Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_669.1159659629430.0
YGL142C (GPI10)61659816720.0
KLLA0E14762g60159716280.0
CAGL0F07843g61259915760.0
ADL281C59559715390.0
Kwal_23.347861859215150.0
KLLA0C08591g5411221175e-06
AAR043C5371051005e-04
Scas_714.36514136900.008
KLLA0D19404g553144890.012
CAGL0K09548g496137870.021
Kwal_47.18842508159860.025
YOR149C (SMP3)516102830.057
ABL185C552131790.18
CAGL0M10769g562141780.26
Kwal_23.6317545149770.29
YNR030W (ECM39)551137770.33
Sklu_1475.2508240760.37
CAGL0K05005g558142740.62
Kwal_23.4476552132740.74
Scas_490.1457117721.1
Scas_606.657152721.2
YNL219C (ALG9)55585721.2
Sklu_1894.3551157711.5
Kwal_14.193333497701.7
KLLA0C02321g184258712.1
KLLA0F24222g82636675.2
KLLA0C06567g53078658.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_669.11
         (596 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_669.11                                                          1138   0.0  
YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...   648   0.0  
KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...   631   0.0  
CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...   611   0.0  
ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...   597   0.0  
Kwal_23.3478                                                          588   0.0  
KLLA0C08591g complement(752256..753881) similar to sp|P53730 Sac...    50   5e-06
AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH] (418301..41...    43   5e-04
Scas_714.36                                                            39   0.008
KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces...    39   0.012
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    38   0.021
Kwal_47.18842                                                          38   0.025
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    37   0.057
ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..6165...    35   0.18 
CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces...    35   0.26 
Kwal_23.6317                                                           34   0.29 
YNR030W (ECM39) [4612] chr14 (678798..680453) Protein involved i...    34   0.33 
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          34   0.37 
CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces c...    33   0.62 
Kwal_23.4476                                                           33   0.74 
Scas_490.1                                                             32   1.1  
Scas_606.6                                                             32   1.2  
YNL219C (ALG9) [4385] chr14 complement(235995..237662) Mannosylt...    32   1.2  
Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement         32   1.5  
Kwal_14.1933                                                           32   1.7  
KLLA0C02321g complement(196533..202061) similar to sp|P41832 Sac...    32   2.1  
KLLA0F24222g complement(2259017..2261497) similar to sp|P53540 S...    30   5.2  
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    30   8.6  

>Scas_669.11
          Length = 596

 Score = 1138 bits (2943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/596 (93%), Positives = 559/596 (93%)

Query: 1   MRKLDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRS 60
           MRKLDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRS
Sbjct: 1   MRKLDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRS 60

Query: 61  YAFPFIFELTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDM 120
           YAFPFIFELTYRLVRLVVFMSRW                FPSNEF           PSDM
Sbjct: 61  YAFPFIFELTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDM 120

Query: 121 ANSLEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGIT 180
           ANSLEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGIT
Sbjct: 121 ANSLEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGIT 180

Query: 181 KIATVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFT 240
           KIATVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFT
Sbjct: 181 KIATVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFT 240

Query: 241 CLQRPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGE 300
           CLQRPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGE
Sbjct: 241 CLQRPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGE 300

Query: 301 ITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTS 360
           ITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTS
Sbjct: 301 ITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTS 360

Query: 361 FATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMTWI 420
           FATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMTWI
Sbjct: 361 FATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMTWI 420

Query: 421 LPLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDL 480
           LPLA          FQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDL
Sbjct: 421 LPLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDL 480

Query: 481 WAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTH 540
           WAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTH
Sbjct: 481 WAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTH 540

Query: 541 EWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRPSL 596
           EWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRPSL
Sbjct: 541 EWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRPSL 596

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/598 (53%), Positives = 408/598 (68%), Gaps = 9/598 (1%)

Query: 3   KLDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYA 62
           KL    +F   L FR+ NA+LTRTFFQADEFWQALEPAH  AF YGELTW+WKF +RSY 
Sbjct: 11  KLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYL 70

Query: 63  FPFIFELTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDMAN 122
           FP IFELTYRLV L   +  +                 P  E            P D+  
Sbjct: 71  FPMIFELTYRLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAEDLKRLPFDVTR 130

Query: 123 SLEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKI 182
           S EY GVIY PK+VM ++A+ GEYY ++ +QKLYL+T     E ++E  + G L  ITK 
Sbjct: 131 SFEYYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERRSG-LSEITKF 189

Query: 183 ATVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCL 242
           A +LSLTNFFNC+ ITR+FINSFEM  T++ALY+WDWTGG  I+ S FTKSL+ A   CL
Sbjct: 190 ALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACL 249

Query: 243 QRPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEIT 302
           QRP++  IW++    LI N++ +   +   FI   K++  F  VF  N  ID YFY ++T
Sbjct: 250 QRPSSGLIWVIPSISLILNLVGK-KQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVT 308

Query: 303 IPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFA 362
            P   F+KFN T+PL+ FYG +PWHFH FQS+PI+LG ++  F  G+F  LS + F    
Sbjct: 309 FPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKY 368

Query: 363 TNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMT---- 418
            NPFFQ+K+ ILLN+LV+S   HKEFRFI+PLQP F+ +S F L +L    + R++    
Sbjct: 369 LNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKS 428

Query: 419 --WILPLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQD 476
             W++P            F ESGSIEVMKFLH EP ++ S+GFIMPCHSTP QSYLHR D
Sbjct: 429 LLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEP-EIDSLGFIMPCHSTPGQSYLHRSD 487

Query: 477 IPDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGK 536
           I DLW+ITC PPLHLLGD +A SKL++YMDESDHLY + + F+Y+NFPP F+K+LRSPGK
Sbjct: 488 IQDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGK 547

Query: 537 VYTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRP 594
            Y+HEWP YL++FE +++  ++++LKDSSY+EY RFFNS +HWDSRR+GDI++YYK P
Sbjct: 548 TYSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYKLP 605

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/597 (51%), Positives = 405/597 (67%), Gaps = 16/597 (2%)

Query: 9   LFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFIFE 68
           LF+ ILV R   ALLTRTFFQADEFWQ+LEPAH MAFGYGELTW+W F +RSYAFP IF+
Sbjct: 10  LFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQ 69

Query: 69  LTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDMANSLEYIG 128
           + Y LV+                         P++EF           P ++   +EY G
Sbjct: 70  IGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQG 129

Query: 129 VIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLSL 188
           VIY PK++M ++AA GE++ I L +KLY +T   S ++     K  ++   T +ATV   
Sbjct: 130 VIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKHSTVINFTLVATV--- 186

Query: 189 TNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPTNA 248
           +NFFNC+ ITRSFINSFEM  T+V+LY+WDWT G  IES +F KSL+I  FT LQRPTNA
Sbjct: 187 SNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNA 246

Query: 249 FIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINF 308
           FIW++LG  +I N++      K + +L++ I   F+++   N+ ID+YFYG ITIP++ F
Sbjct: 247 FIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISI-STNLCIDYYFYGYITIPVLKF 305

Query: 309 IKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQ 368
           IKFN TS L+ FYG +PW+FH+FQS+PI+ GY+L   +   FC L+ K+F S   NPF Q
Sbjct: 306 IKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQ 365

Query: 369 IKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVF-ALHKLKWYQ----------YSRM 417
           IK ++LLNV+++SL  HKEFRFIYPLQPFF+ +SVF  +  L+ Y           +S++
Sbjct: 366 IKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQV 425

Query: 418 TWILPLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDI 477
            WILP+             ESG++ VM +LH+   ++ S+GFIMPCHSTPWQS+ HR D+
Sbjct: 426 MWILPVVSMVASMLLSTLHESGTVAVMDYLHSIR-NIDSIGFIMPCHSTPWQSHFHRNDV 484

Query: 478 PDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKV 537
            +LWAITC PPLHLL D DA +KL  YMDESD+LY N ++F+Y++FPPVF+K LRSPGK 
Sbjct: 485 KELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQ 544

Query: 538 YTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRP 594
           YT+EWPEYL+IFE LD   M +YL DS Y+E TRFFNS  HWD RR+GDI++Y+K P
Sbjct: 545 YTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSGDIIIYHKMP 601

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/599 (51%), Positives = 400/599 (66%), Gaps = 22/599 (3%)

Query: 7   GSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFI 66
            ++F  ++ FR+ N+LLTRT+FQADEFWQ+LEPAH  AFGYGELTW+WK  +RSYAFP +
Sbjct: 23  SAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPML 82

Query: 67  FELTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDMANSLEY 126
           FE+ YRLV+L+   S+                 FP ++            P++ + ++EY
Sbjct: 83  FEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEY 142

Query: 127 IGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVL 186
            GVIY PK+ M L+AATGEY+TIKLIQK+YL   K+  +NDD+  K   L  ITKIA +L
Sbjct: 143 YGVIYAPKLFMALLAATGEYFTIKLIQKVYL---KTVSKNDDQLPK---LSNITKIALLL 196

Query: 187 SLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPT 246
           +LTNFFNC+ ITR+FINSFEM  T++ALY WDW+GG+ I +  FTKSL  AMF C+QRP+
Sbjct: 197 TLTNFFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPS 256

Query: 247 NAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLI 306
           NA IWIVLG  L  N++ R  D+     L  KI++ F    L+NV IDFYFY +I  P+ 
Sbjct: 257 NAIIWIVLGFFLTINLLLR-RDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVF 315

Query: 307 NFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPF 366
            FI FN TS L+ FYG +PWHFHL QS+PI+LGY+L  F+ G+F + S  K  +      
Sbjct: 316 KFINFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTK-NNIRFGAL 374

Query: 367 FQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKL----KWYQY-SRMTWIL 421
            QIK +++LN++ +S   HKEFRFIYPLQP F  +S     KL    + Y+Y     WI+
Sbjct: 375 RQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCLLSALGALKLAGKVQNYRYLKEYVWII 434

Query: 422 PLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDLW 481
           PL           FQESG I+VMK LHNE  D+ SVGF+MPCHSTPWQSYLHR DI  LW
Sbjct: 435 PLMSMIVSIFITTFQESGVIQVMKDLHNEK-DIDSVGFVMPCHSTPWQSYLHRNDIRQLW 493

Query: 482 AITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKEL-------RSP 534
           AI+CEPPLHLLG  +A+ +LQ+YMDESD+LY N + F+ +NFP  F   +        + 
Sbjct: 494 AISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDMENVNNNAS 552

Query: 535 GKVYTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKR 593
              + HEWP++LIIFEQLD+  M  YL DS YV+Y + FNS+SHWDSRR GD+++YYK 
Sbjct: 553 MPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNGDLIIYYKN 611

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/597 (46%), Positives = 392/597 (65%), Gaps = 18/597 (3%)

Query: 8   SLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFIF 67
           S+ R + ++R+ NAL  R+FFQADE+WQ+LEPAH+ AFGYG LTW+W+  +RSYAFP +F
Sbjct: 5   SILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPMLF 64

Query: 68  ELTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDMANSLEYI 127
           E++Y +  ++   +R                  PS              P      +EY 
Sbjct: 65  EMSYYVAWILGVATR-MALQGLAHATALCGAVVPSGAAGVAAMKAVWELPEAAQELVEYY 123

Query: 128 GVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLS 187
           GV+YGP+VVM  +AA GE+Y++ L++KLYL   + + + DD+ G       ++++A +L+
Sbjct: 124 GVLYGPRVVMAAVAACGEFYSVLLVRKLYL---RVADKGDDQKGDAAP---VSRLALMLT 177

Query: 188 LTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPTN 247
           +TNFFNC+  TR+FINSFEMT TAVALY WDW+GGL + S  F+ SL +A F CLQRPTN
Sbjct: 178 MTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTN 237

Query: 248 AFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLIN 307
             IW VLG  L+ N++ R   ++    L+ K+          N++ID+YFYG + +PL+ 
Sbjct: 238 VLIWAVLGLFLVLNLV-RSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLR 296

Query: 308 FIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFF 367
           FI+FNVT+PLA FYG +PWHFHL QSVP+I+GY L FFV  +  H   +       +P  
Sbjct: 297 FIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIM 356

Query: 368 QIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMT--------- 418
           QIK +++LN+ ++S   HKEFRF+YPLQP F+++S   +H    + ++R T         
Sbjct: 357 QIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSL 416

Query: 419 -WILPLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDI 477
            ++LP+             E+G + VM +LH+     +S+GFIMPCHSTPWQS+LHR D+
Sbjct: 417 LYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDL 476

Query: 478 PDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKV 537
             LWAI+C+PPL LL   DA  +L +YMDESDHLY N   F+++NFPPVF+++LRSPG+ 
Sbjct: 477 GKLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQ 536

Query: 538 YTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRP 594
           Y +EWPE+L++FE +D+  M+EYLKDS+YVE  RFFN+ SHWDSRRAGD++VY+K P
Sbjct: 537 YAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAGDVIVYHKSP 593

>Kwal_23.3478
          Length = 618

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/592 (48%), Positives = 383/592 (64%), Gaps = 15/592 (2%)

Query: 8   SLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFIF 67
           S+ + +++FR+ ++L   ++FQ DEFWQ LEPAH  AFGYG+LTW+W + +RSYAFPFIF
Sbjct: 31  SIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIF 90

Query: 68  ELTYRLVRLVVFMSRWXXXXXXXXXXXXXXXXFPSNEFXXXXXXXXXXXPSDMANSLEYI 127
           E+ YRLV +V  ++                   P +E            P ++ + LEY 
Sbjct: 91  EILYRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYY 150

Query: 128 GVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLS 187
           GVI  PKV+M LI A GE Y    I+KLY     + + + DE  K  S + +   A +LS
Sbjct: 151 GVIIAPKVMMALIGAVGEMYAFAFIEKLY-----TREFSGDEKNKMQSGKLVKMAACLLS 205

Query: 188 LTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPTN 247
            TNFFN ++ITR+F N+ EM  T  ALYFWDWTGG  +    FT SL   +F CLQRPTN
Sbjct: 206 TTNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTN 265

Query: 248 AFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLIN 307
           A IW+ LG  L+ N+  R  DFK   +L+RK++L F+ V  +N++IDFYFY E+  P+  
Sbjct: 266 ALIWVPLGLFLVLNLTAR-KDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFR 324

Query: 308 FIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFF 367
           FIKFN TS L++FYG++PWHFHL QS+P+ILG++   F+ G FC  + K      ++   
Sbjct: 325 FIKFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGLNSS-ML 383

Query: 368 QIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFAL-------HKLKWYQYSRMTWI 420
           Q ++++++N++ FSL +HKEFRF+Y L PFF+  S  AL        K+       + W 
Sbjct: 384 QARIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWA 443

Query: 421 LPLAXXXXXXXXXXFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDIPDL 480
            P            + E+G  EV K+LH+ P  + SVGFIMPCHSTPWQSY+HR DI D+
Sbjct: 444 PPFFSIIASLLVSSYHETGVTEVTKYLHHIP-RIHSVGFIMPCHSTPWQSYIHRNDIQDI 502

Query: 481 WAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTH 540
           W+ITCEPPL LL D DA   L SYMDESD LY N  +F+Y+N PPVF+KELRSP K Y+H
Sbjct: 503 WSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSH 562

Query: 541 EWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYK 592
           EWPEYLIIF+QLDD  M+++LKDS+Y E  RFFN+WSHWDSRR+GDI+VY K
Sbjct: 563 EWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDIIVYRK 614

>KLLA0C08591g complement(752256..753881) similar to sp|P53730
           Saccharomyces cerevisiae YNR030w ECM39 involved in cell
           wall biogenesis and architecture singleton, start by
           similarity
          Length = 541

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 275 LLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSV 334
           ++R   +   A   L++ +D YF+  +T+P I    FNV    ++ +G+ P+  +L    
Sbjct: 224 IVRTGFIGAGAGIFLSIQVDSYFWNRLTVPEIEAFIFNVVHGESSKWGTQPFFAYL---- 279

Query: 335 PIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPL 394
               GY  + F+P     L+H  F     N F  + +    +VLV SL  HKE+RFI   
Sbjct: 280 ---TGYLPMMFIPPTALLLNHLGF-KIGPNSFRVVGIAAYFHVLVMSLQPHKEWRFIIYS 335

Query: 395 QP 396
            P
Sbjct: 336 NP 337

>AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH]
           (418301..419914) [1614 bp, 537 aa]
          Length = 537

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 12/105 (11%)

Query: 289 LNVSIDFYFYGEITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVP- 347
           L+ +ID YF+G   +P ++   FNV    +  +G+ P   +  + +P       LFF P 
Sbjct: 236 LSATIDSYFWGRSCVPEMDAFVFNVIGGQSAKWGTEPLLAYFTRYLP------RLFFPPM 289

Query: 348 -GMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLTTHKEFRFI 391
             +FC    +     A+ PF  +    L+++++ SL  HKE+RFI
Sbjct: 290 VTVFCIAGVR----IASTPFRIVFAASLIHIMLLSLQPHKEWRFI 330

>Scas_714.36
          Length = 514

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 264 KRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSPLANFYGS 323
           +  + + ++ +L   I+L      LL+ +I  Y   E  I   N +K+N        +G 
Sbjct: 211 RHKSHWSSFLVLSLSILLTTSLCILLDTAI--YESNEWVITPWNNLKYNFDISNLESHGL 268

Query: 324 SPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLT 383
            PW+ H+  ++P +LG  ++ F+P +      K  T+  T       + I+ +++  S  
Sbjct: 269 HPWYTHILVNLPQLLG-PMIIFLPLILL----KTSTTIPT-------LSIMSSMVTLSYF 316

Query: 384 THKEFRFIYPLQPFFM 399
            H+EFRF+ PL P  +
Sbjct: 317 KHQEFRFLTPLVPLLL 332

>KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9 mannosyltransferase singleton,
           start by similarity
          Length = 553

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 18/144 (12%)

Query: 257 LLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNV--SIDFYFYGEITIPLINFIKFNVT 314
           L++TN+I      +    L   +   F+   + ++  +ID +FYG++++   N + +N+ 
Sbjct: 194 LVVTNVIHYTATHRFMDTLRAGVSSSFVFAIISSIVAAIDSFFYGKLSVVPFNIVMYNII 253

Query: 315 SP----LANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIK 370
           S       N +G  PW++++          NLL   P          FT  +  P     
Sbjct: 254 SANEDSGPNIFGVEPWYYYI---------QNLLLNFPITTLFFGVIGFTQLSIWP-LSGS 303

Query: 371 MIILLNVLVFSLTTHKEFRFIYPL 394
           + I LN  VF    HKE RF+YP+
Sbjct: 304 LFIWLN--VFLAQPHKEERFLYPI 325

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 29 QADEFWQALEPAHLMAFGYGELTWDW--KFAIRSYAF 63
            DE +   EP +L+  G+G+ TW++  +++IRS+AF
Sbjct: 35 DCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAF 71

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 23/137 (16%)

Query: 274 ILLRK-IVLCFMAVFL-LNVSIDFYF------YGEITIPLINFIKFNVTSPLANFYGSSP 325
           +L RK I +  +AV + L+ SI  YF        EI I  +  + +N+       +G  P
Sbjct: 202 VLYRKWIQMVVIAVSMTLSTSIIVYFDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHP 261

Query: 326 WHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVF-SLTT 384
            + HL  ++P+ILG       PG+    + K       N F  + ++ +++ L F S   
Sbjct: 262 RYTHLLVNIPLILG-------PGLLMIRNTK-------NDFLNLPLLSIISSLFFLSALR 307

Query: 385 HKEFRFIYPLQPFFMTV 401
           H+E RF+ P+ P F T+
Sbjct: 308 HQELRFLLPVVPLFSTL 324

>Kwal_47.18842
          Length = 508

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 21/159 (13%)

Query: 269 FKAYFIL-LRKIVLCFMA-----VFLLNVSIDFYFYGEITIPLINFIKFNVTSPLANFYG 322
           F A+F+   + +++C ++      F + V    Y   +  +  +N + +N+ +     +G
Sbjct: 200 FNAFFLHHFKSLMVCAISFISACAFFIYVDTTLYGTNDWCVAPMNNLAYNLKNSNLAEHG 259

Query: 323 SSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSL 382
             P + HL  +VP +LG  L+FFV       S ++  + +        +  +  ++V S+
Sbjct: 260 LHPRYTHLLLNVPQMLGPLLIFFV-------SRRQRINLSF-------LACISGIIVLSM 305

Query: 383 TTHKEFRFIYPLQPFF-MTVSVFALHKLKWYQYSRMTWI 420
             H+E RF+ PL P F ++V +    K    Q     W+
Sbjct: 306 FQHQELRFLIPLLPLFCVSVDLSNFDKFVSSQLVNKAWL 344

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 14/102 (13%)

Query: 299 GEITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKF 358
           G +  PL N +K+N+       +G  P + HL  ++P I+G  LL     +F      K 
Sbjct: 241 GFVITPL-NNLKYNLNVQNLQVHGLHPRYTHLLVNLPQIVGPVLLL---AIFSGYKLDKL 296

Query: 359 TSFATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMT 400
           +++A          I+  +L  S   H+E RF+ PL P  +T
Sbjct: 297 STYA----------IISGLLFLSFFQHQELRFLVPLVPLLVT 328

>ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..61658)
           [1659 bp, 552 aa]
          Length = 552

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 21/131 (16%)

Query: 293 IDFYFYGEITIPLINFIKFNVTSPLAN----FYGSSPWHFHLFQSVPIILGYNLLFFVPG 348
           +D  FY  +T+   N +K+NV    A+     +G+ PW++++F  +  +    L+F +  
Sbjct: 231 VDSIFYRRLTLVPWNIVKYNVLGTSADSGPHIFGTEPWYYYVFSLLLNLPLPTLIFAIVA 290

Query: 349 MFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHK 408
           +             TN  + +   +   ++VF    HKE RF+YP+  F    S     K
Sbjct: 291 LL-----------HTN-LWPVWCSLFAWLVVFIAQPHKEERFMYPIYAFVTLASSIGFTK 338

Query: 409 LKWYQYSRMTW 419
           +     S++ W
Sbjct: 339 V-----SKLLW 344

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 29 QADEFWQALEPAHLMAFGYGELTWDW--KFAIRSYAFPFIFELTYRLVRLVVFMSRW 83
            DE +   EP +L+  G+G+ TW++  +++IRS+AF    ++    VR +V    W
Sbjct: 30 DCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLMPLQVLLLGVRRLVQAREW 86

>CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces
           cerevisiae YNR030w involved in cell wall biogenesis and
           architecture, start by similarity
          Length = 562

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 20/141 (14%)

Query: 275 LLRKIVLCFMAVFL---LNVSIDFYFYGEITIPLINFIKFNVTSPLANFYG-SSPWHFHL 330
           + R +   FM   +   +++SID YF+G+  IP ++   FNV       YG S+ W    
Sbjct: 229 IFRALKFGFMGAGIAIGISMSIDSYFWGDWGIPEVDAFIFNVV------YGKSAQWGTE- 281

Query: 331 FQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIIL---LNVLVFSLTTHKE 387
              +     Y  + F+P     L++  + +   N    +K++ L    ++L  S   HKE
Sbjct: 282 -SPLAYFTNYLRMLFLPPTVLVLNYIGYRAAPKN----LKIVTLAGYFHILAMSTQPHKE 336

Query: 388 FRF-IYPLQPFFMTVSVFALH 407
           +RF IY + P  M  S  A +
Sbjct: 337 WRFIIYSVPPIIMLGSAGAAY 357

>Kwal_23.6317
          Length = 545

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (45%), Gaps = 26/149 (17%)

Query: 276 LRKIV----LCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSPLANFYGSSPWHFHLF 331
           LRKIV    L  M     ++ +D YF+   T P ++   FNV    +  +G+ P++ +L 
Sbjct: 227 LRKIVKTSALGAMVGATASIFVDSYFWRTWTFPEMDAFLFNVIDGKSAKWGTLPFYSYLT 286

Query: 332 QSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMII---LLNVLVFSLTTHKEF 388
             +P++       F+P     L    F  F   P  ++K++    + ++LV S   HKE+
Sbjct: 287 TMLPML-------FIPPTVLVLD---FMGFRAAP-QELKVLTEASIFHILVLSFQPHKEW 335

Query: 389 RFIYPLQPFFMTVSVFALHKLKWYQYSRM 417
           RFI          S+ AL  L  Y  SR+
Sbjct: 336 RFI--------VYSIPALTLLASYGASRI 356

>YNR030W (ECM39) [4612] chr14 (678798..680453) Protein involved in
           the dolichol pathway for N-glycosylation, member of a
           family of mannosyltransferases [1656 bp, 551 aa]
          Length = 551

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 9/137 (6%)

Query: 289 LNVSIDFYFYGEITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPG 348
           +++++D YF+ E  +P ++   FNV +  A+ +G  P   +          Y  + F+P 
Sbjct: 239 ISITVDSYFWQEWCLPEVDGFLFNVVAGYASKWGVEPVTAYFTH-------YLRMMFMPP 291

Query: 349 MFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLTTHKEFRF-IYPLQPFFMTVSVFALH 407
               L++  +   A      + +  L +++V S   HKE+RF IY +    +  +  A H
Sbjct: 292 TVLLLNYFGY-KLAPAKLKIVSLASLFHIIVLSFQPHKEWRFIIYAVPSIMLLGATGAAH 350

Query: 408 KLKWYQYSRMTWILPLA 424
             +  +  ++T +L LA
Sbjct: 351 LWENMKVKKITNVLCLA 367

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 99/240 (41%), Gaps = 37/240 (15%)

Query: 194 CYLITRSFINSFEMTTTAVALYFWDWTGGLTIES--SEFTKSLVIAMFTCLQRPTNAFIW 251
           CY  T +F NS E     + L  +      + +S    +  S++I  F CL      F  
Sbjct: 131 CYQ-THTFSNSLETVILLITLSLFKTLIQDSRDSKYQHYRTSVLIGFFICL----GIFNR 185

Query: 252 IVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFL---LNVSIDFYFYGEIT---IPL 305
           I   + ++   I   T  K Y+   R  ++C  +  L   L V  D   Y   T    PL
Sbjct: 186 ITFPAFILLPCIP--TMHKFYWHHWRSSMVCLFSFGLTSYLFVVADTRLYNSNTWCVAPL 243

Query: 306 INFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNP 365
            NF  +N+       +G  P + H+  +VP ILG  L+FF               F+   
Sbjct: 244 NNF-SYNMDESNLATHGLHPRYTHILFNVPQILGPALIFF---------------FSRRY 287

Query: 366 FFQIKMIILLNVLV-FSLTTHKEFRFIYPLQPFF---MTVSVFALHKLKWYQYSRMTWIL 421
              + ++  ++ LV  SL  H+E RF+ PL P F   M +S F    +KW    ++ W+L
Sbjct: 288 KLALPLLSCISGLVILSLFKHQELRFLVPLLPLFCISMNLSNFD-KVIKWEHVIKL-WLL 345

>CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9, start by similarity
          Length = 558

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 25/142 (17%)

Query: 281 LCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSPLA----NFYGSSPWHFH---LFQS 333
           L F+ + ++ + ID  FYG+      N   +NV +       N +G+ P+ ++   L  +
Sbjct: 216 LIFLLISVIVIGIDSLFYGKFAPVAWNIFFYNVLNADEEAGPNIFGTEPFSYYIQNLLLN 275

Query: 334 VPII-LGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSLTTHKEFRFIY 392
            PI  LG+ +L         +SH +     T+         ++   VF+L  HKE RF+Y
Sbjct: 276 FPITTLGFAVL--------GVSHWRLWPLWTSA--------IVWFTVFALQPHKEERFLY 319

Query: 393 PLQPFF-MTVSVFALHKLKWYQ 413
           PL  +  ++ S+     LK Y+
Sbjct: 320 PLYGYISLSASILTYKALKVYK 341

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 9/88 (10%)

Query: 4  LDNGSLFRAILVFRIANALLTRTFF----QADEFWQALEPAHLMAFGYGELTWDW--KFA 57
          ++N      ++V  +A  L  + F+      DE +   EP +L+  G+G+ TW++  +++
Sbjct: 1  MNNKYCTFVLVVLLVATRLYIQPFYSLISDCDETFNYWEPLNLLLRGFGKQTWEYSPEYS 60

Query: 58 IRSYAF--PFIFELTYRLVRLVVFMSRW 83
          IRS++F  PF + L Y L  +    + W
Sbjct: 61 IRSWSFLLPF-YSLLYPLNAVAEIQANW 87

>Kwal_23.4476
          Length = 552

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 53/132 (40%), Gaps = 20/132 (15%)

Query: 267 TDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSP----LANFYG 322
           +  KA F  L  + L   +VF    ++D+ FYG  T    N + +NV         N +G
Sbjct: 210 STMKAGFRALMALALVLGSVF----AVDYIFYGRFTPVAWNIVMYNVIGADEKSGPNIFG 265

Query: 323 SSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVFSL 382
             PW++++   +       LL              F   A    + I   ++  + +F  
Sbjct: 266 VEPWYYYILNLLLNFPLPVLL------------GSFLGIANLRLWPIWGGLVTWMAIFFQ 313

Query: 383 TTHKEFRFIYPL 394
             HKE RF+YP+
Sbjct: 314 QPHKEERFLYPV 325

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 9  LFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDW--KFAIRSYAF 63
          LF A+L  R+    +       DE +   EP + +  G+G+ TW++  +++IRS+AF
Sbjct: 11 LFSALLASRLYLQPVFSLISDCDETFNYWEPLNFLLRGFGKQTWEYSPEYSIRSWAF 67

>Scas_490.1
          Length = 457

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 15/117 (12%)

Query: 293 IDFYFYGEITIPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCH 352
           ID YF+ E  +P ++   FNV S  A+ +G+          +     Y  + F+P     
Sbjct: 264 IDSYFWKESCVPEVDAFIFNVISGQASKWGTE-------SPIAYFTHYIRMMFIPPTVLL 316

Query: 353 LSHKKFTSFATNPFFQIKMIIL---LNVLVFSLTTHKEFRF-IYPLQPFFMTVSVFA 405
           L++  F    TN    +K+I L    ++ + S   HKE+RF IY + P  +  S  A
Sbjct: 317 LNYFGFKLAPTN----LKIISLAAYFHIFIMSFQPHKEWRFIIYAIPPIMLLGSTAA 369

>Scas_606.6
          Length = 571

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 6/52 (11%)

Query: 14 LVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDW--KFAIRSYAF 63
          L F+  N+L++      DE +   EP +L+  G+G+ TW++  +++IRS+AF
Sbjct: 24 LYFQPFNSLIS----DCDETFNYWEPLNLLLRGFGKQTWEYSPEYSIRSWAF 71

>YNL219C (ALG9) [4385] chr14 complement(235995..237662)
          Mannosyltransferase involved in N-glycosylation,
          catalyzes transfer of mannose from Dol-P-Man to
          lipid-linked oligosaccharides [1668 bp, 555 aa]
          Length = 555

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 13/85 (15%)

Query: 11 RAILVFRIANALLTRTFFQ--------ADEFWQALEPAHLMAFGYGELTWDW--KFAIRS 60
          +A+ +  +    LTR + Q         DE +   EP +L+  G+G+ TW++  +++IRS
Sbjct: 4  KAVTISLLLLLFLTRVYIQPTFSLISDCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRS 63

Query: 61 YAF--PFIFELTYRLVRLVVFMSRW 83
          +AF  PF + + Y + +     S W
Sbjct: 64 WAFLLPF-YCILYPVNKFTDLESHW 87

>Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement
          Length = 551

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 27/157 (17%)

Query: 259 ITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINFIKFNVTSPLA 318
           +T  I+ GT        L  +VL  + V +   SID  FYG+ +    N + +NV     
Sbjct: 207 VTATIRTGT--------LSLLVLAVVTVIVF--SIDSIFYGKFSPVAWNIVMYNVIGANE 256

Query: 319 N----FYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIIL 374
           N     +G  PW++++   +       L+F V G+  HL             + +   ++
Sbjct: 257 NSGPDIFGIEPWYYYVLNLLLNFPLPVLIFSVIGLL-HLQ-----------LWPVWGSLV 304

Query: 375 LNVLVFSLTTHKEFRFIYPL-QPFFMTVSVFALHKLK 410
           + + +F    HKE RF+YP+     ++ SV  ++ LK
Sbjct: 305 VWMGIFFSQPHKEERFLYPIYSTLTLSASVGLVNCLK 341

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 29 QADEFWQALEPAHLMAFGYGELTWDW--KFAIRSYAF 63
            DE +   EP +++  G+G+ TW++  +++IRS+AF
Sbjct: 30 DCDETFNYWEPLNVLVRGFGKQTWEYSPEYSIRSWAF 66

>Kwal_14.1933
          Length = 334

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 494 DADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKVYTHEWPEYLIIFE-QL 552
           ++D    +    D  + LY +  R  +E F   +K +L S G VY H   + +   + QL
Sbjct: 55  ESDIVVDVSGKYDAENGLYDHHQREFFETFNDKYKTKLSSAGLVYKHFGQDIIKALQPQL 114

Query: 553 DDLIMREYLKDSSYVEYTRFF----NSWSHWDSRRAG 585
           +D  + E+L D  Y ++        N  S++DS   G
Sbjct: 115 EDSQV-EFLYDKVYRDFVESLDANDNGISNFDSEELG 150

>KLLA0C02321g complement(196533..202061) similar to sp|P41832
           Saccharomyces cerevisiae YNL271c BNI1 regulator of
           budding, start by similarity
          Length = 1842

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 32/58 (55%)

Query: 134 KVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLSLTNF 191
           K+  +      E Y + ++Q L+L ++K+++E+DD G     L+ I  + + +++T  
Sbjct: 579 KLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDSLISNVAITTL 636

>KLLA0F24222g complement(2259017..2261497) similar to sp|P53540
           Saccharomyces cerevisiae YNL126w SPC98 spindle pole body
           component singleton, start by similarity
          Length = 826

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 131 YGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKEN 166
           +G  V+  L A+ G  Y+ +LIQ LY     SSKEN
Sbjct: 5   FGTCVLHMLPASAGSAYSQQLIQDLYYSIKTSSKEN 40

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 14/78 (17%)

Query: 321 YGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQIKMIILLNVLVF 380
           +G  P + HL  ++P+I G  +L F+       S K              +  +  +L+ 
Sbjct: 285 HGLHPRYTHLLINLPLICGPIILLFI-------SQKAVLKLP-------ALSCISGILML 330

Query: 381 SLTTHKEFRFIYPLQPFF 398
           SL  H+E RFI P+ P  
Sbjct: 331 SLFRHQELRFIIPVLPLL 348

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,553,770
Number of extensions: 783981
Number of successful extensions: 2180
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2190
Number of HSP's successfully gapped: 39
Length of query: 596
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 489
Effective length of database: 12,891,983
Effective search space: 6304179687
Effective search space used: 6304179687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)