Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_669.1058558525870.0
CAGL0F07799g58059913071e-175
Kwal_23.348850250912211e-163
Sklu_2101.356847112161e-161
YMR171C55052611941e-158
KLLA0D10065g46646911341e-150
ADL279W49353111221e-148
Sklu_2430.75392993054e-29
KLLA0B12760g5421712771e-25
ABL026W4801712723e-25
Kwal_26.76655511662583e-23
Scas_721.1265731342494e-22
YKL124W (SSH4)5791722477e-22
CAGL0M06545g5871712478e-22
KLLA0A01221g872150800.13
AFR242C82361780.24
CAGL0I04114g91075750.65
Scas_712.2397361674.8
Kwal_47.1917383622674.8
YGR125W103643675.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_669.10
         (585 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_669.10                                                          1001   0.0  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   508   e-175
Kwal_23.3488                                                          474   e-163
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           473   e-161
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   464   e-158
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   441   e-150
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   436   e-148
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         122   4e-29
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   111   1e-25
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   109   3e-25
Kwal_26.7665                                                          103   3e-23
Scas_721.126                                                          100   4e-22
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   100   7e-22
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   100   8e-22
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...    35   0.13 
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    35   0.24 
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    33   0.65 
Scas_712.23                                                            30   4.8  
Kwal_47.19173                                                          30   4.8  
YGR125W (YGR125W) [2082] chr7 (742328..745438) Member of the sul...    30   5.1  

>Scas_669.10
          Length = 585

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/585 (85%), Positives = 498/585 (85%)

Query: 1   MLIRKATLLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLI 60
           MLIRKATLLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLI
Sbjct: 1   MLIRKATLLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLI 60

Query: 61  TMXXXXXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEESTRTNNEXXXXXXXXXXXD 120
           TM              KFVVTRMLTSNISRISLLNRTEVEESTRTNNE           D
Sbjct: 61  TMIIIYVLVILVYIVVKFVVTRMLTSNISRISLLNRTEVEESTRTNNEGTGRSRRSTRRD 120

Query: 121 QRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXXXXXXXXXXXXXXXXXXXXX 180
           QRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQ                     
Sbjct: 121 QRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQNPPIIIPPNNNNNSNDISTTD 180

Query: 181 XXAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTN 240
             AEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTN
Sbjct: 181 SNAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTN 240

Query: 241 LPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDS 300
           LPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDS
Sbjct: 241 LPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDS 300

Query: 301 NGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKG 360
           NGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKG
Sbjct: 301 NGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKG 360

Query: 361 CKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDAL 420
           CKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDAL
Sbjct: 361 CKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDAL 420

Query: 421 VGSYQDLEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLRDEYGQLLPPPPGFEF 480
           VGSYQDLEDGI                               PLRDEYGQLLPPPPGFEF
Sbjct: 421 VGSYQDLEDGINDEEEDYEDEEEEDEEEDYDEEDDNTTTETDPLRDEYGQLLPPPPGFEF 480

Query: 481 STSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDASWDEHD 540
           STSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDASWDEHD
Sbjct: 481 STSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDASWDEHD 540

Query: 541 DEADYERTTNQLQGLLEDHXXXXXXXXSDREGVSNEHDALMGRID 585
           DEADYERTTNQLQGLLEDH        SDREGVSNEHDALMGRID
Sbjct: 541 DEADYERTTNQLQGLLEDHEEEEEEEESDREGVSNEHDALMGRID 585

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 299/599 (49%), Positives = 358/599 (59%), Gaps = 82/599 (13%)

Query: 11  LLTFWLCQRVNGYVIPR--------------DLPHSEESIGTPYPYED-----------D 45
           LL   L  + +G+VIP               D+P   E +  P P ED           +
Sbjct: 2   LLFLGLLAQASGFVIPDAYRDAQSTGLKRRDDVPTPPEVLPYPGPAEDVPYPGTPDGYTN 61

Query: 46  KDEDVDFHVMLFSLITMXXXXXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEESTRT 105
           +D+ +D +VM     +M              K VVTR+LT + +RISLLN    EE   T
Sbjct: 62  QDDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTRH-ARISLLN----EEGMAT 116

Query: 106 NNEXXXXXXXXXXXDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXXXXXX 165
                          +     S LDD   VKSKL  L+PEEQFYYKQGEE+IKQ      
Sbjct: 117 GLSARSRRLAESAESR---WPSALDDENEVKSKLQKLSPEEQFYYKQGEEYIKQNPPLII 173

Query: 166 XXXXXXXXXXXXXXXXXAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTE 225
                              +DPI+N QT+QFIEEEGA AWEFQ +PNLPNDTI++ENKTE
Sbjct: 174 STGSRSGDQNTV-------NDPIINDQTRQFIEEEGALAWEFQPNPNLPNDTIIVENKTE 226

Query: 226 ITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPY 285
           I+FLNYNYDASV TNLPIPCINRVYYCEFKIFEL+ + +QT L  NE+IS GL+TSPYPY
Sbjct: 227 ISFLNYNYDASVTTNLPIPCINRVYYCEFKIFELSITDDQTTLKDNEIISFGLSTSPYPY 286

Query: 286 FRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRN 345
           FRLPGRHHHSIAYDSNGARRFNDSF L+PELA+LFP C++GDIIG+GYRTRSGT FFTRN
Sbjct: 287 FRLPGRHHHSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRN 346

Query: 346 GKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGL 405
           GKK+SEKS+GGHIKG K KYLYP+VG NVPCK+HVNFG+YGFV+IEANVKKWGYAK +G+
Sbjct: 347 GKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFIEANVKKWGYAKPNGI 406

Query: 406 KVPPPSYEEYGKDALVGSYQDLEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLR 465
           K+PPPSY++Y +D L      LE G                                 + 
Sbjct: 407 KLPPPSYDDYVQDTL------LESGYEDNDNSDNDSDDESDTDNRRQHRSIKNT----II 456

Query: 466 DEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYS--------------QD 511
           D  G LLPPPPGFEFSTSP S+ G NEE  INL+SLP +PP YS              +D
Sbjct: 457 DIDGNLLPPPPGFEFSTSPHSH-GTNEE--INLDSLPMNPPSYSDEESKNQVKSKITPRD 513

Query: 512 VSNRTNSFTLDEGRS---KDFIEND----------ASWDEHDDEADYERTTNQLQGLLE 557
              R++  T DE  S   K  + ND            + E DD   YE   ++LQ ++E
Sbjct: 514 SVGRSDGLTQDEQGSREGKSMMLNDLENDGLDDDEDDYMESDD--GYEHDIDELQAMIE 570

>Kwal_23.3488
          Length = 502

 Score =  474 bits (1221), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 261/509 (51%), Positives = 316/509 (62%), Gaps = 63/509 (12%)

Query: 6   ATLLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLITMXXX 65
           A LL +L  W+ +   GYV  +     +  +G+  PY+ D ++D+D  +M+FSL  M   
Sbjct: 13  AVLLSVL--WIKKASCGYVPSQS--DGQHFVGSG-PYDGDYEDDLDIGLMMFSLAFMVFS 67

Query: 66  XXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEESTRTNNEXXXXXXXXXXXDQRFDL 125
                      KF++ R   + IS    L+  E        N                  
Sbjct: 68  YFALTLVYLVVKFLLRRYFRTGIS----LSEGESRVIGPAVNAR---------------W 108

Query: 126 ESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXXXXXXXXXXXXXXXXXXXXXXXAED 185
            S LDD + V+ KL+ ++ EEQFYYKQGEEFIKQ                          
Sbjct: 109 PSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETV--------- 159

Query: 186 DPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTNLPIPC 245
           DPI+N QT QFI+EEGA AWEFQ DP LPND++L+ENK+EITFLNYNYD SVMTNLPIP 
Sbjct: 160 DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPR 219

Query: 246 INRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGARR 305
           +NRVYYCEFKIFELN +    N S NE++S GL+TSPYPYFRLPGRHHHSIAYDS G RR
Sbjct: 220 LNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRR 279

Query: 306 FNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKY 365
           FNDSF L PELA++FP CE+GD+IG+GYRT SGT FFTRNGKK++EKSIGGHIKG K KY
Sbjct: 280 FNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKY 339

Query: 366 LYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDALV-GSY 424
           +YPIVG+N+PCKVHVNFGTYGFV+IEANVKKWGYAKS+G+K+PPPSYE+Y +D L+  SY
Sbjct: 340 VYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSY 399

Query: 425 QDLEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLRDEYGQLLPPPPGFEFSTSP 484
           +D                                     + D  G LLPPPPGFE+S SP
Sbjct: 400 ED-----------------------DATDNESTSTIDGDIIDSEGHLLPPPPGFEYSVSP 436

Query: 485 L-SNFGQNEEEDINLNSLPYDPPRYSQDV 512
             S  GQ       LNSLP +PPRY+ D 
Sbjct: 437 QPSAAGQ-----FTLNSLPPEPPRYASDT 460

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  473 bits (1216), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/471 (54%), Positives = 302/471 (64%), Gaps = 53/471 (11%)

Query: 42  YEDDKDEDVDFHVMLFSLITMXXXXXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEE 101
           ++DD ++D+D  ++ FS+  M              +FV+ +  ++   RISL N      
Sbjct: 92  FQDDYEDDMDMAMLFFSMAFMLLSYILLTLIYFSVRFVIKKYFST---RISLNNNNSPNI 148

Query: 102 STRTNNEXXXXXXXXXXXDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXX 161
            T T+N                   S LDD E VK KL  L+PEEQFYYKQGEE+IKQ  
Sbjct: 149 RTTTSNS----------------WPSSLDDEEAVKDKLVKLSPEEQFYYKQGEEYIKQNP 192

Query: 162 XXXXXXXXXXXXXXXXXXXXXAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIE 221
                                   DPI+N QT +FIEEEG  AWEFQ DPNLPNDTILIE
Sbjct: 193 PLLIPHRSEDSQGML---------DPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTILIE 243

Query: 222 NKTEITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTN-LSPNEVISMGLAT 280
           NKTEITFLNYNYDASVMTNLP+P +NRVYY E KIFELN S    N LS NE+IS GL++
Sbjct: 244 NKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFGLSS 303

Query: 281 SPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTF 340
           SPYPYFRLPGRHHHSIAYDS G RRFNDSF L  ELA++FP  ++GDIIG+GYRT SGT 
Sbjct: 304 SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTV 363

Query: 341 FFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYA 400
           FFTRNGKK++EK IGGHIKG K+KYLYPIVG NVPCKVHVNFG+YGFV+IEANVKKWGYA
Sbjct: 364 FFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKWGYA 423

Query: 401 KSHGLKVPPPSYEEYGKDALVGSYQDLEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 460
           KSHG+K+PPPSY+EYG+D L+ S    ED I                             
Sbjct: 424 KSHGVKLPPPSYDEYGQDVLLES--SYEDDITDNESVSTVEGD----------------- 464

Query: 461 XXPLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYSQD 511
              + D  G+LLPPPPGFEFST+P S    N  + I L+SLP  PP YS D
Sbjct: 465 ---IVDSDGELLPPPPGFEFSTTPQSR--GNIGDQITLDSLPAQPPSYSSD 510

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  464 bits (1194), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 250/526 (47%), Positives = 327/526 (62%), Gaps = 37/526 (7%)

Query: 42  YEDDKDEDVDFHVMLFSLITMXXXXXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEE 101
           Y  D  ++++  +MLF+  T+              K + TR++T+  +      R  +  
Sbjct: 34  YGGDDTDELNMDIMLFAFGTLIVVYIVICIVYFFTKQIATRLITAYYNEHGPGQRISLFS 93

Query: 102 STRTNNEXXXXXXXXXXXDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXX 161
               NN              R+   + LDD + V+ KL+ L+PEEQFYYKQGEE+IKQ  
Sbjct: 94  DYDENNAHVHSRRLMENMSLRW--PNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNP 151

Query: 162 XXXXXXXXXXXXXXXXXXXXXAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIE 221
                                  +DPIMN QT+Q+I+EEGA AWEF  +P++PN T+++E
Sbjct: 152 PFLLNQGLLQQSEDSNPDT--TREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVE 209

Query: 222 NKTEITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATS 281
           NKTE++FLNYNYDAS+ TNLPIPCIN+VYYCEFKIFE +            VIS GL+T 
Sbjct: 210 NKTEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKGVISFGLSTQ 269

Query: 282 PYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFF 341
           PYPYFRLPGRHHHSIAYDSNGARRFNDSF L+ +L  LFP CE+GDI+G+GYR+RSGT F
Sbjct: 270 PYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVF 329

Query: 342 FTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAK 401
           FTRNGKK++EKS+GGHI+G K +YLYPI+G+NVPC++HVNFGTYGFVYIEANVKKWGYAK
Sbjct: 330 FTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAK 389

Query: 402 SHGLKVPPPSYEEYGKDALVGSY-------QDLEDGIXXXXXXXXXXXXXXXXXXXXXXX 454
           S+G+K+PPPSYE+YGKD L+ S        +D  DG                        
Sbjct: 390 SNGIKLPPPSYEDYGKDTLLESGGEDNDFDEDFSDG---------------DSDNIAAGS 434

Query: 455 XXXXXXXXPLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSN 514
                    +R+  G++LPPPPGFEF+ SP +   +   E+INL+SLP  PP YS D  +
Sbjct: 435 TTNLNDDIIIRN--GEILPPPPGFEFTMSPPTG-KKIINEEINLDSLPMLPPSYSDDEHH 491

Query: 515 RTNSFTLDEGR----SKDFIENDASWD----EHDDEADYERTTNQL 552
             N  +   GR    S++ I ++AS+D    +++DE D+ER   Q 
Sbjct: 492 SKNDKSAISGRIIGTSRNLITDEASFDSVDNDNEDENDHERDPEQF 537

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  441 bits (1134), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 298/469 (63%), Gaps = 50/469 (10%)

Query: 43  EDDKDEDVDFHVMLFSLITMXXXXXXXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEES 102
           E   D DVD  +++F+++ M              +++V R+ T+   RISL      EE 
Sbjct: 28  EGPSDPDVDMDLIVFTMMFMFLSYLLSILVYFVTRWLVKRLFTA---RISLH-----EEG 79

Query: 103 TRTNNEXXXXXXXXXXXDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXXX 162
           T    +                 + +LDD   VK  L  L+P+EQFYYKQGEE++KQ   
Sbjct: 80  TMNGGQSDLSE------------DRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPP 127

Query: 163 XXXXXXXXXXXXXXXXXXXXAEDDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIEN 222
                                  DPI+N QT QFIEEEGA+AWEFQADPNLPNDT++I+ 
Sbjct: 128 LLVPYLPNDPENREEVIP-----DPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQE 182

Query: 223 KTEITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGLATSP 282
           +TE+TFLN++YDASVMT LPIP +N+VYY E KIFELN    + +LS NE+IS+GL+TSP
Sbjct: 183 RTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFELNQG--KNHLSDNEMISIGLSTSP 240

Query: 283 YPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFF 342
           YPYFRLPGRHHHSI+YDS+G RR N SFP+  EL  LFP  E+GD+IG+GYRTRSGT FF
Sbjct: 241 YPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFF 300

Query: 343 TRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKS 402
           T NGKK++EK +GGHIKG K+KYLYPIVG+N+PCK+HVNFGTYGFVYIEANVKKWGY+K+
Sbjct: 301 THNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKN 360

Query: 403 HGLKVPPPSYEEYGKDALVGSYQDLEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 462
            G+K+PPPSYE+Y +D L+ S    ED +                               
Sbjct: 361 AGIKLPPPSYEDYDQDVLLES--AFEDDVSDSESITSDSINEQ----------------- 401

Query: 463 PLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYSQD 511
            + D+ G +LPPPPGFEFSTS  S+      E I ++SLP +PP YS D
Sbjct: 402 -ITDQSGNILPPPPGFEFSTSVASDI---PVESITMHSLPAEPPNYSAD 446

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 253/531 (47%), Positives = 323/531 (60%), Gaps = 65/531 (12%)

Query: 8   LLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLITMXXXXX 67
           +  +  ++L +   G  +P  L        T +P  DD + D+DF +  FSL+ M     
Sbjct: 1   MFNIAIWFLVRGARG--MPVTLQRVARRSATVFP--DDNELDMDFVLFTFSLVFMLLCYG 56

Query: 68  XXXXXXXXXKFVVTRMLTSNISRISLLNRTEVEESTRTNNEXXXXXXXXXXXDQRFDLES 127
                    ++VV R  T    RI+L       +S+R N+                D+ +
Sbjct: 57  MMVLIYLGLRYVVRRCFTR---RIAL----SSSDSSRANSG---------------DVPT 94

Query: 128 FLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQXXXXXXXXXXXXXXXXXXXXXXXAEDDP 187
            LDD   V+ KL+ L+PEEQFYYKQGEEFIKQ                          DP
Sbjct: 95  VLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVF--DP 152

Query: 188 IMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTNLPIPCIN 247
           ++N QT ++IEEEGA AWEFQ  P+LP D + +EN+TE+TF+N N D SV TNLPIP  N
Sbjct: 153 VINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLAN 212

Query: 248 RVYYCEFKIFELNNSPEQ--TNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGARR 305
           +VYY E KIFEL +   +  ++LS N+++S GLATSPYPYFRLPGRHHHS+AYDSNGARR
Sbjct: 213 KVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARR 272

Query: 306 FNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKY 365
            N+SF L  EL++LFP CE+GD+IG+GYRTRSGT FFTRNGKK++EK IGGHIKG KIKY
Sbjct: 273 LNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKY 332

Query: 366 LYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDALV-GSY 424
           LYPIVG NVPCK+HVNFGTYGFVYIEANVKKWGYAK +G+K+PPP+YE+Y +D L+  SY
Sbjct: 333 LYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSY 392

Query: 425 QD-LEDGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLRDEYGQLLPPPPGFEFSTS 483
           +D + +G                                 L D  G LLPPPPGFEFST+
Sbjct: 393 EDEVSEG-------------------------ETNSFVEHLHD--GHLLPPPPGFEFSTT 425

Query: 484 PLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDA 534
           P SN  Q       LN+LP +PP Y  DV+  +       GRS++ +++DA
Sbjct: 426 PTSNCDQ-----FTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSEN-VQSDA 470

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  122 bits (305), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 92/299 (30%), Positives = 143/299 (47%), Gaps = 79/299 (26%)

Query: 194 KQFIEEEGASAWEF---------QADPNLPNDTILIENKTEITFLNYNYDASVMTNLPIP 244
           KQ I++ G  ++ F         +A   LP  + LI++K +I F  YN  +S + N P+P
Sbjct: 162 KQLIKDRGIQSYYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSAIMNFPLP 219

Query: 245 CINR--VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNG 302
             NR    Y E K+F+    P ++N     + ++GL T PYPYFR+PG + HSIAY+S G
Sbjct: 220 Y-NRKDAVYFEVKVFKY---PSKSN----SIFTIGLITPPYPYFRMPGYNKHSIAYESTG 271

Query: 303 ARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSE--KSIG----- 355
             R ++ F  +     L P  E GD++G GYR RSGT F T NGKK+ +  ++IG     
Sbjct: 272 KLRISNPFYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFI 327

Query: 356 --GHIKGC----------------------------------------KIKYLYPIVGTN 373
             G +  C                                        +++ ++     +
Sbjct: 328 GLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTED 387

Query: 374 VP---CKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY--EEYGKDALVGSYQDL 427
           +P    ++ VN G  GFV+IEANVKK+ +   +G    PPSY  +E  +D ++   ++L
Sbjct: 388 IPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEEL 446

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 90/171 (52%), Gaps = 23/171 (13%)

Query: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239
           +N Q KQ I++ G  ++ F    N         LP  +  +E+K  ++F  +N  +S + 
Sbjct: 154 LNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLP--SFFVEDKLNVSFTKFNISSSAIM 211

Query: 240 NLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAY 298
           N P+P   +   Y E K+++            N + S+GL T PYPYFR+PG   +SIAY
Sbjct: 212 NYPLPMNKKDAVYFEVKVYKFKTCS-------NSIFSIGLMTCPYPYFRIPGTAAYSIAY 264

Query: 299 DSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349
           +S G  R N++F  D     L P  E GD++G GYR  SGT F T NGKK+
Sbjct: 265 ESTGKLRINNAFGAD----TLLPKLEEGDVVGFGYRYSSGTIFITHNGKKM 311

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 376 CKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY 412
            ++HVN G  GFV+IEANVKK+ +   +G    PP+Y
Sbjct: 397 IELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAY 433

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 92/171 (53%), Gaps = 21/171 (12%)

Query: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239
           M  + +Q + + G  A+      N         LP  + L+++K  +TF  YN  +S + 
Sbjct: 91  MCPEDRQCVRDRGIQAYYLLPSINDNVDRRGNFLP--SFLVQDKLNVTFTKYNKSSSTIM 148

Query: 240 NLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAY 298
           N P+P   R   Y E K+++  N      L+ N + S+GL T PYPYF +PG   +SIAY
Sbjct: 149 NYPLPHNKRDAVYFEVKVYKFRNY-----LASNSIFSIGLVTCPYPYFVMPGMCQYSIAY 203

Query: 299 DSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349
           +S G  R N+SF      + L P  + GD++G+GYR R+GT F T NGKK+
Sbjct: 204 ESTGKLRINNSF----YASTLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 377 KVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY--EEYGKDALVGSYQDL 427
           ++ VN G  GFV++EANVKK+ +   +G    PP+Y  +E   D ++    DL
Sbjct: 330 ELQVNLGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDL 382

>Kwal_26.7665
          Length = 551

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (53%), Gaps = 23/166 (13%)

Query: 194 KQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMTNLPIP 244
           KQFI++ G  ++ F    N         LP  + ++++K ++ F  +N  AS + N P+P
Sbjct: 192 KQFIKDRGVQSYYFLPSINDNVDHYGNFLP--SFIVQDKLDVLFTKFNRSASTIMNYPLP 249

Query: 245 CINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGA 303
              +   Y E K+F+    P ++N     + S GL T PYPYFR+PG    SIAY+S G 
Sbjct: 250 QNKKEAVYFEVKVFKF---PAKSN----SIFSCGLVTCPYPYFRIPGMAQFSIAYESTGK 302

Query: 304 RRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349
            R N+ F  +     L P  + GD+IG GYR ++GT   T NGKK+
Sbjct: 303 LRMNNPFYAN----TLLPKLQEGDVIGFGYRYKTGTILITHNGKKL 344

>Scas_721.126
          Length = 573

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (55%), Gaps = 12/134 (8%)

Query: 217 TILIENKTEITFLNYNYDASVMTNLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVIS 275
           + LI++K ++ F  YN  +S + N P+P   R   Y E K+F+  + P       N + S
Sbjct: 196 SFLIQDKLDMVFTKYNKSSSTVMNYPLPYTKRDAVYFEVKVFK--HQP-----VSNTIFS 248

Query: 276 MGLATSPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRT 335
           +GL T PYPYFR+PG    SIAY+S G  R N+ F      + L P    GD++G GYR 
Sbjct: 249 IGLVTVPYPYFRIPGMAKFSIAYESTGKLRINNPF----MASTLLPKLVEGDVVGFGYRY 304

Query: 336 RSGTFFFTRNGKKV 349
            SGT F T NGKK+
Sbjct: 305 SSGTIFITHNGKKL 318

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 376 CKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY--EEYGKDALV 421
            ++HVN G  GFV+IEANVKK+ +   +G    PPSY  EE   D L+
Sbjct: 392 VELHVNLGQVGFVFIEANVKKYAFGTVYGNIGIPPSYNGEEIKNDKLL 439

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 90/172 (52%), Gaps = 25/172 (14%)

Query: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239
           ++   +QFI++ G  ++      N         LP  + ++++K +I F  +N  +S + 
Sbjct: 162 LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDKLDIQFSKFNKSSSTVM 219

Query: 240 NLPIPCINR--VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIA 297
           N P+P  NR    Y E KIF       +     N + S+GL T PYPYFR+PG   +SIA
Sbjct: 220 NYPLPH-NRKDAVYFEVKIF-------RHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIA 271

Query: 298 YDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349
           Y+S G  R N+ F      + L P  E GD +G GYR ++GT F T NGKK+
Sbjct: 272 YESTGKLRINNPF----TASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 91/171 (53%), Gaps = 23/171 (13%)

Query: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239
           ++ +  Q I++ G  ++ F    N         LP  + L+++K E+ F  +N  +S + 
Sbjct: 158 LDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLP--SFLVQDKLEVEFTRWNKSSSAVL 215

Query: 240 NLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAY 298
           N P+P   +   Y E K++  N+ P       N + S+GL T PYPYFR+PG    SIAY
Sbjct: 216 NYPLPYNKKDAVYFEVKVY--NHKPNS-----NSIFSIGLVTVPYPYFRIPGMCKFSIAY 268

Query: 299 DSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349
           +S G  R ND  P  P  + L P    GD++G GYR ++GT F T NGKK+
Sbjct: 269 ESTGKLRIND--PFFP--STLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 62/150 (41%), Gaps = 32/150 (21%)

Query: 261 NSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLF 320
           NSP     SP++ I   + T  Y Y  L G       +D++G+++++  F  D       
Sbjct: 419 NSPS----SPSQTIHGDVET--YSYSGLDGN-----KFDASGSQKYSRPFGND------- 460

Query: 321 PVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHV 380
                 DI+G G     G+ FFT+NG       +G   + C    L P V       +  
Sbjct: 461 ------DIVGCGVNFIEGSIFFTKNG-----IFLGNAFEDCFDIDLVPFVSIKSGNSLRT 509

Query: 381 NFG-TYGFVY-IEANVKKWGYAK-SHGLKV 407
           NFG T  F++ I+    +W Y   SH  K 
Sbjct: 510 NFGLTEEFLFDIDQYQLQWKYKTYSHIFKA 539

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 5/61 (8%)

Query: 325 RGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGT 384
           R D+IG G     GT FFT+NG       +G   K      L P V       +  NFG 
Sbjct: 404 RDDVIGCGINYVDGTIFFTKNGIH-----LGTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458

Query: 385 Y 385
           Y
Sbjct: 459 Y 459

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 325 RGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGT 384
           R D+IG G    +G+ FFT+NG  + E ++   +    I Y+    G +    V  NFG 
Sbjct: 504 RDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNFGL 558

Query: 385 Y-GFVY-IEANVKKW 397
           Y  FV+ I    K W
Sbjct: 559 YEEFVFDINQYQKNW 573

>Scas_712.23
          Length = 973

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 5/61 (8%)

Query: 325 RGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGT 384
           R DIIG G     GT FFT+NG       +G          + P +       V  NFG 
Sbjct: 582 RDDIIGCGINYIDGTIFFTKNG-----VFLGTAFTNVYDLNVVPSIALKPGNSVRTNFGI 636

Query: 385 Y 385
           Y
Sbjct: 637 Y 637

>Kwal_47.19173
          Length = 836

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 14/22 (63%)

Query: 325 RGDIIGVGYRTRSGTFFFTRNG 346
           R D+IG G     GT FFT+NG
Sbjct: 441 RNDVIGCGVNYVDGTIFFTKNG 462

>YGR125W (YGR125W) [2082] chr7 (742328..745438) Member of the
           sulfate permease family of membrane transporters [3111
           bp, 1036 aa]
          Length = 1036

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%)

Query: 487 NFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDF 529
           N G N +   NL SLP + PR  Q +S   N F  DE   K+F
Sbjct: 829 NRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNF 871

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,775,060
Number of extensions: 820568
Number of successful extensions: 2579
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2587
Number of HSP's successfully gapped: 45
Length of query: 585
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 478
Effective length of database: 12,891,983
Effective search space: 6162367874
Effective search space used: 6162367874
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)