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEEL 768

Query: 837 Q--MXXXXXXXXXXXXXXXNNVEY-GGFSSDDKTIVALWEIMAECNTEERLAFIKFVTSV 893
           +  +               +  +Y GGFS D + +   WEI+   +   +   ++FVT+ 
Sbjct: 769 ERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTAS 828

Query: 894 PQAPLQGFQALEPRFGIRNAGT-ELDRLPTASTCVNLLKLPDYQDKELLREKLLYAI 949
            + P  G   +   F I   G+ + D LP A TC N + L +Y  K+ L  KLL+AI
Sbjct: 829 DRIPATGISTIP--FKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAI 883

>CAGL0M10175g complement(1014414..1018844) similar to sp|P33202
            Saccharomyces cerevisiae YKL010c Ubiquitin fusion
            degradation protein 4, hypothetical start
          Length = 1476

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 99/395 (25%), Positives = 171/395 (43%), Gaps = 59/395 (14%)

Query: 614  EDAFNSYNKIGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFKKS--EYKLF 671
            +D F++  K+ +RF    +V  V E+  E G  G G T EF   +S+E  +KS   +   
Sbjct: 1091 KDMFSTGVKVLKRFGGDSTVMEV-EYIDEVGT-GLGPTLEFYAIISKEFARKSLNMWHCL 1148

Query: 672  ETNDQY------------------ELYPSTDVTPEK-----LKYLWFMGKIVGKCLYEHV 708
            + N ++                   L+P+  +  EK     L     +G  V + LY++ 
Sbjct: 1149 DDNMKHVADGTPNDNTMSEVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSLYDNR 1208

Query: 709  LIDVSFANFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEE----------- 757
            ++D  F   F   +L ++                 Y  L+ +LA  D +           
Sbjct: 1209 ILDFRFNPVFF--MLCHAITKNEGLSTLTLDSDQVYQQLS-ILANIDSQLAASLRYIYNN 1265

Query: 758  ------IQSLGLTFEMTSSTKDKPIELIPNGS-HIPVTKENVLQYLTKVSNYKLNVSMFR 810
                  I+SL LTF +         EL+ +G+ H      +V +Y++ V +  L   +  
Sbjct: 1266 RTNTPLIKSLSLTFTLPGYN----FELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAP 1321

Query: 811  QCVSFHGGLSTMILPTWVEMFNSIEL-QMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIV 869
            Q  SF  G S +     + +F+  E+  +                 V   G++ D  TI 
Sbjct: 1322 QLNSFIDGFSRLFPYKNMLLFSPNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIR 1381

Query: 870  ALWEIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGI--RNAGTEL---DRLPTAS 924
             L  I++  + +E+  F++F+T  P+ PL GF++L+P+  +  ++A   L   D LP+  
Sbjct: 1382 DLISIISTFDNQEKRMFLQFLTGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVM 1441

Query: 925  TCVNLLKLPDYQDKELLREKLLYAIKSGA-RFDLS 958
            TC N LKLP Y  +E++R+++L A+  GA  F LS
Sbjct: 1442 TCANYLKLPKYSSREVMRQQILTAMTEGADSFQLS 1476

>Scas_549.3
          Length = 842

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 94/376 (25%), Positives = 158/376 (42%), Gaps = 39/376 (10%)

Query: 607 ISREHVLEDAFNSYNK-IGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGFK- 664
           + RE +  D+     +  G+  KS L V F+NE     GID GG+ KE+   +++  F  
Sbjct: 476 VRRERITNDSLKCIRQHQGDLLKS-LRVEFINE----PGIDAGGLKKEWFLLLTKSLFNP 530

Query: 665 -KSEYKLFETN--DQYELYP----STDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFANF 717
               +K  E +    + + P     +D+  +K  Y  F G ++   L+   ++D+ F   
Sbjct: 531 MNGLFKYLEDSRLSWFAIQPICEEESDIESQKELYYLF-GVVLALALFNSTILDLKFPKA 589

Query: 718 FLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMT-------- 768
             KKL     NF+               NL K+L+   ++ + L  L+F  T        
Sbjct: 590 LYKKLCKEPLNFEDYRELYPETAK----NLEKMLSYPGKDFEDLFCLSFTTTYQDATLGI 645

Query: 769 ----SSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMIL 824
               S T    +EL   G  I VT+EN  +++    ++ L  S+      F  G + +  
Sbjct: 646 FGSQSQTDKVTVELCKGGKGINVTQENKQRFVDLWVDFYLTKSISNSFDHFQTGFNRVCG 705

Query: 825 PTW-VEMFNSIELQ--MXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVA-LWEIMAECNT 880
             + + +F+S EL+  +               +  +YGG  +D   IV   W+I+   + 
Sbjct: 706 KCYSISLFDSDELEKLVCGDEGKENYDFKILRSITKYGGGFNDQSKIVEWFWKIVESWSN 765

Query: 881 EERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGT-ELDRLPTASTCVNLLKLPDYQDKE 939
           + +   + FVT   + P  G   L   F +   GT + + LP + TC N L L +Y  +E
Sbjct: 766 QLQRKLLLFVTGSDRIPATGISTLP--FKVTRLGTKDKEDLPLSHTCFNELCLWEYTTEE 823

Query: 940 LLREKLLYAIKSGARF 955
            L+ KLL AI     F
Sbjct: 824 KLKNKLLCAITESEGF 839

>Sklu_2101.2 YGL141W, Contig c2101 1350-2581
          Length = 411

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 129/451 (28%), Positives = 197/451 (43%), Gaps = 80/451 (17%)

Query: 2   MNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTCQ 61
           MNFTGQT+RRN+NLG++   +K++LLL A+ ERE+RA +R   ++AT+IQS IR HL  +
Sbjct: 1   MNFTGQTKRRNINLGSKSRKSKEELLLNAKKERERRAIERRNEDSATRIQSSIRSHLVTR 60

Query: 62  QFFAHDIWISDMEHSIHIFPAYGPRILNYDNEENLSKLLKLTKLYMIDYCSGSFRNYFAT 121
           +     I     + +  I  AY PR+  Y  +++L+  L             S RN    
Sbjct: 61  KLLLDLISHPTADSATAILIAYTPRMY-YMYDQHLTATL-----------IHSIRN---D 105

Query: 122 KLLSRIKTCCMLSTV--LDIIDKDT-LSMKTFMQNGLIPFLNHFEHVNETEATVSLIF-- 176
           + +  IK   +L  V   DI ++ T L +  F  N   P  NHF      EA V L+   
Sbjct: 106 RPIVNIKLAQLLQVVGYFDISEELTELVLSKF--NTKYPLTNHF-----YEAVVGLLLNS 158

Query: 177 -EYLCSWYKD---------DFEAKSIVQLEIFQLNIHRCKSREFIEFLLLNSFLTFESSV 226
            + L  W  D         D E+   V   +F   I   K+R     L    FL+   SV
Sbjct: 159 TKNLSKWVMDRVMQLLKVLDEESNHYVT-SLFA--IDTSKTRHLDNNL---RFLSQLGSV 212

Query: 227 FSHLLREPMR-----VLENYFIIYGQLMNKDTLNLRPYLSNANAMHLLERLVKDIYYIFP 281
           F   L   ++     +LEN   IY Q  ++     R          +LE L++       
Sbjct: 213 FYPELTANIKSNKSILLENLAFIYAQSKDEG----REVFGRC----ILEYLIE------- 257

Query: 282 LVSKDSMTCLPTKDAYHIKNLFESKFIDTFLEKRPSYEHEVHFMGWYKFLQLADMCNKKT 341
                  +  P K    + N F   +   FL+   +Y  +        F++ +     K 
Sbjct: 258 -------SSGPYKATSSLSNYFHGLYSKDFLDFLVNYSSQNQAGYISAFIKSSPDDVSKN 310

Query: 342 SVLLNFLS--------NKSLMF--ELFTSIDQSDSKMAFQLLIELMDLWLLVSTDFDLLS 391
           +VL+  +S        NK+LM   E F  +DQ  ++    LL+ L+   L VS+D++LL 
Sbjct: 311 NVLIWLISKAGLMKNINKNLMRTNEKFQDLDQKTTEEDLFLLLHLLKNDLSVSSDYELLH 370

Query: 392 DSSKISMNQLISFTKSLKDLVFHNLWDLSKD 422
           +     +  L  FT  LK +VF  LW  S++
Sbjct: 371 NIDTYPIENLQEFTSRLKGMVFDCLWRASEE 401

>CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 858

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 151/383 (39%), Gaps = 54/383 (14%)

Query: 607 ISREHVLEDAFNSYNK-IGERFKSRLSVTFVNEFGPEAGIDGGGITKEFLTSVSEEGF-- 663
           + R ++  D+  S  +  G+ FKS L V FV E     GID GG+ KE+   +++  F  
Sbjct: 493 VRRSNISSDSLQSIKEHQGDLFKS-LKVEFVGE----PGIDAGGLRKEWFMLLTKTLFDP 547

Query: 664 --------KKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYEHVLIDVSFA 715
                    +S    F  + Q E   ++    E ++  +  G ++   ++   ++++ F 
Sbjct: 548 RTSLFVYVPESRLIWFSNSAQNE---ASIPDKETMELYYLFGVVMALAIFNSTILNLHFP 604

Query: 716 NFFLKKLLNYSNNFQXXXXXXXXXXXXXYMNLTKLLAMTDEEIQSL-GLTFEMT------ 768
               KK+      F                NL KLL    ++   +  L FE T      
Sbjct: 605 KALYKKICGEPLKFDDYAEIYPETA----QNLQKLLEYDGDDFSEVFALNFETTFINDMW 660

Query: 769 -----SSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMI 823
                +  K   +EL  NG ++ VT  N  +Y+    ++ LN ++      F  G   + 
Sbjct: 661 EINPKNIKKYNTVELCANGKNMSVTSSNKEEYVKLWIDFYLNKNISTTFEKFLLGFKRVF 720

Query: 824 -LPTWVEMFNSIELQMXXXXXXXXXXXXXXXNNVEYGGFSSDDKTIVAL----------W 872
            +   +++FN  ELQ                N  ++G   S  K I  +          W
Sbjct: 721 SVSKSIKLFNFEELQ-------RLVCGDQDTNKYDFGMLKSVTKYIGGMNENMPVAKWFW 773

Query: 873 EIMAECNTEERLAFIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKL 932
           EI  E +  ++   ++FVT     P  G   L  +  +  + ++ D+LP A TC N L L
Sbjct: 774 EIAQEWDITKQKKLMRFVTGSDGVPATGMSTLPFKLSLLGS-SDSDKLPIAHTCFNELCL 832

Query: 933 PDYQDKELLREKLLYAIKSGARF 955
             Y+ KE L  KL +A+     F
Sbjct: 833 WQYRSKEKLESKLKWAVTESEGF 855

>KLLA0F21208g 1975203..1980527 similar to sp|P42945 Saccharomyces
            cerevisiae YJL109c singleton, start by similarity
          Length = 1774

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 578  LNLDDPDRNMMFELAMPWMSNGMGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVN 637
            L L+D     +F L + W  NG G     +S+E  L   +  YNK  E  KS ++  F  
Sbjct: 1542 LKLNDKVFRPLFALVVNWAFNGEGVTNTNMSKEERLMAFYKFYNKTQENLKSIITSYFTY 1601

Query: 638  EFGPEAGIDGGGITKE 653
               P   +    I+KE
Sbjct: 1602 LLEPTNNLLKQFISKE 1617

>KLLA0A01782g complement(157216..158802) some similarities with
           sp|Q04233 Saccharomyces cerevisiae YML006c GIS4
           hypothetical protein singleton, hypothetical start
          Length = 528

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 6/81 (7%)

Query: 356 ELFTSIDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTKSLKDLVFHN 415
           ++FT I QS++  +     ++ D WLL  TDF+ L +   +S+  ++ F+K L  ++F++
Sbjct: 305 QIFTGIRQSENDRSNA---DINDDWLLYDTDFN-LGNLQMLSLYDILDFSKFLPKILFYS 360

Query: 416 LWDLSKDDRSENFETAL-HLL 435
           +  + KD   +N E +L HL+
Sbjct: 361 MIHV-KDSVDDNTELSLQHLI 380

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,023,618
Number of extensions: 1305279
Number of successful extensions: 3667
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3668
Number of HSP's successfully gapped: 49
Length of query: 958
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 847
Effective length of database: 12,753,511
Effective search space: 10802223817
Effective search space used: 10802223817
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)