Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_668.1887587545920.0
YGL163C (RAD54)89889836540.0
KLLA0A03069g89592131480.0
AEL297W89592929590.0
CAGL0I04224g94259226970.0
Kwal_14.153784285526380.0
KLLA0F11814g93161210521e-128
YBR073W (RDH54)9246089801e-118
Scas_718.409266109791e-118
AGL212W9036039741e-117
Kwal_27.105139006079701e-117
CAGL0M01958g9206049471e-113
CAGL0I01694g10716897236e-81
Sklu_2125.310525677182e-80
Scas_549.410795307007e-78
KLLA0E22726g10335496918e-77
AEL065C10255336882e-76
YJR035W (RAD26)10856206875e-76
YOR304W (ISW2)11206016214e-67
CAGL0I09614g10395236142e-66
CAGL0C01683g11155266063e-65
Scas_665.1710605186011e-64
Kwal_34.160827264675774e-63
Scas_652.1710255375876e-63
KLLA0F24838g10624855823e-62
Kwal_14.160011025755814e-62
KLLA0F04521g13444895801e-61
Kwal_34.1592510254925752e-61
Scas_597.810654885691e-60
KLLA0C17578g15255435694e-60
YER164W (CHD1)14684955667e-60
YBR245C (ISW1)11296075648e-60
Kwal_23.477713014905641e-59
Scas_594.717035705641e-59
YOR290C (SNF2)17034855642e-59
CAGL0M04807g17304865622e-59
AER375C12884855603e-59
Scas_662.713424895603e-59
AFL040W10865525575e-59
KLLA0F06710g10965365576e-59
Kwal_26.916414544865552e-58
CAGL0L11770g14765105542e-58
Kwal_56.2344214355135507e-58
Scas_576.614574875499e-58
YIL126W (STH1)13594855481e-57
AFR562C14444865481e-57
KLLA0E23804g18735345429e-57
AFR537W10254905381e-56
AGR123C14224815382e-56
CAGL0H05533g19045325294e-55
CAGL0G08756g13544925267e-55
AEL256C18666005242e-54
KLLA0B08327g15344885232e-54
YPL082C (MOT1)18675625205e-54
Scas_664.918595515118e-53
KLLA0F07513g10485324732e-48
KLLA0E04048g8262653126e-29
ACR286C10193083073e-28
Scas_520.58633113063e-28
ADL098C8043723053e-28
YFR038W8533343028e-28
Scas_548.410541512966e-27
CAGL0H06193g11261562967e-27
Kwal_55.2014314944002951e-26
CAGL0J02662g8443142931e-26
YAL019W (FUN30)11311632931e-26
Scas_669.2013973002932e-26
Sklu_1582.22831642742e-26
YGL150C (INO80)14893092904e-26
CAGL0M01188g14501712896e-26
Kwal_27.1138813343752886e-26
ADR309W14861712851e-25
KLLA0E08965g14893062842e-25
YDR334W15141702832e-25
Kwal_26.712310812692813e-25
Scas_646.3*14561522823e-25
KLLA0F21758g15723012805e-25
Kwal_47.180778091582777e-25
CAGL0E05038g14843232781e-24
AGR379W14141552672e-23
AAR147W15801472378e-20
Kwal_47.177719721582313e-19
AFR220W10851522304e-19
CAGL0A03432g11511782233e-18
ADL345C7461672188e-18
KLLA0F17479g11141782181e-17
Kwal_23.36607681512171e-17
CAGL0G09493g14081552181e-17
CAGL0K07766g8301722152e-17
Scas_721.10011371772143e-17
KLLA0B09240g8001512133e-17
YBR114W (RAD16)7901742116e-17
Scas_591.107721872108e-17
Kwal_14.186813571492063e-16
YLR032W (RAD5)11691582045e-16
KLLA0C05368g16051392046e-16
YOR191W (RIS1)16191502021e-15
Scas_674.12d13231481912e-14
Sklu_2412.711271371832e-13
KLLA0F12166g15281961412e-08
Kwal_14.128715181501384e-08
AAL030C15391251304e-07
YLR247C15561501286e-07
Scas_573.91502651232e-06
CAGL0B05049g1470631188e-06
Sklu_2432.9147561960.003
Sklu_2234.2100668960.003
Kwal_34.1608029043760.43
KLLA0D08932g27899730.97
KLLA0F23716g554153741.1
ACL033C93066712.9
Sklu_2393.10550119703.4
Sklu_2029.259867703.7
AGL004C64271694.1
CAGL0C03399g47833684.8
Scas_588.1669356685.2
KLLA0E04763g63660678.3
YML091C (RPM2)120245678.4
AAL069C66569669.5
KLLA0A04983g125150669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_668.18
         (875 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_668.18                                                          1773   0.0  
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...  1412   0.0  
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...  1217   0.0  
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...  1144   0.0  
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...  1043   0.0  
Kwal_14.1537                                                         1020   0.0  
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   409   e-128
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   382   e-118
Scas_718.40                                                           381   e-118
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   379   e-117
Kwal_27.10513                                                         378   e-117
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   369   e-113
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   283   6e-81
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           281   2e-80
Scas_549.4                                                            274   7e-78
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   270   8e-77
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   269   2e-76
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   269   5e-76
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   243   4e-67
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   241   2e-66
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   238   3e-65
Scas_665.17                                                           236   1e-64
Kwal_34.16082                                                         226   4e-63
Scas_652.17                                                           230   6e-63
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   228   3e-62
Kwal_14.1600                                                          228   4e-62
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   228   1e-61
Kwal_34.15925                                                         226   2e-61
Scas_597.8                                                            223   1e-60
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   223   4e-60
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   222   7e-60
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   221   8e-60
Kwal_23.4777                                                          221   1e-59
Scas_594.7                                                            221   1e-59
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   221   2e-59
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   221   2e-59
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   220   3e-59
Scas_662.7                                                            220   3e-59
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   219   5e-59
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   219   6e-59
Kwal_26.9164                                                          218   2e-58
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   218   2e-58
Kwal_56.23442                                                         216   7e-58
Scas_576.6                                                            216   9e-58
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   215   1e-57
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   215   1e-57
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   213   9e-57
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   211   1e-56
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   211   2e-56
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   208   4e-55
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   207   7e-55
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   206   2e-54
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   206   2e-54
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   204   5e-54
Scas_664.9                                                            201   8e-53
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   186   2e-48
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   124   6e-29
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   122   3e-28
Scas_520.5                                                            122   3e-28
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   122   3e-28
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   120   8e-28
Scas_548.4                                                            118   6e-27
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   118   7e-27
Kwal_55.20143                                                         118   1e-26
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   117   1e-26
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   117   1e-26
Scas_669.20                                                           117   2e-26
Sklu_1582.2 , Contig c1582 197-1048                                   110   2e-26
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   116   4e-26
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   115   6e-26
Kwal_27.11388                                                         115   6e-26
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   114   1e-25
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   114   2e-25
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   113   2e-25
Kwal_26.7123                                                          112   3e-25
Scas_646.3*                                                           113   3e-25
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   112   5e-25
Kwal_47.18077                                                         111   7e-25
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   111   1e-24
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   107   2e-23
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    96   8e-20
Kwal_47.17771                                                          94   3e-19
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    93   4e-19
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    91   3e-18
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    89   8e-18
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    89   1e-17
Kwal_23.3660                                                           88   1e-17
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    89   1e-17
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    87   2e-17
Scas_721.100                                                           87   3e-17
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    87   3e-17
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    86   6e-17
Scas_591.10                                                            86   8e-17
Kwal_14.1868                                                           84   3e-16
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    83   5e-16
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    83   6e-16
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    82   1e-15
Scas_674.12d                                                           78   2e-14
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          75   2e-13
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    59   2e-08
Kwal_14.1287                                                           58   4e-08
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    55   4e-07
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    54   6e-07
Scas_573.9                                                             52   2e-06
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    50   8e-06
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              42   0.003
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         42   0.003
Kwal_34.16080                                                          34   0.43 
KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces c...    33   0.97 
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    33   1.1  
ACL033C [1016] [Homologous to ScYIL075C (RPN2) - SH] (304166..30...    32   2.9  
Sklu_2393.10 YIL162W, Contig c2393 16513-18165                         32   3.4  
Sklu_2029.2 , Contig c2029 2095-3891                                   32   3.7  
AGL004C [4307] [Homologous to ScYFL002C (SPB4) - SH] (715488..71...    31   4.1  
CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces c...    31   4.8  
Scas_588.16                                                            31   5.2  
KLLA0E04763g complement(429714..431624) similar to sgd|S0006383 ...    30   8.3  
YML091C (RPM2) [3880] chr13 complement(87123..90731) Bifunctiona...    30   8.4  
AAL069C [118] [Homologous to ScYDR295C (PLO2) - SH] (226816..228...    30   9.5  
KLLA0A04983g complement(445032..448787) similar to sp|P32790 Sac...    30   9.9  

>Scas_668.18
          Length = 875

 Score = 1773 bits (4592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/875 (97%), Positives = 856/875 (97%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60
           MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV
Sbjct: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60

Query: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120
           VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH
Sbjct: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120

Query: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM 180
           SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM
Sbjct: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM 180

Query: 181 IMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLGSSEE 240
           IMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLGSSEE
Sbjct: 181 IMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLGSSEE 240

Query: 241 DEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQ 300
           DEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQ
Sbjct: 241 DEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQ 300

Query: 301 NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELV 360
           NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELV
Sbjct: 301 NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELV 360

Query: 361 KWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQ 420
           KWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQ
Sbjct: 361 KWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQ 420

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
           LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP
Sbjct: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480

Query: 481 GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL 540
           GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL
Sbjct: 481 GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL 540

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNXXXX 600
           PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPN    
Sbjct: 541 PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNLINL 600

Query: 601 XXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 660
                          YNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQ
Sbjct: 601 DEEIDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 660

Query: 661 TLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 720
           TLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG
Sbjct: 661 TLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 720

Query: 721 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSC 780
           ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSC
Sbjct: 721 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSC 780

Query: 781 VVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTT 840
           VVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTT
Sbjct: 781 VVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTT 840

Query: 841 WNHLNHAALEKTNDHLLQNEFQHPDISYAFQYISH 875
           WNHLNHAALEKTNDHLLQNEFQHPDISYAFQYISH
Sbjct: 841 WNHLNHAALEKTNDHLLQNEFQHPDISYAFQYISH 875

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score = 1412 bits (3654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/898 (77%), Positives = 769/898 (85%), Gaps = 23/898 (2%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYK-TAKPRALSSEHEKE 59
           MARR+LPDRPPNGIG G+RPRLVPRPINVQ+S++ L+KPF+VPYK T  P A        
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60

Query: 60  VVQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRL 119
              V GR LRKRS TV YSGLDI++  A+ +   ++FSQ TKRRKDALSA RLA DPTRL
Sbjct: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120

Query: 120 HSIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGD 179
             I++TL+RSFTVPIKGY+QRHSLPLTLG KKKI  EPRPLHDPTDEFAIVLYDPSVDG+
Sbjct: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180

Query: 180 MIMHDNSQDVRNDKKD----STKEKGTDSKD---EETKTGSKKFAHPKLMTNGVRNKSLK 232
           MI+HD S D + ++      ST+EK   +K+   +E +   +   HP LMTNGVRNK L+
Sbjct: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240

Query: 233 ELLGSSEED-EAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAV 291
           ELLG SE   E KKKF +VPVVIDPKL KILRPHQVEGV+FLYRCVTGLVMKD+L+AEA 
Sbjct: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300

Query: 292 NTGI--------------VKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 337
           NT                 KTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK
Sbjct: 301 NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 360

Query: 338 RLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQA 397
           RLIDKCIIVCPSSLVNNWANEL+KWLGP TL+PLAVDGKKSS+  GN+TV++A+H+WAQA
Sbjct: 361 RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA 420

Query: 398 TGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRV 457
            GRNIVKPVLIISYETLRRNVDQL+NC+VGLMLADEGHRLKNGDSLTFTALDSI+CPRRV
Sbjct: 421 QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV 480

Query: 458 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL 517
           ILSGTPIQNDLSEYFALL+FSNPGLLG+R+EFRKNFE PILR RDAD+TD+EITKGE QL
Sbjct: 481 ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL 540

Query: 518 QKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVG 577
           QKLSTIVSKFIIRRTNDIL+KYLPCKYEHVIFVNLKP Q ++Y++L+KSR+V K+VKGVG
Sbjct: 541 QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVG 600

Query: 578 GTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAIL 637
           G+QPL+AIG+LKKLCNHPN                   YNM GSK+RDVQ ++S KF+IL
Sbjct: 601 GSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSIL 660

Query: 638 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFND 697
           ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCR KHYS+VRLDGTM+INKRQKLVDRFND
Sbjct: 661 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND 720

Query: 698 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 757
           PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF
Sbjct: 721 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 780

Query: 758 ISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHC 817
           ISTG+IEEKI+QRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ N+ TICETHETYHC
Sbjct: 781 ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC 840

Query: 818 KRCNAAGKQSVRSTAMLYGDPTTWNHLNHAALEKTNDHLLQNEFQHPDISYAFQYISH 875
           KRCNA GKQ  R+ AMLYGD TTWNHLNH ALEKTNDHLL+NE  + DIS+AFQYISH
Sbjct: 841 KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNEHHYNDISFAFQYISH 898

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score = 1217 bits (3148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/921 (66%), Positives = 721/921 (78%), Gaps = 72/921 (7%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60
           MARR+LPDRPPNGIG G RP L PR ++   ++ TL+KPFKVP+K  K     ++H K  
Sbjct: 1   MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFKVNK-----TDHAKRY 55

Query: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120
               G    +RS T +Y+ +D SS  +D+            +RKDALS SRL  +P+RL 
Sbjct: 56  ----GVRSSRRSQT-TYANMD-SSLDSDLHV----------KRKDALSLSRLNAEPSRLD 99

Query: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM 180
           +I  TL+RSFTVPIKGY+ RH++P+ LGTK K+++ PRPLHDPTDE AIVLYDP+VDGD+
Sbjct: 100 TIYSTLRRSFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGDI 159

Query: 181 I-MHDNSQDVRN---DKKDSTKEKGTDSKDEETKTGSKKFA----HPKLMTNGVRNKSLK 232
              H++ +  R    D K S K K ++S+D++ K  S   A    HPK+++NGV+NK+LK
Sbjct: 160 PEQHEDLESFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTLK 219

Query: 233 ELLGSSEEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAV- 291
           ELLGSSE D   KKFPNVPVVIDPKL KILRPHQVEGV+FLYRCVTGLVMKDFLDA+ V 
Sbjct: 220 ELLGSSE-DNTSKKFPNVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKTVL 278

Query: 292 -----------------NTG--------------IVKTEQN--NRGAYGCIMADEMGLGK 318
                             TG              ++K  +N  NRGAYGCIMADEMGLGK
Sbjct: 279 DSSSQSMEKADTQADSNITGSKSPVETDVSSLKDVIKINENSRNRGAYGCIMADEMGLGK 338

Query: 319 TLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKS 378
           TLQC+ALMWT+L+QGPQG+R IDKCIIVCPSSLVNNWANE+ KWLGPG+LS LA+DGKKS
Sbjct: 339 TLQCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLAIDGKKS 398

Query: 379 SLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLK 438
           SL +GN  VA++V  WA A GRNIVKPVLIISY+TLRRNV+QL+NC+VGLMLADEGHRLK
Sbjct: 399 SLNNGN--VADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLADEGHRLK 456

Query: 439 NGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPIL 498
           N DSLTFTALDSI CPRRVILSGTPIQNDLSEYFALLNFSNPGLLG+R++FRKNFELPIL
Sbjct: 457 NADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFRKNFELPIL 516

Query: 499 RSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKD 558
           +SRD+ +TDEE+T G+++L++LS IVSKFIIRRTN+IL+KYLPCKYEHVIF+NL PFQ+ 
Sbjct: 517 QSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIFINLTPFQQS 576

Query: 559 VYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNXXXXXXX---XXXXXXXXXXXX 615
           +Y   ++SR V K+VKG    QPLKAIG+LKKLCNHP+                      
Sbjct: 577 LYQHFIESRAVKKIVKG-DSNQPLKAIGLLKKLCNHPDLLELSEDIPGSEELIPDDYQSS 635

Query: 616 YNMQGSKSRDV-QPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHY 674
            + + S++R V Q  FS KF++L RFL+KIKTES+DKIVLISNYTQTLDLIEKMC + HY
Sbjct: 636 VDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDLIEKMCFSNHY 695

Query: 675 SSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPA 734
             +RLDGTM INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLIL+DPDWNPA
Sbjct: 696 GVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILLDPDWNPA 755

Query: 735 ADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSS 794
           ADQQALARVWRDGQKKDCFIYRFISTG+IEEKI+QRQSMKMSLSSCVVD KEDVERLFSS
Sbjct: 756 ADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDEKEDVERLFSS 815

Query: 795 DNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTTWNHLNHAALEKTND 854
           DNL+QLF+ + KTIC+THETY+CKRC   GKQ +++  MLYGD T+WNHLNH AL KTND
Sbjct: 816 DNLKQLFKLDTKTICDTHETYNCKRCK-NGKQILKAPVMLYGDATSWNHLNHDALAKTND 874

Query: 855 HLLQNEFQHPDISYAFQYISH 875
           HLL+NEF H DIS+AFQYISH
Sbjct: 875 HLLKNEFNHKDISFAFQYISH 895

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/929 (62%), Positives = 682/929 (73%), Gaps = 88/929 (9%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60
           MA+RKLPDRPPNG G G+RP + PR ++   + STL++PF+VP        L+SE  +  
Sbjct: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVP--------LNSERTRHG 52

Query: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120
            +   R  R+   T +  G       A  +EN +       +R DALS  R++ D  RL 
Sbjct: 53  ERYGVRATRRAVTTYAEEG------GARSEENDVG-----GKRIDALSEQRVSKDAQRLA 101

Query: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM 180
            IE TL+RSF+VPIKGY+ RH++PL LG K +++  PRPLHDPT+EFAIVLYDP+VDG++
Sbjct: 102 GIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEI 161

Query: 181 IMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFA-HPKLMTNGVRNKSLKELLGSSE 239
                        ++   +K  D  +EE    +++ A HP+ ++NG+RNK+L+ELLG+  
Sbjct: 162 --------PDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVT 213

Query: 240 EDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAV-------- 291
           E     KFP+VPVVIDP+L +ILRPHQVEGV+FLYRCVTGL MKDFLD +AV        
Sbjct: 214 E---TPKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQD 270

Query: 292 ---------------------------------------NTGIVKTEQNNRGAYGCIMAD 312
                                                  +     T ++NRGAYGCIMAD
Sbjct: 271 DGTGKDPGSKDSEPIVVEVLEETPTPTPTPTPTPSPEILDANAAMTRESNRGAYGCIMAD 330

Query: 313 EMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLA 372
           EMGLGKTLQCIALMWTLLRQG QG+  I+KCIIVCPSSLVNNWANE+VKWLGP  LSPLA
Sbjct: 331 EMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLA 390

Query: 373 VDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLAD 432
           +DG+KSSL++G  +VA++V  WA A GRN+VKPVLIISYETLRRNV+ L+ C VGLMLAD
Sbjct: 391 IDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLAD 448

Query: 433 EGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKN 492
           EGHRLKNGDSLTFT+LDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR++FRKN
Sbjct: 449 EGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKN 508

Query: 493 FELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNL 552
           FE+PILR RDAD+TD+EI  GE +L +LS IVSKFIIRRTNDILSKYLPCKYEH++FVNL
Sbjct: 509 FEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNL 568

Query: 553 KPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXX--- 609
            P QK +Y   ++SR+V K++KG G +QPLKAIG+LKKLCNHP+                
Sbjct: 569 SPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIP 627

Query: 610 --XXXXXXYNMQGSKSR-DVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIE 666
                   +N +G +S  +VQ   S KFAILERFL KIK ES+DKIVLISNYTQTLDLIE
Sbjct: 628 DDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIE 687

Query: 667 KMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLIL 726
           KMCR  HY  +RLDGTMTINKRQKLVD+FNDP G+EFIFLLSSKAGGCGINLIGANRLIL
Sbjct: 688 KMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLIL 747

Query: 727 MDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKE 786
           MDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TGSIEEKI QR SMKMSLSSCVV+ KE
Sbjct: 748 MDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKE 807

Query: 787 DVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTTWNHLNH 846
           DVERLFSS+NLR LFQ++  T      TYHCKRC   GKQ +++ AMLYGD TTWNHLNH
Sbjct: 808 DVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRCR-DGKQMIKAPAMLYGDATTWNHLNH 866

Query: 847 AALEKTNDHLLQNEFQHPDISYAFQYISH 875
            AL KTNDHLL+NE Q  DISY FQYISH
Sbjct: 867 DALLKTNDHLLRNEHQFNDISYVFQYISH 895

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/592 (83%), Positives = 534/592 (90%), Gaps = 6/592 (1%)

Query: 284 DFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC 343
           DFL+A      + K++ NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLI KC
Sbjct: 357 DFLEA------LKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC 410

Query: 344 IIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIV 403
           IIVCPSSLVNNWANELVKWLGP TLSPLAVDGKKSSLASG ++VAEA+ +WAQA GRNIV
Sbjct: 411 IIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIV 470

Query: 404 KPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTP 463
           KPVLIISY+TLRRNV QL+N +VGL+LADEGHRLKNGDSLTFTALDSINCPRRVILSGTP
Sbjct: 471 KPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTP 530

Query: 464 IQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTI 523
           IQNDLSEYFALLNFSNPGLLGTR+EFR+NFE+PILRSRDAD+TD ++  GE++LQ LS I
Sbjct: 531 IQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNI 590

Query: 524 VSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLK 583
           VSKFIIRRTNDILSKYLPCKYEHVIFVNL PFQK VY+ L+KSRD+ K+VKG GG+QPLK
Sbjct: 591 VSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLK 650

Query: 584 AIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHK 643
           AIGVLKKLCNHP+                   Y++   KSRDVQ QFSGKFAILERFLHK
Sbjct: 651 AIGVLKKLCNHPDLIKLDEELDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHK 710

Query: 644 IKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEF 703
           IKTESDDKIVLISNYTQTLDLIE+MCRN+HY+SVRLDGTM+INKRQKLVDRFNDPEGQEF
Sbjct: 711 IKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEF 770

Query: 704 IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSI 763
           IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTG+I
Sbjct: 771 IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTI 830

Query: 764 EEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAA 823
           EEKIYQRQSMKMSLSSCVVDAKEDVERLFS DNLRQLFQ+NDKTIC+THET+ CKRCN  
Sbjct: 831 EEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKH 890

Query: 824 GKQSVRSTAMLYGDPTTWNHLNHAALEKTNDHLLQNEFQHPDISYAFQYISH 875
           G+Q +R+ AMLYGD TTWNHLNH ALEKTNDHLL+NEF H DISYAFQYISH
Sbjct: 891 GQQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKNEFYHNDISYAFQYISH 942

 Score =  342 bits (876), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 217/296 (73%), Gaps = 17/296 (5%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60
           MARR+LPDRPPNGIG G+RPRLVPRPINV  SIS L+KPFKVP K+ + + + +  +   
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDLSR 60

Query: 61  VQVNGRILRKRSHTVSYSGLDISSA-AADVDEN---SLTFSQSTKRRKDALSASRLANDP 116
            +      R+RS TVSY+GLD+ S    D  EN    L      KRR DALSA RL  DP
Sbjct: 61  QRQL----RQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDP 116

Query: 117 TRLHSIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSV 176
           TRL +IE TLK+SF VPIKGY+QRHSLPLTLGTK K+I EPRPLHDPTDEFAIVLYDPSV
Sbjct: 117 TRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSV 176

Query: 177 DGDMIMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLG 236
           DG+MI+ D+++ V+N       +   D   +E +    K+ HPK+++NGV+NK+L+ELLG
Sbjct: 177 DGEMIIQDDTETVQN------VQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQELLG 230

Query: 237 SS---EEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAE 289
           +S     +  KKKF NVPVVIDPKL KILRPHQVEGVKFLYRCVTGLVMKDFLD +
Sbjct: 231 NSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQ 286

>Kwal_14.1537
          Length = 842

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/855 (62%), Positives = 614/855 (71%), Gaps = 78/855 (9%)

Query: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60
           MARRKLPDRPPNGIG G RP L PR ++   + +TL++PFKVP +  +    +       
Sbjct: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLE---PNCAANPAN 57

Query: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120
             +  R  R ++H       +++  A + + +         +R DALSA RL+ DP RL 
Sbjct: 58  AAIGKRTTRSKTHVY-----ELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLR 112

Query: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDG-- 178
            I+  L+RSFTVPIKGY+ RH++PL+LGTK KI++ PRPLHDPT+EFAIVLYDPSVDG  
Sbjct: 113 KIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPT 172

Query: 179 -DMIMHDNSQ-DVRNDKKDSTKEKGTDSKDE---ETKTGSKKFAHPKLMTNGVRNKSLKE 233
            ++++   SQ    +     +K +G+    +        S   +HPK ++NG+ NK+L+E
Sbjct: 173 PELLIQMRSQLPKSSSASALSKPRGSTRATQLSPTPPPPSPHPSHPKKLSNGLPNKTLRE 232

Query: 234 LLGSSEEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLD------ 287
           LLG  + DE   KF +VPVVIDP L KILRPHQVEGV+FLYRCVTGLVMKD+LD      
Sbjct: 233 LLGDRQVDE---KFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKDYLDQQALLQ 289

Query: 288 -AEAVNTGIVKTE----------------------------------------------- 299
            A+A  T   +T                                                
Sbjct: 290 NADAATTSKEQTPPADHLPSPPAELLPSPPADPAHTLTSDEKLPNQELDTPAPTDESSSE 349

Query: 300 -QNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 358
              NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK  IDKCIIVCPSSLVNNWANE
Sbjct: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409

Query: 359 LVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNV 418
           +VKWLG GTL+ L +DGKKSSL   N TVA+AV  WA A GR++VKPVLIISYETLRRNV
Sbjct: 410 IVKWLGKGTLASLPIDGKKSSL--NNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNV 467

Query: 419 DQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 478
           + L NC++GL+LADEGHRLKN +S TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS
Sbjct: 468 EHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 527

Query: 479 NPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSK 538
           NPGLLGTRSEFR+NFE PIL SRDAD+TD EI KG E+LQ LSTIVSKFIIRRTNDILSK
Sbjct: 528 NPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSK 587

Query: 539 YLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVK-GVGGTQPLKAIGVLKKLCNHPNX 597
           YLPCKYEHV+FVNLKPFQ+ VY  +LK RDV   VK G   +QPLK IG LKKLCNHP+ 
Sbjct: 588 YLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDL 647

Query: 598 XXXXXXXXXXXXXXXXXXYNMQGSKS--RDVQPQFSGKFAILERFLHKIKTESDDKIVLI 655
                              N   SK    +VQ  +SGKF+IL RFLHKIKTESDDKIV+I
Sbjct: 648 LQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVII 707

Query: 656 SNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 715
           SNYTQTLD+IE+MCR   Y  VRLDGTMTINKRQKLVDRFND EGQEFIFLLSSKAGGCG
Sbjct: 708 SNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCG 767

Query: 716 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKM 775
           INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TG+IEEKIYQRQSMKM
Sbjct: 768 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKM 827

Query: 776 SLSSCVVDAKEDVER 790
           SLSSCVVD KEDVER
Sbjct: 828 SLSSCVVDEKEDVER 842

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  409 bits (1052), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 239/612 (39%), Positives = 354/612 (57%), Gaps = 64/612 (10%)

Query: 250 VPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCI 309
           V V++DP L+K LRPHQ EGVKFLY CV  +V       +   + I++ + + +G   C+
Sbjct: 266 VSVIVDPLLSKTLRPHQREGVKFLYDCVMNMV-----HTKGDESMILERDDDIKG---CL 317

Query: 310 MADEMGLGKTLQCIALMWTLLRQGP-------QGKRL---IDKCIIVCPSSLVNNWANEL 359
           +ADEMGLGKTL  I L+WTLL+Q P       +G  L   I K +IVCP +L+ NW  E 
Sbjct: 318 LADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKKEF 377

Query: 360 VKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-----PVLIISYETL 414
            KWL    +  L       +L S NS   +      +A  R+ +K      VLI+ YE L
Sbjct: 378 KKWLPMNRIGVL-------TLHSRNSPTED------KAQVRSFLKVPRTYQVLIVGYEKL 424

Query: 415 RRNVDQLRNC--DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 472
               D+L+N   ++ L++ DEGHRLKN DS     L S++  ++++LSGTPIQNDL E++
Sbjct: 425 LSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFY 484

Query: 473 ALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEE--ITKGEEQLQKLSTIVSKFIIR 530
            +++F NPG+LG+   F++ + LPI RSRD ++   +  + +G  +  +L  I  +FI+R
Sbjct: 485 TIIDFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILR 544

Query: 531 RTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKK 590
           RTN+IL +YLP + + +IF      Q + +H++L    +N     +     L  I + KK
Sbjct: 545 RTNEILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLN--FSNMTFNSSLGLITLFKK 602

Query: 591 LCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQF-SGKFAILERFLHKIKTESD 649
           +CN                        +   ++     +F SGK  IL   LH++KT++D
Sbjct: 603 ICNSTRLIKTDPYYEE----------RLSQVQTSSTSGKFTSGKLRILLSLLHELKTKTD 652

Query: 650 DKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRF-NDPEGQEFIFLLS 708
           +K+V+ISNYTQTLD+IE  C ++ Y+S RLDG+     R ++V  F NDP    F+FLLS
Sbjct: 653 EKVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNNDPSI--FVFLLS 710

Query: 709 SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIY 768
           +K+GG G+NLIGA+RL+L D DWNP+ D QA++R+ RDGQ++ CFIYR ++TG I+EKI 
Sbjct: 711 AKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKIL 770

Query: 769 QRQSMKMSLSSCVVDAKEDVER----LFSSDNLRQLFQYNDKTICETHETYHCKRCNAAG 824
           QRQ MK++LS   +D+  D  +    LF  + L+ LF  N  T+  TH+      CN +G
Sbjct: 771 QRQLMKIALSKKFLDSATDQSKNDDDLFQQEELKDLFTINLSTLSNTHDLI----CNCSG 826

Query: 825 KQSVRSTAMLYG 836
           +  V     + G
Sbjct: 827 EVEVLEEEEITG 838

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  382 bits (980), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 234/608 (38%), Positives = 344/608 (56%), Gaps = 61/608 (10%)

Query: 250 VPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCI 309
           V V++DP L K LRPHQ EGVKF+Y C+ GL      + +   T      +N+    GC+
Sbjct: 250 VDVIVDPLLGKFLRPHQREGVKFMYDCLMGLARPTIENPDIDCTTKSLVLENDSDISGCL 309

Query: 310 MADEMGLGKTLQCIALMWTLLRQGPQGKR------------LIDKCIIVCPSSLVNNWAN 357
           +AD+MGLGKTL  I L+WTL+RQ P   +            L  K ++VCP +L+ NW  
Sbjct: 310 LADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWKR 369

Query: 358 ELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-----PVLIISYE 412
           E  KWL    +  L       +L+S NS   + +        RN +K      VLII YE
Sbjct: 370 EFGKWLNLSRIGVL-------TLSSRNSPDMDKMAV------RNFLKVQRTYQVLIIGYE 416

Query: 413 TLRRNVDQLRNCD--VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSE 470
            L    ++L      + +++ DEGHRLKNG S     L S++  R+++L+GTPIQNDL+E
Sbjct: 417 KLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNE 476

Query: 471 YFALLNFSNPGLLGTRSEFRKNFELPILRSRD-ADSTDEEI-TKGEEQLQKLSTIVSKFI 528
           +F +++F NPG+LG+ + F++ F +PI R+RD A+  +EE+  KGEE+ +++  I  +FI
Sbjct: 477 FFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFI 536

Query: 529 IRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGG----TQPLKA 584
           +RRTN IL KYLP K + ++F   KP+ +    ++L  +D+ +  +   G    +  L  
Sbjct: 537 LRRTNAILEKYLPPKTDIILFC--KPYSQ----QILAFKDILQGARLDFGQLTFSSSLGL 590

Query: 585 IGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKI 644
           I +LKK+CN P                       Q S SR +    SGK  +L   L  I
Sbjct: 591 ITLLKKVCNSPGLVGSDPYYKSHIKDTQS-----QDSYSRSLN---SGKLKVLMTLLEGI 642

Query: 645 KTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFI 704
           +  + +K+V++SNYTQTLD+IE +      S  RLDG++   +R  +V  FN      F 
Sbjct: 643 RKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNPAI-FG 701

Query: 705 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
           FLLS+K+GG G+NL+G +RLIL D DWNP+ D QA++R+ RDGQKK CFIYR ++TG I+
Sbjct: 702 FLLSAKSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCID 761

Query: 765 EKIYQRQSMKMSLS------SCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCK 818
           EKI QRQ MK SLS      S + + +   + LF+ ++L+ LF  +  T   TH+   C 
Sbjct: 762 EKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSVHTDTKSNTHDLI-CS 820

Query: 819 RCNAAGKQ 826
            C+  G++
Sbjct: 821 -CDGLGEE 827

>Scas_718.40
          Length = 926

 Score =  381 bits (979), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 236/610 (38%), Positives = 339/610 (55%), Gaps = 64/610 (10%)

Query: 249 NVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGC 308
           +V V++DP L K+LRPHQ EGVKF+Y CV GL   +  + +  NTG     + +    GC
Sbjct: 246 DVDVIVDPLLGKLLRPHQREGVKFMYDCVMGLAT-NHQETDEDNTGKSLILEKDSDIGGC 304

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKR------------LIDKCIIVCPSSLVNNWA 356
           ++ADEMGLGKTL  I L+WTLL+Q P  K             L  K ++VCP +L+ NW 
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 357 NELVKWLGPGTLSPLAVDGKKSSLASGNSTVAE--AVHSW--AQATGRNIVKPVLIISYE 412
            E  KWL    +  L       +L+S N+   +  AV ++   Q T +     VL+I YE
Sbjct: 365 REFAKWLNLNRIGIL-------TLSSRNTPEMDKTAVKNFLRVQRTFQ-----VLVIGYE 412

Query: 413 TLRRNVDQLRNCD--VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSE 470
            L    ++L      + L++ DEGHRLKNG S     L ++   R+++LSGTPIQNDL+E
Sbjct: 413 KLLSVSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNE 472

Query: 471 YFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEE--ITKGEEQLQKLSTIVSKFI 528
           ++ +++F NPG+LG+   F+K F  PI R RD ++   E  I  GE + +++  I  KF 
Sbjct: 473 FYTIIDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFT 532

Query: 529 IRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVL 588
           +RRTN ILSKYLP K + ++F      Q   ++ +L    ++     +     L  I + 
Sbjct: 533 LRRTNAILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRID--FANLSFNSSLGLITLF 590

Query: 589 KKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQF-----SGKFAILERFLHK 643
           KK+CN P                    Y  +      +Q ++     SGK  IL   L K
Sbjct: 591 KKICNSP------------TLIGDDSYYQSKIRPDGVIQERYDRSLNSGKLKILMTLLEK 638

Query: 644 IKTES-DDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFN-DPEGQ 701
           IK  + ++K+V++SNYTQTLD+I+ +  +    S RLDG+    +R  +V+ FN +P   
Sbjct: 639 IKGNTNNEKVVIVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPS-- 696

Query: 702 EFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTG 761
            F FLLS+K+GG G+NLIGA+RLIL D DWNP+ D QA++R+ RDGQKK C+IYR I+TG
Sbjct: 697 IFAFLLSAKSGGVGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTG 756

Query: 762 SIEEKIYQRQSMKMSLSSCVVDAKEDVER------LFSSDNLRQLFQYNDKTICETHETY 815
            I+EKI QRQ MK SLS   +D+     +      LF+ ++L+ LF   + T   TH+  
Sbjct: 757 CIDEKILQRQLMKHSLSKKFLDSSYTTGKTGSNDDLFTKEDLKDLFTIMETTKSNTHDLI 816

Query: 816 HCKRCNAAGK 825
            C  C   GK
Sbjct: 817 -CD-CEGTGK 824

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  379 bits (974), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 227/603 (37%), Positives = 335/603 (55%), Gaps = 58/603 (9%)

Query: 250 VPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCI 309
           V VV+DP L+K LR HQ  G+KF+Y CV GL       +E  +   V   + +    GC+
Sbjct: 241 VEVVVDPILSKKLRQHQRTGIKFMYDCVRGLAR-----SEKDDDRTVMILEYDSDVKGCL 295

Query: 310 MADEMGLGKTLQCIALMWTLLRQGPQG------------KRLIDKCIIVCPSSLVNNWAN 357
           +ADEMGLGKT   IAL+WTLL+Q P+             + +  K ++VCP +L+ NW  
Sbjct: 296 LADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWKK 355

Query: 358 ELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-----PVLIISYE 412
           E +KWL    +  L +  K +     N               RN ++      VLI+ YE
Sbjct: 356 EFIKWLPMNRIGILTLSSKNTPEKDKNDV-------------RNFLRVQRTYQVLILGYE 402

Query: 413 TLRR---NVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLS 469
            L      +DQ ++  + L++ DEGHRLKN  S     L  +   R+VIL+GTPIQNDL+
Sbjct: 403 KLLNVFSELDQAKS-KLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLN 461

Query: 470 EYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADS--TDEEITKGEEQLQKLSTIVSKF 527
           E++ ++NF NPG+LGT + F++ +  PI R+RD ++   D+ ++ GE + Q L  I  KF
Sbjct: 462 EFYTIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKF 521

Query: 528 IIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGV 587
           I+RRT+ I++ YLP + + V+F      Q D ++++L    V+   + +     L  I +
Sbjct: 522 ILRRTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVD--FQNMSFNSSLGLITL 579

Query: 588 LKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTE 647
            KK+CN P+                    N      R  Q   SGK  +L   LH+I   
Sbjct: 580 FKKICNSPSLVSSDSYFQSK--------VNGGTPALRIAQSTTSGKLKVLMSLLHQIAHR 631

Query: 648 SD-DKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFL 706
           SD +K+V+ISNYTQTLD+I  +  +   S +RLDG+    +R  +V+ FN  +   F FL
Sbjct: 632 SDNEKVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQ-TIFGFL 690

Query: 707 LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEK 766
           LS+K+GG G+NL+GA+RLIL D DWNP+ D QA++R+ RDGQKK CFIYR ++TG I+EK
Sbjct: 691 LSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEK 750

Query: 767 IYQRQSMKMSLSSCVVDAKED---VERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAA 823
           I+QRQ MK +LS   +D   D    + +F  ++L+ LF     T+  TH+   C  C  +
Sbjct: 751 IFQRQLMKNNLSKKFLDDHCDDKSSDNVFEQEDLKDLFSVQSGTLSNTHDLL-CS-CEGS 808

Query: 824 GKQ 826
           G++
Sbjct: 809 GEE 811

>Kwal_27.10513
          Length = 900

 Score =  378 bits (970), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 228/607 (37%), Positives = 336/607 (55%), Gaps = 64/607 (10%)

Query: 252 VVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKD-FLDAEAVNTGIVKTEQNNRGAYGCIM 310
           VV+DP L+K LRPHQ  GVKF+Y C+ GL     + D    +T + +T +      GC++
Sbjct: 241 VVVDPILSKHLRPHQRIGVKFMYDCILGLSRPSCYEDDGTFSTKLKRTNE----IQGCLL 296

Query: 311 ADEMGLGKTLQCIALMWTLLRQGP--------------QGKRLIDKCIIVCPSSLVNNWA 356
           ADEMGLGKTL  I L+WTLL+Q P              QG  L +K ++VCP +L+ NW 
Sbjct: 297 ADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQG--LCNKILVVCPVTLIGNWK 354

Query: 357 NELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-----PVLIISY 411
            E  KWL    +  L +  K ++                + T RN ++      VL+I Y
Sbjct: 355 REFSKWLNVNRIGILTLSSKSNAEKD-------------KLTVRNFLRVQRTYQVLVIGY 401

Query: 412 ETLRRNVDQLRNCD--VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLS 469
           E L    ++L      + L++ DEGHRLKNG S T  A+ S+  PR+++L+GTPIQNDL+
Sbjct: 402 EKLLSVTEELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLA 461

Query: 470 EYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEIT--KGEEQLQKLSTIVSKF 527
           E+F + +F N G+LGT S+F+++F  PI R+RD ++    +   KG ++ Q+L  I   F
Sbjct: 462 EFFTIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNF 521

Query: 528 IIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGV 587
            +RRT + +SK+LP K + V+F      Q D + + L +  ++     +     L  I +
Sbjct: 522 TLRRTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLD--FSRLTFNSSLGLITL 579

Query: 588 LKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTE 647
            KK+CN P+                     ++ +    +    SGK  +L   L  ++  
Sbjct: 580 FKKICNSPSLISQDSYYLE----------TIKPNSEVKISAPDSGKLRVLMALLDNLRKL 629

Query: 648 S-DDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFL 706
           S  +K+V++SNYTQTLD+I+ M  +   S  RLDG+     R K+V+ FN      F FL
Sbjct: 630 SPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPSI-FAFL 688

Query: 707 LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEK 766
           LS+K+GG G+NLIGA+RLIL D DWNPA D QA++R+ RDGQK++C+IYR ++TG I+EK
Sbjct: 689 LSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEK 748

Query: 767 IYQRQSMKMSLSSCVVDAKEDV-----ERLFSSDNLRQLFQYNDKTICETHETYHCKRCN 821
           I+QRQ  K SLSS  +    D      + LF S++L+ LF  +  T   TH+   C  C 
Sbjct: 749 IFQRQLAKTSLSSKFMGDSADSNTESGDDLFGSEDLKDLFTVHATTSSNTHDLI-CS-CQ 806

Query: 822 AAGKQSV 828
             G+ +V
Sbjct: 807 GLGQPAV 813

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  369 bits (947), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/604 (37%), Positives = 340/604 (56%), Gaps = 57/604 (9%)

Query: 250 VPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCI 309
           V +++DP L K+LR HQ  GVKF+Y C+ GL     L AE+ +    + E+++    GCI
Sbjct: 255 VDIIVDPLLCKMLRNHQRIGVKFMYDCLLGLETN--LTAESTDDKSCRLERDS-DIKGCI 311

Query: 310 MADEMGLGKTLQCIALMWTLLRQGPQGKR------------LIDKCIIVCPSSLVNNWAN 357
           +AD+MGLGKTL  I L+WTLL+Q P   +            +I K +IVCP +L+ NW  
Sbjct: 312 LADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWKR 371

Query: 358 ELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-----PVLIISYE 412
           E  KWLG   +  L ++ K +                 + + RN +K      VLI+ YE
Sbjct: 372 EFKKWLGLNRIGILTLNPKNNV-------------DMDKISVRNFIKVNRTYQVLILGYE 418

Query: 413 -TLRRNVDQLRNCD-VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSE 470
             L    + L+  D + L++ DEGHRLKNG S     L S++  ++VIL+GTPIQNDL+E
Sbjct: 419 KVLTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNE 478

Query: 471 YFALLNFSNPGLLGTRSEFRKNFELPILRSRDADS--TDEEITKGEEQLQKLSTIVSKFI 528
           +F +++F NPG+LGT + F+K +  PI R+RD ++    + I +GEE+  +L     +FI
Sbjct: 479 FFTIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFI 538

Query: 529 IRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVL 588
           +RR+N+ILSK+LP K + ++F      Q   +  ++++  V+  +  +     L  I ++
Sbjct: 539 LRRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVD--MNNITFNTSLGLINLM 596

Query: 589 KKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTES 648
           KK+CN P+                    N   S         SGK  +L   L +IK  S
Sbjct: 597 KKVCNSPSLLCNDPYYQSNVDSNIFTVSNKSNS---------SGKLTVLLELLLEIKATS 647

Query: 649 D-DKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLL 707
             +K+V++SNYTQ+LD+I+ +  +   S+ RLDG     +R  LV+ FN+     F FLL
Sbjct: 648 PMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLL 706

Query: 708 SSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKI 767
           S+KAGG G+NLIGA+RL+L D DWNPA D QA++R+ R+GQK+ C+IYR I+TG I+EKI
Sbjct: 707 SAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKI 766

Query: 768 YQRQSMKMS-----LSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNA 822
            QRQ MK +     LSS   D     + LF   +L+ LF  +  T   TH+   C RC+ 
Sbjct: 767 LQRQLMKHNLTRKFLSSNTSDTGSANDDLFDKSDLKDLFTIHQNTKSNTHDLI-C-RCDG 824

Query: 823 AGKQ 826
            G++
Sbjct: 825 LGEE 828

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  283 bits (723), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 218/689 (31%), Positives = 333/689 (48%), Gaps = 121/689 (17%)

Query: 204 SKDEETKTGSKKFAHPKLMTNG------------VRNKSLKELLGSSEE-DEAKKKFPNV 250
           SKD+E      +FAH + + +G            ++++S K  L   E   E +K  P +
Sbjct: 219 SKDDEISVPDTRFAHGQTLDDGDELIYQKRLRKWIKHRSSKRTLDKHEHLPEWQKPHPEI 278

Query: 251 P-------VVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNR 303
           P         I  ++  +L  +Q  GV++LY                         Q  R
Sbjct: 279 PDAKLNNEFKIPGEIFSLLFNYQKTGVQWLYELF----------------------QQRR 316

Query: 304 GAYGCIMADEMGLGKTLQCIALMWTL----LRQGPQGKRLIDKCIIVCPSSLVNNWANEL 359
           G    I+ DEMGLGKT+Q  A +  L    L  GP         +IVCP++++  W NE+
Sbjct: 317 GG---IIGDEMGLGKTIQVTAFLAALHHSNLLSGP--------VLIVCPATVMKQWCNEI 365

Query: 360 VKWLGPGTLSPLAVDGK----KSSLASG---NSTVAEAV-----HSWAQA--------TG 399
            +W  P     L   G     KS+L      N  +   +     H +  A        TG
Sbjct: 366 HQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLKSKVETG 425

Query: 400 ---RNIVKPV------LIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDS 450
              +N++  V      +I +Y  LR + D+L N +    + DEGH+++N DS        
Sbjct: 426 MHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKK 485

Query: 451 INCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEI 510
           + C  R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F  PI     A++T+ ++
Sbjct: 486 LKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQV 545

Query: 511 TKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVN 570
             G      L  ++S +++RR    ++K LP K E V+F  L  FQ+  Y   L S +++
Sbjct: 546 QTGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSDELS 605

Query: 571 KMVKGVGGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQF 630
           + +KG G    L  I +L+K+CNHP+                   Y    S   D  P+ 
Sbjct: 606 Q-IKG-GKRHVLYGIDILRKICNHPD--------------LLDRDYIKNTSGYGD--PKR 647

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKH-----YSSVRLDGTMTI 685
           SGK  ++++ L   K+E   K +L +   Q LD++E+  + K         +R+DGT +I
Sbjct: 648 SGKMQVVKQLLKLWKSEG-HKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGTTSI 706

Query: 686 NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 745
             RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 707 QVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARERAWR 764

Query: 746 DGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQ-- 802
            GQK++  IYR + +G+IEEKIY RQ  K  L + V+ D K+  +R F +  L+ LF   
Sbjct: 765 IGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLSDPKQ--KRFFKTKELQDLFSLG 822

Query: 803 ----YNDKTICETHETYHCKRCNAAGKQS 827
               Y+ +T+ E  E +  K  + + K S
Sbjct: 823 GEQGYSTETLNEEVEKHTKKLKDESTKDS 851

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  281 bits (718), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 189/567 (33%), Positives = 290/567 (51%), Gaps = 67/567 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKW---- 362
           G I+ DEMGLGKT+Q I+ + +L   G     L    +IVCP++++  W NE   W    
Sbjct: 305 GGIIGDEMGLGKTIQIISFLASLHHSG----MLDGPILIVCPATVMKQWCNEFHTWWPPF 360

Query: 363 -------LGPGT----------LSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK- 404
                  +G G           L  + ++      +  + T ++   S    +  N+ K 
Sbjct: 361 RAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTKS-TMESKLNLTKL 419

Query: 405 --------PVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRR 456
                    VLI +Y  LR + D+L     G  + DEGH+++N DS        +    R
Sbjct: 420 VDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDISLTCKQLKTSNR 479

Query: 457 VILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQ 516
           VILSGTPIQN+L+E ++L +F  PG LGT   F++ F +PI     A++T+ ++  G + 
Sbjct: 480 VILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYANATNIQVQTGYKC 539

Query: 517 LQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGV 576
              L  ++S +++RR    ++K LP K E V+F  L  +Q++ Y + L S D+ K+    
Sbjct: 540 AVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQFLNSGDLVKIKN-- 597

Query: 577 GGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAI 636
           G  Q L  I +L+K+CNHP+                    +M+ S+     P+ SGK  +
Sbjct: 598 GKRQVLYGIDILRKICNHPDILVR----------------DMRHSEESYGDPKRSGKMQV 641

Query: 637 LERFLHKIKTESDDKIVLISNYTQTLDLIEKMC--RNKHYSS---VRLDGTMTINKRQKL 691
           +++ L K+  E   K +L +   Q LD++EK    R+   SS   +R+DGT  I  RQ L
Sbjct: 642 VKQLL-KLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNIAARQHL 700

Query: 692 VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 751
           VD+FN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK++
Sbjct: 701 VDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRE 758

Query: 752 CFIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQYNDKTICE 810
             IYR +  GSIEEKIY RQ  K  L++ ++ D K+  +R F  + L+ LF    +    
Sbjct: 759 VTIYRLMIAGSIEEKIYHRQIFKQFLTNKILKDPKQ--KRFFKMNELQDLFSLGGE---R 813

Query: 811 THETYHCKRCNAAGKQSVRSTAMLYGD 837
            HE        +     +R+T  L GD
Sbjct: 814 GHENQEFADEISHQTDQMRNTKSLEGD 840

>Scas_549.4
          Length = 1079

 Score =  274 bits (700), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 178/530 (33%), Positives = 273/530 (51%), Gaps = 62/530 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           G I+ DEMGLGKT+Q IA + +L   G     L    +IVCP++++  W NEL  W  P 
Sbjct: 324 GGIIGDEMGLGKTIQIIAFLASLHHSG----LLNGPVLIVCPATVMKQWCNELHHWWPPL 379

Query: 367 TLSPLAVDGKKSSL---------------ASGNSTVAEAVHSWAQATG--------RNIV 403
               L   G   S                A+ N    E   + ++           ++++
Sbjct: 380 RTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTKASLESTFNIQSLI 439

Query: 404 KPVL------IISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRV 457
             V+      I +Y  LR + +QL   +    + DEGH+++N DS        I  P R+
Sbjct: 440 DKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDISLTCKKIKTPNRI 499

Query: 458 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL 517
           ILSGTPIQN+L E ++L +F  PG LGT   F++ F +PI     A++T+ ++  G +  
Sbjct: 500 ILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYANATNIQVQTGVKCA 559

Query: 518 QKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVG 577
             L  ++S +++RR    ++K LP K E V+F  L  +QK+ Y   L S ++ + ++G G
Sbjct: 560 TALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEFLNSNELTQ-IRG-G 617

Query: 578 GTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAIL 637
               L  I +L+K+CNHP+                               P+ SGK  ++
Sbjct: 618 RRHVLYGIDILRKICNHPDLLEREERQYETDYG----------------NPKRSGKMQVV 661

Query: 638 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKH-----YSSVRLDGTMTINKRQKLV 692
           ++ L     E   K +L +   Q LD++E+  + K         +R+DGT  I+KRQ LV
Sbjct: 662 KQLLLLWHKEGH-KTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGTSNISKRQGLV 720

Query: 693 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 752
           D+FN+ +    +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK++ 
Sbjct: 721 DQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARERAWRIGQKREV 778

Query: 753 FIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 801
            IYR + +GSIEEKIY RQ  K  L++ ++ D K+  +R F  + LR LF
Sbjct: 779 SIYRLMVSGSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKMNELRDLF 826

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  270 bits (691), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 183/549 (33%), Positives = 276/549 (50%), Gaps = 72/549 (13%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGP- 365
           G I+ DEMGLGKT+Q IA + TL       ++L    ++VCP++++  W NE   W  P 
Sbjct: 285 GGIIGDEMGLGKTIQIIAFLATL----HHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPF 340

Query: 366 --------------GTLSPLAVDGKKSSLASGNSTVAEAVHSWAQAT-----GRNIVKPV 406
                         GT  P   + +K  + S   T     +   + T      R  VK +
Sbjct: 341 RAVILHSIGAGMNKGTQIP-EEELEKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKL 399

Query: 407 L----------IISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRR 456
           L          I +Y  LR + + L N   G  + DEGH+++N DS        +    R
Sbjct: 400 LEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNR 459

Query: 457 VILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQ 516
           +ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI     A++++ ++  G + 
Sbjct: 460 IILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKC 519

Query: 517 LQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGV 576
              L  ++S +++RR    ++K LP K E V+F  L  +QK  Y   L S ++ K+ K  
Sbjct: 520 AVALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEFLHSDELMKIRK-- 577

Query: 577 GGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQ------PQF 630
           G  Q L  I +L+K+CNHP+                    +++  K  D +      P  
Sbjct: 578 GKRQVLYGIDILRKICNHPD------------------LLDLKRKKMNDYEDADYGNPAR 619

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNK-----HYSSVRLDGTMTI 685
           SGK  ++++ L    ++   K +L +   Q LD++++    K         +R+DGT  I
Sbjct: 620 SGKMQVVKQLLLLWHSQG-HKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMDGTTNI 678

Query: 686 NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 745
             RQ LVD+FN+      +FLL+++ GG GINL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 679 GSRQSLVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQARERAWR 736

Query: 746 DGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQYN 804
            GQK++  IYR +  GSIEEKIY RQ  K  LS+ ++ D K+  +R F  ++L  LF   
Sbjct: 737 IGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSNKILKDPKQ--KRFFKMNDLHDLFTLG 794

Query: 805 DKTICETHE 813
                ET E
Sbjct: 795 GDNGYETEE 803

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  269 bits (688), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 274/533 (51%), Gaps = 62/533 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKW---- 362
           G I+ DEMGLGKT+Q ++ + +L   G    +L    ++VCP++++  W +E   W    
Sbjct: 283 GGIVGDEMGLGKTIQIVSFLASLHHSG----KLKGPVLVVCPATVMKQWCSEFQTWWPPF 338

Query: 363 -------LGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGR------------NIV 403
                  +G G ++   +  ++           E  +      GR            ++V
Sbjct: 339 RAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLV 398

Query: 404 KPV------LIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRV 457
           + V      LI +Y  L+ + D L + +    + DEGH+++N D+        +  P R+
Sbjct: 399 QKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRI 458

Query: 458 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL 517
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI     A++T+ ++  G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQTGYKCA 518

Query: 518 QKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVG 577
             L  ++S +++RR  + ++K LP K E V+F  +  FQK+ Y + L S D+ K+  G  
Sbjct: 519 VALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDMIKIKNGR- 577

Query: 578 GTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAIL 637
             Q L  I +L+K+CNHP+                    + +  +     P+ SGK  ++
Sbjct: 578 -RQVLYGIDILRKICNHPDLLER----------------DFRKHEPSFGDPRRSGKMTVI 620

Query: 638 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKH-----YSSVRLDGTMTINKRQKLV 692
           ++ L   K +   K +L +   Q LD++E    +K         +R+DGT  I  RQ LV
Sbjct: 621 KQLLLTWKKQG-HKALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQALV 679

Query: 693 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 752
           DRFN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK+D 
Sbjct: 680 DRFNN--GPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRDV 737

Query: 753 FIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQYN 804
            IY  +  GSIEEKIY RQ  K  L++ V+ D K+  +R F  + L  LF + 
Sbjct: 738 TIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQ--KRFFKMNELHDLFSFG 788

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  269 bits (687), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 200/620 (32%), Positives = 297/620 (47%), Gaps = 94/620 (15%)

Query: 237 SSEEDEAKKKFPNVPVVIDPKLTKILR-PHQVEGVKFLYR--CVTGLVMKDFLDAEAVNT 293
           SS+  E ++  PN+P   D KL    + P ++  + F Y+  CV  L             
Sbjct: 265 SSDLPEWRRPHPNIP---DAKLNSQFKIPGEIYSLLFNYQKTCVQWLY------------ 309

Query: 294 GIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVN 353
              +  Q N G    I+ DEMGLGKT+Q IA +  L   G     L    +IVCP++++ 
Sbjct: 310 ---ELYQQNCGG---IIGDEMGLGKTIQVIAFIAALHHSGL----LTGPVLIVCPATVMK 359

Query: 354 NWANELVKW-----------LGPGT------------LSPLAVDGKKSSLAS---GNSTV 387
            W NE   W           +G G             L  L ++ K S  +     NST 
Sbjct: 360 QWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTR 419

Query: 388 AEAVHSWAQATGRNIVKPV-----LIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDS 442
            +     +    + I K V     LI +Y  LR + D+L        + DEGH+++N DS
Sbjct: 420 TKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDS 479

Query: 443 LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRD 502
                   +    R+ILSGTPIQN+L+E ++L +F  PG LGT   F++ F +PI     
Sbjct: 480 EISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGY 539

Query: 503 ADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHR 562
           A++T+ ++  G +    L  ++S +++RR    ++K LP K E V+F  L  +Q+  Y  
Sbjct: 540 ANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLE 599

Query: 563 LLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSK 622
            L S D+N++  G      L  I +L+K+CNHP+                          
Sbjct: 600 FLHSSDLNQIQNGKRNV--LFGIDILRKICNHPDLLDRDTKRHNPDYG------------ 645

Query: 623 SRDVQPQFSGKFAILERFL---HKIKTESDDKIVLISNYTQTLDLIEKMCRNK-----HY 674
                P+ SGK  ++++ L   HK       K +L +   Q LD++E+    K     H 
Sbjct: 646 ----DPKRSGKMQVVKQLLLLWHK----QGYKALLFTQSRQMLDILEEFISTKDPDLSHL 697

Query: 675 SSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPA 734
           + +R+DGT  I  RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+
Sbjct: 698 NYLRMDGTTNIKGRQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPS 755

Query: 735 ADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFS 793
            D QA  R WR GQK++  IYR +  GSIEEKIY RQ  K  L++ ++ D K+  +R F 
Sbjct: 756 TDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQ--KRFFK 813

Query: 794 SDNLRQLFQYNDKTICETHE 813
              L  LF    +    T E
Sbjct: 814 IHELHDLFSLGGENGYSTEE 833

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  243 bits (621), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 178/601 (29%), Positives = 289/601 (48%), Gaps = 106/601 (17%)

Query: 233 ELLGSSEEDEAKKKFPNVPVVIDPKLTKI--LRPHQVEGVKFLYRCVTGLVMKDFLDAEA 290
           EL+   EE+       ++ V   P   K   LR +QV+G+ +L                 
Sbjct: 153 ELMADEEEEIVDTYQEDIFVSESPSFVKSGKLRDYQVQGLNWLISL-------------- 198

Query: 291 VNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLR----QGPQGKRLIDKCIIV 346
                      +      I+ADEMGLGKTLQ I+ +  L      +GP         +I+
Sbjct: 199 -----------HENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGP--------FLII 239

Query: 347 CPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKP- 405
            P S ++NW  E +KW     ++ L + G K        T A+ V        RNI+   
Sbjct: 240 VPKSTLDNWRREFLKW--TPNVNVLVLHGDKD-------TRADIV--------RNIILEA 282

Query: 406 ---VLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGT 462
              VLI SYE + R  + L+      ++ DE HR+KN  S     +       R++++GT
Sbjct: 283 RFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGT 342

Query: 463 PIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLST 522
           P+QN+L E +ALLNF  P + G    F + FE      ++    D+EI      +Q+L +
Sbjct: 343 PLQNNLHELWALLNFLLPDIFGDSELFDEWFE------QNNSEQDQEIV-----IQQLHS 391

Query: 523 IVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGV----GG 578
           +++ F++RR    + K L  K E  ++V +   Q   Y  LL+ +D++ +   V    G 
Sbjct: 392 VLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLE-KDIDAVNGAVGKREGK 450

Query: 579 TQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQF-SG 632
           T+ L  +  L+K CNHP                    Y  +G++     + D    F SG
Sbjct: 451 TRLLNIVMQLRKCCNHP--------------------YLFEGAEPGPPYTTDEHLIFNSG 490

Query: 633 KFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLV 692
           K  IL++ L ++K E   ++++ S  ++ LD++E  C  + +   R+DG+ +  +R + +
Sbjct: 491 KMIILDKLLKRLK-EKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAI 549

Query: 693 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 752
           D +N P  ++F+FLL+++AGG GINL+ A+ +IL D DWNP AD QA+ R  R GQKK  
Sbjct: 550 DEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQV 609

Query: 753 FIYRFISTGSIEEKIYQRQSMKMSLSSCVVD---AKEDVERLFSSDNLRQLFQYNDKTIC 809
            +YRF++  +IEEK+ +R + K+ L   V+     K+      S D+L  + Q+  K + 
Sbjct: 610 HVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTASLGNSKDDLLDMIQFGAKNMF 669

Query: 810 E 810
           E
Sbjct: 670 E 670

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  241 bits (614), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 159/523 (30%), Positives = 266/523 (50%), Gaps = 71/523 (13%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKTLQ I+ +  L       K++    +++ P S ++NW  E  KW      
Sbjct: 155 ILADEMGLGKTLQTISFLGYL----RYVKKIEGPFLVIVPKSTLDNWRREFFKW------ 204

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKP----VLIISYETLRRNVDQLRNC 424
           +P           + ++TV +      Q   +NIV      VLI SYE + R    L+  
Sbjct: 205 TP-----------NVSTTVLQGTKEQRQDILQNIVLEARFDVLITSYEMVIREKGYLKRL 253

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 484
               ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G
Sbjct: 254 AWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFG 313

Query: 485 TRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKY 544
               F   F+      ++    D+E+      +Q+L  +++ F++RR    + K L  K 
Sbjct: 314 DSEVFDDWFQ------QNNSDQDQEVV-----VQQLHAVLNPFLLRRIKADVEKSLLPKI 362

Query: 545 EHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGV----GGTQPLKAIGVLKKLCNHPNXXXX 600
           E  ++V +   Q   Y  LL+ +D++ +   V    G T+ L  +  L+K CNHP     
Sbjct: 363 ETNVYVGMTDMQVQWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP----- 416

Query: 601 XXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQF-SGKFAILERFLHKIKTESDDKIVL 654
                          Y  +G++     + D    F +GK  +L++ L ++K E   ++++
Sbjct: 417 ---------------YLFEGAEPGPPYTTDEHLIFNAGKMIVLDKLLKRLK-EKGSRVLI 460

Query: 655 ISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 714
            S  ++ LD++E  C  ++Y+  R+DG+ +  +R   +D +N P  ++F+FLL+++AGG 
Sbjct: 461 FSQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGL 520

Query: 715 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMK 774
           GINL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YRF++  +IEEK+ +R + K
Sbjct: 521 GINLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQK 580

Query: 775 MSLSSCVVD---AKEDVERLFSSDNLRQLFQYNDKTICETHET 814
           + L   V+     K+      S D+L ++ QY  K + E + T
Sbjct: 581 LRLDQLVIQQGSGKKTANLGNSKDDLIEMIQYGAKNVFEKNGT 623

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  238 bits (606), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 158/526 (30%), Positives = 265/526 (50%), Gaps = 72/526 (13%)

Query: 272 FLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLR 331
           +L+R     +     D +      + +   NR A   I+ADEMGLGKTLQ I+ +  L  
Sbjct: 162 YLFRESPAYINGQLRDYQVQGLNWLVSLDKNRIA--GILADEMGLGKTLQTISFLGYL-- 217

Query: 332 QGPQGKRLIDKC----IIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTV 387
                 R I K     +++ P S +NNW  E+ KW     ++   + G K   A      
Sbjct: 218 ------RYIKKIPGPFLVIAPKSTLNNWLREINKW--TPEVNAFILQGDKEERAR----- 264

Query: 388 AEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTA 447
              +     A   ++V    I SYE + R     R  +   ++ DE HR+KN +S+    
Sbjct: 265 --LIQDKFMACDFDVV----IASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQV 318

Query: 448 LDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTD 507
           L   +   R++++GTP+QN+L E +ALLNF  P +     +F + F      S++ D  D
Sbjct: 319 LREFHSKNRLLITGTPLQNNLHELWALLNFLLPDIFSDSQDFDEWF------SKETDEED 372

Query: 508 EEITKGEEQLQKLSTIVSKFIIRRT-NDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKS 566
           +E       +++L T++  F++RR  +D+ +  LP K E  ++V + P QK  Y ++L+ 
Sbjct: 373 QEKI-----VKQLHTVLQPFLLRRIKSDVETSLLPKK-ELNVYVGMSPMQKKWYRQILE- 425

Query: 567 RDVNKMVKGVGG----TQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSK 622
           +D++ +    G     T+ L  +  L+K CNHP                    Y   G++
Sbjct: 426 KDIDAVNADSGSKESKTRLLNIVMQLRKCCNHP--------------------YLFDGAE 465

Query: 623 -----SRDVQPQF-SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSS 676
                + D    + S K  +L++ L K+K E+  ++++ S  ++ LD++E  C  + Y  
Sbjct: 466 PGPPYTTDEHLVYNSEKLKVLDKLLRKLK-EAGSRVLIFSQMSRVLDILEDYCYFREYEY 524

Query: 677 VRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAAD 736
            R+DG+     R + +D +N P+ ++F+FLL+++AGG GINL  A+ ++L D DWNP AD
Sbjct: 525 CRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINLTTADVVVLFDSDWNPQAD 584

Query: 737 QQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
            QA+ R  R GQKK   ++RF++  S+EEKI +R + K+ L   V+
Sbjct: 585 LQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLDQLVI 630

>Scas_665.17
          Length = 1060

 Score =  236 bits (601), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 160/518 (30%), Positives = 259/518 (50%), Gaps = 63/518 (12%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKTLQ I+ +  L       K++    +IV P S ++NW  E  KW     +
Sbjct: 159 ILADEMGLGKTLQTISFLGYL----RYVKKIDGPFLIVVPKSTLDNWRREFNKW--TPEV 212

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
           + + + G K           E  H             VLI SYE + +  + L+      
Sbjct: 213 NAIVLHGDK-----------EERHKILYDIVLEAKFDVLITSYEMVIKEKNVLKKFAWQY 261

Query: 429 MLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSE 488
           ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    
Sbjct: 262 IVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSGI 321

Query: 489 FRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVI 548
           F + FE      ++    D+EI      +Q+L T+++ F++RR    + K L  K E  +
Sbjct: 322 FDEWFE------QNNSEQDQEIV-----VQQLHTVLNPFLLRRIKADVEKSLLPKIETNV 370

Query: 549 FVNLKPFQKDVYHRLLKSRDVNKMVKGV----GGTQPLKAIGVLKKLCNHPNXXXXXXXX 604
           +V +   Q   Y  LL+ +D++ +   V    G T+ L  +  L+K CNHP         
Sbjct: 371 YVGMTEMQVKWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP--------- 420

Query: 605 XXXXXXXXXXXYNMQGSK-----SRDVQPQF-SGKFAILERFLHKIKTESDDKIVLISNY 658
                      Y  +G++     + D    F +GK  +L++ L ++K E   ++++ S  
Sbjct: 421 -----------YLFEGAEPGPPYTTDEHLVFNAGKMIVLDKLLKRLK-EKGSRVLIFSQM 468

Query: 659 TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718
           ++ LD++E  C  + Y   R+DG+     R + +D +N P   +F+FLL+++AGG GINL
Sbjct: 469 SRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINL 528

Query: 719 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778
           + A+ +IL D DWNP AD QA+ R  R GQKK   +YRF++  +IEEK+ +R + K+ L 
Sbjct: 529 VTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLD 588

Query: 779 SCVVD---AKEDVERLFSSDNLRQLFQYNDKTICETHE 813
             V+     K+      + D+L ++ QY  K + E  E
Sbjct: 589 QLVIQQGTGKKTASLGSNKDDLLEMIQYGAKNMFENKE 626

>Kwal_34.16082
          Length = 726

 Score =  226 bits (577), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 152/467 (32%), Positives = 235/467 (50%), Gaps = 59/467 (12%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKW---- 362
           G I+ DEMGLGKT+Q IA + +L   G    +L    +IVCP++++  W  E   W    
Sbjct: 283 GGIIGDEMGLGKTIQIIAFLASLHHSG----KLDGPVLIVCPATVLRQWCKEFHTWWPPF 338

Query: 363 -------LGPGT----------LSPLAVDGKKSSL---ASGNSTVAEAVHSWAQATGRNI 402
                  +G G           L  L ++     L   A  +S   ++      A  + I
Sbjct: 339 RTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTKSTLESGMARSKLI 398

Query: 403 VKPV-----LIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRV 457
            K V     LI +Y  LR + D L N      + DEGH+++N D+        +    R+
Sbjct: 399 NKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADISLTCKKLKTKNRI 458

Query: 458 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL 517
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F +PI     A++T+ ++  G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYANATNIQVQTGYKCA 518

Query: 518 QKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVG 577
             L  ++S +++RR    ++K LP K E V+F  L  FQ+  Y + L S D+ K+    G
Sbjct: 519 IALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQFLNSEDLTKIKN--G 576

Query: 578 GTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAIL 637
             Q L  I +L+K+CNHP+                    + + ++S    P+ SGK  ++
Sbjct: 577 KRQVLFGIDILRKICNHPDLLEK----------------DKRENESSYGDPKRSGKMQVV 620

Query: 638 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNK-----HYSSVRLDGTMTINKRQKLV 692
           ++ L ++      K +L +   Q LD++EK    K       + +R+DGT  I  RQ LV
Sbjct: 621 KQLL-RLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIGSRQALV 679

Query: 693 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 739
           D FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA
Sbjct: 680 DSFNN--GLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>Scas_652.17
          Length = 1025

 Score =  230 bits (587), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 163/537 (30%), Positives = 259/537 (48%), Gaps = 97/537 (18%)

Query: 262 LRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQ 321
           LRP+Q++G+ +L                            ++     I+ADEMGLGKTLQ
Sbjct: 113 LRPYQIQGLNWLVSL-------------------------HKNGLAGILADEMGLGKTLQ 147

Query: 322 CIALMWTL-LRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSL 380
            IA +  L   +G  G  L+     + P S +NNW  E+ KW      +P   D K   L
Sbjct: 148 TIAFLGYLKYMEGINGPFLV-----IAPKSTLNNWLREINKW------TP---DVKAFVL 193

Query: 381 ASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNG 440
                  A  +         +IV    + SYE + R     +  +   ++ DE HR+KN 
Sbjct: 194 QGDKQERASLIKEKLMTCDFDIV----VASYEIIIREKAAFKKFNWEYIIIDEAHRIKNE 249

Query: 441 DSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRS 500
           +SL    L       R++++GTP+QN+L E +ALLNF  P +  +  +F   F       
Sbjct: 250 ESLLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSSSQDFDDWF------- 302

Query: 501 RDADSTDEEITKGEEQLQKLSTIVSKFIIRRT-NDILSKYLPCKYEHVIFVNLKPFQKDV 559
             +++T+E+  K  +QL    T++  F++RR  ND+ +  LP K E  ++V +   QK  
Sbjct: 303 -SSETTEEDQDKVVKQLH---TVLQPFLLRRIKNDVETSLLPKK-ELNLYVGMSNMQKKW 357

Query: 560 YHRLLKSRDVNKMVKGVGG--------TQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXX 611
           Y ++L+     K +  V G        T+ L  +  L+K CNHP                
Sbjct: 358 YKKILE-----KDLDAVNGENSSKESKTRLLNIVMQLRKCCNHP---------------- 396

Query: 612 XXXXYNMQGSK-----SRDVQPQF-SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLI 665
               Y   G++     + D    + S K  +L++ L K+K E   ++++ S  ++ LD++
Sbjct: 397 ----YLFDGAEPGPPYTTDEHLVYNSKKLQVLDKLLKKMK-EDGSRVLIFSQMSRVLDIL 451

Query: 666 EKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 725
           E  C  + Y   R+DG+     R K +D +N P+  +FIFLL+++AGG GINL  A+ ++
Sbjct: 452 EDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGINLTSADIVV 511

Query: 726 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
           L D DWNP AD QA+ R  R GQKK   ++RF++  S+EEKI +R + K+ L   V+
Sbjct: 512 LYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRLDQLVI 568

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  228 bits (582), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 153/485 (31%), Positives = 251/485 (51%), Gaps = 62/485 (12%)

Query: 309 IMADEMGLGKTLQCIALMWTL-LRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           I+ADEMGLGKTLQ I+ +  L   +G +G       I++ P S ++NW  E  KW     
Sbjct: 158 ILADEMGLGKTLQSISFLGYLRYIKGIEGP-----YIVIVPKSTLDNWQREFAKW----- 207

Query: 368 LSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVG 427
            +P      K+ +  G+    + +      T       VLI SYE + +    L+     
Sbjct: 208 -TPEV----KTVILQGDKDFRKELIETKILTCNF---DVLITSYEMVLKEKLTLKRFAWE 259

Query: 428 LMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            +L DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G   
Sbjct: 260 YILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSE 319

Query: 488 EFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHV 547
            F + F+      ++    D+E+      +Q+L +++  F++RR    + K L  K E  
Sbjct: 320 VFDEWFQ------QNGKEEDQEVV-----VQQLHSVLQPFLLRRVKSEVEKSLLPKKEIN 368

Query: 548 IFVNLKPFQKDVYHRLLKSRDVNKMVKGV----GGTQPLKAIGVLKKLCNHPNXXXXXXX 603
           ++V +   Q + Y  LL+ +D++ +   V    G T+ L  +  L+K CNHP        
Sbjct: 369 LYVGMTDMQIEWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP-------- 419

Query: 604 XXXXXXXXXXXXYNMQGSK-----SRDVQPQF-SGKFAILERFLHKIKTESDDKIVLISN 657
                       Y  +G++     + D    F SGK  +L++ L K K E   ++++ S 
Sbjct: 420 ------------YLFEGAEPGPPYTTDEHLVFNSGKMIVLDK-LLKKKKEQGSRVLIFSQ 466

Query: 658 YTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGIN 717
            ++ LD++E  C  + Y   R+DG+ + ++R + +D +N P  ++FIFLL+++AGG GIN
Sbjct: 467 MSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGIN 526

Query: 718 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSL 777
           L+ A+ ++L D DWNP AD QA+ R  R GQKK  F+YRF++  +IEEK+ +R + K+ L
Sbjct: 527 LVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLRL 586

Query: 778 SSCVV 782
              V+
Sbjct: 587 DQLVI 591

>Kwal_14.1600
          Length = 1102

 Score =  228 bits (581), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 167/575 (29%), Positives = 275/575 (47%), Gaps = 91/575 (15%)

Query: 256 PKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMG 315
           P +   LRP+QV+GV +L                      V   +NN      I+ADEMG
Sbjct: 130 PFINGCLRPYQVQGVNWL----------------------VSLHRNNLAG---ILADEMG 164

Query: 316 LGKTLQCIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWANELVKWLGPGTLSPL 371
           LGKTLQ I+ +  L        R ++K     +++ P S +NNW  E+ +W      +P 
Sbjct: 165 LGKTLQTISFLGYL--------RYVEKKPGPFVVIAPKSTLNNWLREINRW------TP- 209

Query: 372 AVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLA 431
             D +   L       A+ V +   A   +IV    + SYE + +     +      ++ 
Sbjct: 210 --DVRAFILQGDKEERAKLVANKLMACDFDIV----VASYEIIIKEKASFKKIAWEYIVI 263

Query: 432 DEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRK 491
           DE HR+KN +S+    L       R++++GTP+QN+L E +ALLNF  P +      F  
Sbjct: 264 DEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDVFSDSQAFDD 323

Query: 492 NFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRR-TNDILSKYLPCKYEHVIFV 550
            F           S   E  KG+  +++L T++  F++RR  N++ +  LP K E  +++
Sbjct: 324 WF----------SSESSEDDKGK-IVKQLHTVLQPFLLRRLKNEVETSLLPKK-ELNLYI 371

Query: 551 NLKPFQKDVYHRLLKSRDVNKMVKGVGG-----TQPLKAIGVLKKLCNHPNXXXXXXXXX 605
            +   QK  Y ++L+ +D++  V G  G     T+ L  +  L+K CNHP          
Sbjct: 372 GMSSMQKRWYKQILE-KDID-AVNGANGNKESKTRLLNVMMQLRKCCNHP-YLFDGAEPG 428

Query: 606 XXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLI 665
                     YN             S K  +L++ L K K E   ++++ S  ++ LD++
Sbjct: 429 PPYTTDEHLVYN-------------SAKLKVLDKLLRKFKEEGS-RVLIFSQMSRVLDIL 474

Query: 666 EKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 725
           E  C  + Y   R+DG+     R + +D +N P+ ++F+FLL+++AGG GINL  A+ ++
Sbjct: 475 EDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGINLTTADIVV 534

Query: 726 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDA- 784
           L D DWNP AD QA+ R  R GQKK   ++R ++  S+EEKI +R + K+ L   V+   
Sbjct: 535 LYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRLDQLVIQQS 594

Query: 785 -----KEDVERLFSSDNLRQLFQYNDKTICETHET 814
                +++V++  S D L  + Q+    +  T+ T
Sbjct: 595 RNGVNQKEVKKGDSKDALLSMIQHGAADVFSTNST 629

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, start by similarity
          Length = 1344

 Score =  228 bits (580), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 153/489 (31%), Positives = 236/489 (48%), Gaps = 51/489 (10%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKT+Q I+L+  L     + K      +++ P S + NW  E  KW  P   
Sbjct: 535 ILADEMGLGKTIQSISLISYLY----EIKNERQPFLVIVPLSTITNWTIEFEKW-APSL- 588

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
                   ++ +  GN    +A+    +    ++V    + +YE + ++   L   D   
Sbjct: 589 --------RTIVYKGNPNQRKALQHTIKMGNFDVV----LTTYEYIIKDRPLLAKHDWAH 636

Query: 429 MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
           M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 637 MIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 696

Query: 488 EFRKNFELPILRSRDADSTDEEITKGEEQ----LQKLSTIVSKFIIRRTNDILSKYLPCK 543
            F + F  P   +     T E++   EE+    +++L  ++  F++RR    + K LP K
Sbjct: 697 TFDEWFNTPFANT----GTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDK 752

Query: 544 YEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLCNHP 595
            E V+   L   Q+ +Y ++LK    N    G G     KA        +  L+K+CNHP
Sbjct: 753 VEKVVKCKLSSLQQQLYEQMLKH---NAFFIGAGTEGATKAGIKGLNNKVMQLRKICNHP 809

Query: 596 NXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLI 655
                               Y +            SGKF +L+R L K K  S  ++++ 
Sbjct: 810 FVFDEVENVINPTRENSSILYRV------------SGKFELLDRVLPKFKA-SGHRVLMF 856

Query: 656 SNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 715
              TQ +D++E   R +    +RLDG      R  ++  FN P+ + F FLLS++AGG G
Sbjct: 857 FQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLG 916

Query: 716 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKM 775
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+
Sbjct: 917 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 976

Query: 776 SLSSCVVDA 784
            +   V+ A
Sbjct: 977 DIDGKVIQA 985

>Kwal_34.15925
          Length = 1025

 Score =  226 bits (575), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 153/492 (31%), Positives = 248/492 (50%), Gaps = 76/492 (15%)

Query: 309 IMADEMGLGKTLQCIALMWTLLR----QGPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKTLQ IA +  L       GP         I++ P S +NNW  E  KW  
Sbjct: 151 ILADEMGLGKTLQTIAFLGYLRYLKDIDGPH--------IVIVPKSTLNNWKREFSKW-- 200

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKP----VLIISYETLRRNVDQ 420
              +  + + G K                  Q   ++IV      VLI SYE + +    
Sbjct: 201 TPEVEAVVLSGDKEE---------------RQHLLKDIVLECKFDVLITSYEMVIKEKST 245

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
           L+      ++ DE HR+KN  S     +   +   R++++GTP+QN+L E +ALLNF  P
Sbjct: 246 LKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNFLLP 305

Query: 481 GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL 540
            + G    F + FE      +     D+++      +Q+L T++S F++RR    +   L
Sbjct: 306 DVFGDSDAFDRWFE------QSDTEKDQDVV-----VQQLHTVLSPFLLRRLKSEVETSL 354

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGV----GGTQPLKAIGVLKKLCNHPN 596
             K E  ++V +   Q   Y  LL+ +D++ +   +    G T+ L  +  L+K CNHP 
Sbjct: 355 LPKIETNLYVGMTDMQVQWYKSLLE-KDLDAVNGAIGKREGNTRLLNIVMQLRKCCNHP- 412

Query: 597 XXXXXXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQF-SGKFAILERFLHKIKTESDD 650
                              Y  +G++     + D    F +GK  +L++ L K K E+  
Sbjct: 413 -------------------YLFEGAEPGPPYTTDEHLIFNAGKMIVLDK-LLKKKKEAGS 452

Query: 651 KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSK 710
           ++++ S  ++ LD++E  C  + Y   R+DG+    +R + +D+FN+P  ++FIFLL+++
Sbjct: 453 RVLIFSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTR 512

Query: 711 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQR 770
           AGG GINL+ A+ +++ D DWNP AD QA+ R  R GQKK   +YRF++  +IEEK+ +R
Sbjct: 513 AGGLGINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 572

Query: 771 QSMKMSLSSCVV 782
            + K+ L   V+
Sbjct: 573 AAQKLRLDQLVI 584

>Scas_597.8
          Length = 1065

 Score =  223 bits (569), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 149/488 (30%), Positives = 246/488 (50%), Gaps = 68/488 (13%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKTLQ I+ +  L        R ++K     +++ P S +NNW  E+ KW  
Sbjct: 154 ILADEMGLGKTLQTISFLGYL--------RYVEKIPGPFLVIAPKSTLNNWLREINKW-- 203

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
              ++   + G K   A       + V     A   +IV    + SYE + R     R  
Sbjct: 204 TPEVNAFILQGDKEERA-------QLVKDKLLACDFDIV----VASYEIIIREKSAFRKI 252

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 484
           D   ++ DE HR+KN +SL    L       R++++GTP+QN+L E +ALLNF  P +  
Sbjct: 253 DWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQNNLHELWALLNFLLPDIFS 312

Query: 485 TRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRR-TNDILSKYLPCK 543
              +F   F         +++T+E+    E+ +++L T++  F++RR  ND+ +  LP K
Sbjct: 313 DSQDFDDWF--------SSETTEED---QEKVVKQLHTVLQPFLLRRLKNDVETSLLP-K 360

Query: 544 YEHVIFVNLKPFQKDVYHRLLKSRDVNKM----VKGVGGTQPLKAIGVLKKLCNHPNXXX 599
            E  ++V +   QK  Y ++L+ +D++ +    V     T+ L  +  L+K CNHP    
Sbjct: 361 QELNLYVGMSNMQKKWYKQILE-KDIDAVNGSNVNKESKTRLLNIVMQLRKCCNHP---- 415

Query: 600 XXXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQFSGKFAILERFLHKIKTESDDKIVL 654
                           Y   G++     + D    ++     +   L K   E   ++++
Sbjct: 416 ----------------YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKMKEEGSRVLI 459

Query: 655 ISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 714
            S  ++ LD++E  C  + Y   R+DG+     R + +D +N+P  ++FIFLL+++AGG 
Sbjct: 460 FSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGL 519

Query: 715 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMK 774
           GINL  AN ++L D DWNP AD QA+ R  R GQK+   ++R ++  S+EEKI +R + K
Sbjct: 520 GINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQK 579

Query: 775 MSLSSCVV 782
           + L   V+
Sbjct: 580 LRLDQLVI 587

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
           cerevisiae YER164w CHD1 transcriptional regulator, start
           by similarity
          Length = 1525

 Score =  223 bits (569), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 266/543 (48%), Gaps = 59/543 (10%)

Query: 249 NVPVVIDPKLTKI-LRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYG 307
           N P    PK  K+  +P  ++G +     +TG+    FL             +N+ G   
Sbjct: 364 NYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFL-----------WSKNDNG--- 409

Query: 308 CIMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
            I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  PG
Sbjct: 410 -ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKW-APG 462

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-PVLIISYETLRRNVDQLRNCD 425
            L+ +   G +   AS +       ++  QA G+  +K  VL+ +YE + ++   L +  
Sbjct: 463 -LNCVYYMGNQ---ASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIK 518

Query: 426 VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 485
              +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG    
Sbjct: 519 WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTI 578

Query: 486 RSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYE 545
             E             D ++ DE+    EE ++ L   +  FI+RR    + K LP K E
Sbjct: 579 DQEI------------DFENQDEQ---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTE 623

Query: 546 HVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQP--LKAIGVLKKLCNHPNXXXXXXX 603
            ++ V L   Q + Y  +L +++ + +  G+ G     L  +  LKK  NHP        
Sbjct: 624 RILRVELSDVQTEYYKNIL-TKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEE 682

Query: 604 XXXXXXXXXXXXYNMQGSKSRDVQPQ----FSGKFAILERFLHKIKTESDDKIVLISNYT 659
                           G KSR+   +     SGK  +L++ L ++K +   ++++ S   
Sbjct: 683 RVLSKFG--------DGHKSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMV 733

Query: 660 QTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 719
           + LD++      K  +  RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+
Sbjct: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793

Query: 720 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSS 779
            A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  ++EE++ +R   KM L  
Sbjct: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853

Query: 780 CVV 782
            ++
Sbjct: 854 AII 856

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score =  222 bits (566), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 244/495 (49%), Gaps = 69/495 (13%)

Query: 309 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P  
Sbjct: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450

Query: 368 LSPLAVDGKKSSLASGNSTVAE-AVHSWAQATGRNIVK-PVLIISYETLRRNVDQLRNCD 425
           L+ +   G + S      T+ E   ++  +A G+  +K  VL+ +YE + ++  +L +  
Sbjct: 451 LNCICYMGNQKS----RDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIK 506

Query: 426 VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 485
              M  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG    
Sbjct: 507 WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTI 566

Query: 486 RSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYE 545
             E             D ++ DEE    EE +  L   +  FI+RR    + K LP K E
Sbjct: 567 DQEI------------DFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTE 611

Query: 546 HVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQ--PLKAIGVLKKLCNHPNXXXXXXX 603
            ++ V L   Q + Y  +L +++ + +  G  G     L  +  LKK  NHP        
Sbjct: 612 RILRVELSDVQTEYYKNIL-TKNYSALTAGAKGGHFSLLNIMNELKKASNHP-------- 662

Query: 604 XXXXXXXXXXXXYNMQGSKSRDVQP----------------QFSGKFAILERFLHKIKTE 647
                       Y    ++ R +Q                   SGK  +L++ L ++K +
Sbjct: 663 ------------YLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKD 710

Query: 648 SDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLL 707
              ++++ S   + LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLL
Sbjct: 711 GH-RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLL 769

Query: 708 SSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKI 767
           S++AGG GINL+ A+ +++ D DWNP AD QA+AR  R GQK    +YR +S  ++EE++
Sbjct: 770 STRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEV 829

Query: 768 YQRQSMKMSLSSCVV 782
            +R   KM L   ++
Sbjct: 830 LERARKKMILEYAII 844

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  221 bits (564), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 168/607 (27%), Positives = 284/607 (46%), Gaps = 102/607 (16%)

Query: 194 KDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLGSSEEDEAKK---KFPNV 250
           KD    +  D  +E    G  K  H  +      ++   ELL   + D+ +    +F   
Sbjct: 129 KDPKFRQVLDVLEENKANGKGKGKHQDVRRRKTEHEEDAELLKEEDSDDDESIEFQFRES 188

Query: 251 PVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIM 310
           P  ++ +L    RP+Q++GV +L                            ++     I+
Sbjct: 189 PAYVNGQL----RPYQIQGVNWLVSL-------------------------HKNKIAGIL 219

Query: 311 ADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELVKWLGPG 366
           ADEMGLGKTLQ I+ +  L        R I+K     +++ P S +NNW  E+ +W    
Sbjct: 220 ADEMGLGKTLQTISFLGYL--------RYIEKIPGPFLVIAPKSTLNNWLREINRW--TP 269

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDV 426
            ++   + G K   A       E +         ++V    I SYE + R    L+  + 
Sbjct: 270 DVNAFILQGDKEERA-------ELIQKKLLGCDFDVV----IASYEIIIREKSPLKKINW 318

Query: 427 GLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 486
             ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALLNF  P +    
Sbjct: 319 EYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDA 378

Query: 487 SEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRT-NDILSKYLPCKYE 545
            +F   F         ++ST+E+  K  +QL    T++  F++RR  +D+ +  LP K E
Sbjct: 379 QDFDDWF--------SSESTEEDQDKIVKQLH---TVLQPFLLRRIKSDVETSLLPKK-E 426

Query: 546 HVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGG-----TQPLKAIGVLKKLCNHPNXXXX 600
             ++V +   QK  Y ++L+ +D++  V G  G     T+ L  +  L+K CNHP     
Sbjct: 427 LNLYVGMSSMQKKWYKKILE-KDLD-AVNGSNGSKESKTRLLNIMMQLRKCCNHP----- 479

Query: 601 XXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQFSGKFAILERFLHKIKTESDDKIVLI 655
                          Y   G++     + D    ++     +   L K   E   ++++ 
Sbjct: 480 ---------------YLFDGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIF 524

Query: 656 SNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 715
           S  ++ LD++E  C  ++Y   R+DG+     R + +D +N P+ ++F+FLL+++AGG G
Sbjct: 525 SQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLG 584

Query: 716 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKM 775
           INL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  S+EEKI +R + K+
Sbjct: 585 INLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKL 644

Query: 776 SLSSCVV 782
            L   V+
Sbjct: 645 RLDQLVI 651

>Kwal_23.4777
          Length = 1301

 Score =  221 bits (564), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 152/490 (31%), Positives = 231/490 (47%), Gaps = 53/490 (10%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ-----GPQGKRLIDKCIIVCPSSLVNNWANELVKWL 363
           I+ADEMGLGKT+Q I+L+ T LR+     GP         +++ P S + NW  E  KW 
Sbjct: 478 ILADEMGLGKTIQSISLI-TYLRETKNEPGP--------FLVIVPLSTITNWTLEFEKW- 527

Query: 364 GPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRN 423
            P +L+ +   G  +   S    +                  VL+ +YE + ++   L  
Sbjct: 528 AP-SLATIVYKGTPNQRKSMQHQIRIGNFE------------VLLTTYEYIIKDRSLLAK 574

Query: 424 CDVGLMLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 482
            D   M+ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +
Sbjct: 575 HDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNFVLPKI 634

Query: 483 LGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPC 542
             +   F + F  P   +   +  +    +    +++L  ++  F++RR    + K LP 
Sbjct: 635 FNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPD 694

Query: 543 KYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLCNH 594
           K E V+   L   Q  +Y ++LK    N +  G G     K         I  L+K+CNH
Sbjct: 695 KVEKVVKCKLSGLQHQLYQQMLKH---NALFFGAGTEGATKGGIKGLNNKIMQLRKICNH 751

Query: 595 PNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVL 654
           P                    Y +            +GKF +L+R L K K  +  ++++
Sbjct: 752 PFVFDEVEGIINPSRANSPLLYRV------------AGKFELLDRILLKFKV-TGHRVLM 798

Query: 655 ISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 714
               TQ +D++E   R +    +RLDG      R  ++  FN P  + F FLLS++AGG 
Sbjct: 799 FFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGL 858

Query: 715 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMK 774
           G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K
Sbjct: 859 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQK 918

Query: 775 MSLSSCVVDA 784
           + +   V+ A
Sbjct: 919 LDIDGKVIQA 928

>Scas_594.7
          Length = 1703

 Score =  221 bits (564), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 167/570 (29%), Positives = 267/570 (46%), Gaps = 61/570 (10%)

Query: 234  LLGSSEEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNT 293
            LL +SEED  K   P++PV   P           E   F Y  V   + ++     A+  
Sbjct: 757  LLEASEED--KSVSPSMPVATFPD-----EEDGEEKGNFDYYSVAHRIKEEIRQQPAMLV 809

Query: 294  GIVKTEQNNRGA----------YGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC 343
            G    E   +G              I+ADEMGLGKT+Q I+L+  L     + K +    
Sbjct: 810  GGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLY----ETKHIHGPY 865

Query: 344  IIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIV 403
            +++ P S ++NW+NE  KW  P T+  ++  G  +   S ++ +                
Sbjct: 866  LVIVPLSTLSNWSNEFAKW-AP-TMRCISYKGSPNERKSKHAIIKSGEFD---------- 913

Query: 404  KPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDS-LTFTALDSINCPRRVILSGT 462
              V++ ++E + +    L       M+ DEGHR+KN  S L+ T     +   R+IL+GT
Sbjct: 914  --VVLTTFEYIIKERALLSKVKWIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGT 971

Query: 463  PIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL--QKL 520
            P+QN+L E +ALLNF+ P +  +   F + F  P   +   D    E+++ E  L  ++L
Sbjct: 972  PLQNNLPELWALLNFALPKIFNSVKSFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRL 1029

Query: 521  STIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDV------NKMVK 574
              ++  F++RR    + K LP K E VI   +   Q+ +Y ++LK R +      NK + 
Sbjct: 1030 HKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMYQQMLKYRRLFIGDHTNKKMV 1089

Query: 575  GVGGTQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKF 634
            G+ G      +  LKK+CNHP                    + +            +GKF
Sbjct: 1090 GLRGFN--NQLMQLKKICNHPFVFEEVEDQINPTRETNANIWRV------------AGKF 1135

Query: 635  AILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDR 694
             +LE+ L K+K  +  ++++    TQ +D++E   R      +RLDG    + R  L+  
Sbjct: 1136 ELLEKVLPKLKA-TGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKL 1194

Query: 695  FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
            FN P+ +   F+LS++AGG G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I
Sbjct: 1195 FNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRI 1254

Query: 755  YRFISTGSIEEKIYQRQSMKMSLSSCVVDA 784
             R I+  S+EE I +R   K+ +   V+ A
Sbjct: 1255 LRLITEHSVEEAILERAHKKLDIDGKVIQA 1284

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  221 bits (564), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 248/485 (51%), Gaps = 44/485 (9%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S ++NW++E  KW  P TL
Sbjct: 789  ILADEMGLGKTIQTISLLTYLY----EMKNIRGPYLVIVPLSTLSNWSSEFAKW-AP-TL 842

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
              ++  G      S N   A+      QA  R     V++ ++E + +    L       
Sbjct: 843  RTISFKG------SPNERKAK------QAKIRAGEFDVVLTTFEYIIKERALLSKVKWVH 890

Query: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            M+ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 891  MIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 950

Query: 488  EFRKNFELPILRSRDADSTDEEITKGEEQL--QKLSTIVSKFIIRRTNDILSKYLPCKYE 545
             F + F  P   +   D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 951  SFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 1008

Query: 546  HVIFVNLKPFQKDVYHRLLKSRDV------NKMVKGVGGTQPLKAIGVLKKLCNHPNXXX 599
             V+   +   Q+ +Y ++LK R +      NK + G+ G      I  LKK+CNHP    
Sbjct: 1009 KVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFN--NQIMQLKKICNHP---- 1062

Query: 600  XXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYT 659
                             N     + D+  + +GKF +L+R L K+K  +  ++++    T
Sbjct: 1063 -------FVFEEVEDQINPTRETNDDIW-RVAGKFELLDRILPKLKA-TGHRVLIFFQMT 1113

Query: 660  QTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 719
            Q +D++E   R  +   +RLDG    ++R +L+  FN P+ +   F+LS++AGG G+NL 
Sbjct: 1114 QIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQ 1173

Query: 720  GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSS 779
             A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+ +  
Sbjct: 1174 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDG 1233

Query: 780  CVVDA 784
             V+ A
Sbjct: 1234 KVIQA 1238

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  221 bits (562), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 237/486 (48%), Gaps = 46/486 (9%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+L+  L     + K +    +I+ P S + NW++E  KW  P  L
Sbjct: 824  ILADEMGLGKTIQTISLLTYLY----EMKNIKGPFLIIVPLSTLPNWSSEFAKW-APK-L 877

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
              ++  G  +      + +          T   I+K   I+S                  
Sbjct: 878  RTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKERAILS------------KVKWVH 925

Query: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            M+ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 926  MIIDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAK 985

Query: 488  EFRKNFELPILRSRDADSTDEEITKGEEQL--QKLSTIVSKFIIRRTNDILSKYLPCKYE 545
             F + F  P   +   D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 986  SFDEWFNTPFANTGGQDKI--ELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVE 1043

Query: 546  HVIFVNLKPFQKDVYHRLLKSRDV-------NKMVKGVGGTQPLKAIGVLKKLCNHPNXX 598
             VI   +   Q  +Y ++LK + +       NK+V G+ G      +  LKK+CNHP   
Sbjct: 1044 KVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKLV-GLRGFN--NQLMQLKKICNHPFVF 1100

Query: 599  XXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNY 658
                             +            + +GKF +LER L K+K  S  ++++    
Sbjct: 1101 EEVEDHINPTRDTNMNIW------------RVAGKFELLERILPKLKA-SRHRVLIFFQM 1147

Query: 659  TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718
            TQ +D++E   R      +RLDG    ++R +L+  FNDP  + F F+LS++AGG G+NL
Sbjct: 1148 TQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNL 1207

Query: 719  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+ + 
Sbjct: 1208 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDID 1267

Query: 779  SCVVDA 784
              V+ A
Sbjct: 1268 GKVIQA 1273

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  220 bits (560), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 149/485 (30%), Positives = 232/485 (47%), Gaps = 43/485 (8%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKT+Q I+L+  L     + K+     +++ P S + NW  E  KW  P +L
Sbjct: 479 ILADEMGLGKTIQSISLITYLY----EVKKDSGPFLVIVPLSTITNWTLEFEKW-AP-SL 532

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
           + +   G  +   S    V                  VL+ +YE + ++   L   +   
Sbjct: 533 TTVIYKGTPNQRRSLQHQVRIGDFD------------VLLTTYEYIIKDRSLLAKHEWSH 580

Query: 429 MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
           M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 581 MIIDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 640

Query: 488 EFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHV 547
            F + F  P   +   +  +    +    +++L  ++  F++RR    + K LP K E V
Sbjct: 641 TFDEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 700

Query: 548 IFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLCNHPNXXX 599
           +   L   Q  +Y ++LK    N +  G G     K         I  L+K+CNHP    
Sbjct: 701 VKCKLSGLQHQLYQQMLKH---NALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD 757

Query: 600 XXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYT 659
                           Y +            SGKF +L+R L K K  +  ++++    T
Sbjct: 758 EVEGVVNPTRTNSSLLYRV------------SGKFELLDRVLPKFKA-TGHRVLMFFQMT 804

Query: 660 QTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 719
           Q +D++E   + K+   +RLDG     +R  +++ FN P+   F FLLS++AGG G+NL 
Sbjct: 805 QVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLGLNLQ 864

Query: 720 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSS 779
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+ +  
Sbjct: 865 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDG 924

Query: 780 CVVDA 784
            V+ A
Sbjct: 925 KVIQA 929

>Scas_662.7
          Length = 1342

 Score =  220 bits (560), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 152/489 (31%), Positives = 234/489 (47%), Gaps = 51/489 (10%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKT+Q I+L+  L  +    GP         +++ P S + NW  E  KW  
Sbjct: 483 ILADEMGLGKTIQSISLITYLFEEKKDPGP--------YLVIVPLSTITNWTLEFEKW-A 533

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
           P +L+ +   G          T  +  +   Q    N    VL+ +YE + ++   L   
Sbjct: 534 P-SLNTVIYKG----------TPNQRRNLQHQVRIGNF--DVLLTTYEYIIKDRALLAKH 580

Query: 425 DVGLMLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 483
           +   M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P + 
Sbjct: 581 EWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIF 640

Query: 484 GTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCK 543
            +   F   F  P   +   +  +    +    +++L  ++  F++RR    + K LP K
Sbjct: 641 NSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDK 700

Query: 544 YEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLCNHP 595
            E V+   L   Q+ +Y ++LK    N +  G G     K+        I  L+K+CNHP
Sbjct: 701 VEKVVKCKLSGLQQQLYEQMLKH---NALFLGEGTEGATKSGIKGLNNKIMQLRKICNHP 757

Query: 596 NXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLI 655
                               Y +            SGKF +L R L K K  +  ++++ 
Sbjct: 758 FVFDEVEGVINPTRANSNLLYRV------------SGKFELLNRVLPKFKA-AGHRVLMF 804

Query: 656 SNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 715
              TQ +D++E   R K    +RLDG+   + R  +++ FN P+   F FLLS++AGG G
Sbjct: 805 FQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAGGLG 864

Query: 716 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKM 775
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+
Sbjct: 865 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 924

Query: 776 SLSSCVVDA 784
            +   V+ A
Sbjct: 925 DIDGKVIQA 933

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  219 bits (557), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 162/552 (29%), Positives = 261/552 (47%), Gaps = 99/552 (17%)

Query: 246 KFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGA 305
           +F   P  +D +L    RP+QV+GV +L                      V   +NN   
Sbjct: 132 QFRESPGFVDGRL----RPYQVQGVNWL----------------------VSLHKNN--- 162

Query: 306 YGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWANELVK 361
              I+ADEMGLGKTLQ I  +  L        R I+K     +++ P S +NNW  E+ +
Sbjct: 163 LAGILADEMGLGKTLQTITFLGYL--------RYIEKKRGPFLVIAPKSTLNNWQREINR 214

Query: 362 WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421
           W     +    + G K   A        A +             V I SYE + R     
Sbjct: 215 WTP--DVDAFILQGDKEERARLCQERLLACNF-----------DVAIASYEIIIREKASF 261

Query: 422 RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
           +  D   ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P 
Sbjct: 262 KKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPD 321

Query: 482 LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRT-NDILSKYL 540
           +    + F + F      S  +D   ++I K      +L TI+  F++RR  +D+ +  L
Sbjct: 322 IFSDSAAFDEWFS-----SEASDDDKDKIVK------QLHTILQPFLLRRIKSDVETSLL 370

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGG-----TQPLKAIGVLKKLCNHP 595
           P K E  ++V +   Q+  Y ++L+ +D++  V G  G     T+ L  +  L+K CNHP
Sbjct: 371 PKK-ELNLYVGMSSMQRKWYKQILE-KDLD-AVNGSNGSKESKTRLLNIMMQLRKCCNHP 427

Query: 596 NXXXXXXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQFSGKFAILERFLHKIKTESDD 650
                               Y   G++     + D    ++     +   L K   E   
Sbjct: 428 --------------------YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKLKEDGS 467

Query: 651 KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSK 710
           ++++ S  ++ LD++E  C  + Y   R+DG+     R + +D +N P+ ++FIFLL+++
Sbjct: 468 RVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTR 527

Query: 711 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQR 770
           AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  S+EEKI +R
Sbjct: 528 AGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILER 587

Query: 771 QSMKMSLSSCVV 782
            + K+ L   V+
Sbjct: 588 ATQKLRLDQLVI 599

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  219 bits (557), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 156/536 (29%), Positives = 257/536 (47%), Gaps = 95/536 (17%)

Query: 262 LRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQ 321
           LRP+Q++G+ +L                            ++     I+ADEMGLGKTLQ
Sbjct: 141 LRPYQIQGLNWLVAL-------------------------HKNQLAGILADEMGLGKTLQ 175

Query: 322 CIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKK 377
            IA +  L        R I+K     +++ P S +NNW  E+ +W     +S   + G K
Sbjct: 176 TIAFLGYL--------RYIEKKNGPFLVIAPKSTLNNWLREINRW--TPEVSAFILQGDK 225

Query: 378 SSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRL 437
              +       +  H    A   +I     + SYE + R     +  D   ++ DE HR+
Sbjct: 226 EERS-------KLCHDKLLACDFDIC----VASYEIIIREKASFKKIDWEYVVIDEAHRI 274

Query: 438 KNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPI 497
           KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P +    + F + F    
Sbjct: 275 KNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFADSATFDEWF---- 330

Query: 498 LRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRT-NDILSKYLPCKYEHVIFVNLKPFQ 556
                  S++      E+ +++L T++S F++RR  ND+    LP K E  ++V +   Q
Sbjct: 331 -------SSESSEEDKEKVVKQLHTVLSPFLLRRIKNDVEGSLLPKK-ELNVYVGMSSMQ 382

Query: 557 KDVYHRLLKSRDVNKMVKGVGG-----TQPLKAIGVLKKLCNHPNXXXXXXXXXXXXXXX 611
           K  Y ++L+ +D++  V G  G     T+ L  +  L+K CNHP                
Sbjct: 383 KKWYKQILE-KDID-AVNGSNGQKESKTRLLNIVMQLRKCCNHP---------------- 424

Query: 612 XXXXYNMQGSK-----SRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIE 666
               Y   G++     + D    ++     +   L K   E   ++++ S  ++ LD++E
Sbjct: 425 ----YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKFKEQGSRVLIFSQMSRVLDILE 480

Query: 667 KMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLIL 726
             C  + Y   R+DG+     R   +D +N P+ ++FIFLL+++AGG GINL  A+ ++L
Sbjct: 481 DYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINLTTADIVVL 540

Query: 727 MDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
            D DWNP AD QA+ R  R GQKK   ++RF++  S+EEKI +R + K+ L   V+
Sbjct: 541 YDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLDQLVI 596

>Kwal_26.9164
          Length = 1454

 Score =  218 bits (555), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 234/486 (48%), Gaps = 46/486 (9%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW +E  KW  P  +
Sbjct: 624  ILADEMGLGKTIQTISLLTYLY----EVKNVRGPSLVIVPLSTLTNWDSEFDKW-AP-VI 677

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
              +A  G  +   S    +                  V++ ++E + +    L       
Sbjct: 678  RKVAYKGSPNERKSKQGIIRSGQFD------------VVLTTFEYIIKERALLSKIKWVH 725

Query: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            M+ DEGHR+KN  S L+ T  +  +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 726  MIIDEGHRMKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 785

Query: 488  EFRKNFELPILRSRDADSTDEEITKGEEQ----LQKLSTIVSKFIIRRTNDILSKYLPCK 543
             F + F  P   +   D    +I   EE+    +++L  ++  F++RR    + K LP K
Sbjct: 786  SFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDK 841

Query: 544  YEHVIFVNLKPFQKDVYHRLLKSR-----DVNKMVKGVGGTQPLKAIGVLKKLCNHPNXX 598
             E V+   +   Q+ +Y ++LK R     D+N   K VG       I  LKK+CNHP   
Sbjct: 842  VEKVLKCKMSALQQKLYEQMLKHRRLFIGDLNSN-KNVGMRGFNNQIMQLKKICNHPFVF 900

Query: 599  XXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNY 658
                             + +            +GKF +LER L K K  +  +I++    
Sbjct: 901  EEVEDQINPTRETNANIWRV------------AGKFELLERILPKFKA-TGHRILIFFQM 947

Query: 659  TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718
            TQ +D++E   R  +   +RLDG    + R  L++ FN P  + F FLLS++AGG G+NL
Sbjct: 948  TQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNL 1007

Query: 719  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  S+EE I  R   K+ + 
Sbjct: 1008 QSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEEVILDRAHKKLDID 1067

Query: 779  SCVVDA 784
              V+ A
Sbjct: 1068 GKVIQA 1073

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
           Saccharomyces cerevisiae YER164w CHD1 transcriptional
           regulator, start by similarity
          Length = 1476

 Score =  218 bits (554), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 151/510 (29%), Positives = 247/510 (48%), Gaps = 40/510 (7%)

Query: 277 VTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALM-WTLLRQGPQ 335
           + G  ++DF     +N       +N+ G    I+ADEMGLGKT+Q +A + W +  +   
Sbjct: 386 IKGGELRDF-QLTGINWMAFLWSKNDNG----ILADEMGLGKTVQTVAFISWLIFARRQN 440

Query: 336 GKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWA 395
           G  L+     V P S +  W     KW  P       +  +KS     +       +S  
Sbjct: 441 GPHLV-----VVPLSTMPAWIETFEKW-APDIDVICYMGNQKSR----DIEREYEFYSNP 490

Query: 396 QATGRNIVK-PVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCP 454
           +  G+  +K  VL+ +YE + ++  +L +     +  DE HRLKN +S  + +L+S    
Sbjct: 491 KGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVA 550

Query: 455 RRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGE 514
            R++++GTP+QN++ E  AL+NF  PG      E             D ++ DEE    E
Sbjct: 551 NRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------------DFENQDEE---QE 595

Query: 515 EQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVK 574
           + ++ L   +  FI+RR    + K LP K E ++ V L   Q + Y  +L +++ + +  
Sbjct: 596 QYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNIL-TKNYSALTA 654

Query: 575 GVGGTQ--PLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSG 632
           G  G +   L  +  L K  NHP                     NM            SG
Sbjct: 655 GAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKFGAG----NMSRENILRGLIMSSG 710

Query: 633 KFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLV 692
           K  +L++ L ++K +   ++++ S   + LD++      K  +  RLDGT+  N+R+  +
Sbjct: 711 KMVLLDKLLTRLKKDGH-RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAI 769

Query: 693 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 752
           D FN P   +F+FLLS++AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK   
Sbjct: 770 DHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHV 829

Query: 753 FIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
            +YR +S  ++EE++ +R   KM L   ++
Sbjct: 830 MVYRLVSKDTVEEEVLERARKKMILEYAII 859

>Kwal_56.23442
          Length = 1435

 Score =  216 bits (550), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 155/513 (30%), Positives = 250/513 (48%), Gaps = 46/513 (8%)

Query: 277 VTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALM-WTLLRQGPQ 335
           + G  ++DF     +N       +N+ G    I+ADEMGLGKT+Q +A + W +  +   
Sbjct: 352 IKGGELRDF-QLTGINWMAFLWSKNDNG----ILADEMGLGKTVQTVAFISWLIYARRQN 406

Query: 336 GKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWA 395
           G  L+     V P S +  W     KW  P       V  +KS  A       E   +  
Sbjct: 407 GPHLV-----VVPLSTMPAWQETFEKW-APDLNCIYFVGNQKSRDAIRE---GEFFTNPQ 457

Query: 396 QATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPR 455
             T ++    VL+ +YE + ++  +L       +  DE HRLKN +S  + +L+S     
Sbjct: 458 AKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 517

Query: 456 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEE 515
           R++++GTP+QN++ E  AL+NF  PG      E   +FE     ++DA+         E 
Sbjct: 518 RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI--DFE-----NQDAEQ--------ET 562

Query: 516 QLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKG 575
            ++ L + +  FI+RR    + K LP K E ++ V L   Q D Y  +L +++ + +  G
Sbjct: 563 YIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNIL-TKNYSALSAG 621

Query: 576 VGGTQ--PLKAIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQ---- 629
             G     L  +  LKK  NHP                        G  SR+   +    
Sbjct: 622 SKGAHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFG--------DGRMSRENILRGLIM 673

Query: 630 FSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQ 689
            SGK  +L++ L ++K +   ++++ S   + LD++      K  +  RLDGT+   +R+
Sbjct: 674 SSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRR 732

Query: 690 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
             +D FN P+  +F+FLLS++AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK
Sbjct: 733 ISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQK 792

Query: 750 KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
               +YRF+S  ++EE++ +R   KM L   ++
Sbjct: 793 NHVMVYRFVSKDTVEEEVLERARKKMILEYAII 825

>Scas_576.6
          Length = 1457

 Score =  216 bits (549), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 149/487 (30%), Positives = 239/487 (49%), Gaps = 53/487 (10%)

Query: 309 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           I+ADEMGLGKT+Q +A + W +  +   G       I+V P S +  W     KW  P  
Sbjct: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGPH-----IVVVPLSTMPAWQETFDKW-APD- 456

Query: 368 LSPLAVDGKKSSLASGNSTVAEAVHSWAQATG------RNIVKPVLIISYETLRRNVDQL 421
           L+ +           GN    +A+  +   T       +NI   VL+ +YE + ++  +L
Sbjct: 457 LNVICY--------MGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSEL 508

Query: 422 RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
            +     +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG
Sbjct: 509 GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG 568

Query: 482 LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541
                 E             D ++ DEE    EE ++ L   +  FI+RR    + K LP
Sbjct: 569 RFTIDQEI------------DFENQDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLP 613

Query: 542 CKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQ--PLKAIGVLKKLCNHPNXXX 599
            K E ++ V L   Q + Y  +L +++ + +  G  G     L  +  LKK  NHP    
Sbjct: 614 SKTERILRVELSDVQTEYYKNIL-TKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFD 672

Query: 600 XXXXXXXXXXXXXXXXYNMQGSKSRDVQPQ----FSGKFAILERFLHKIKTESDDKIVLI 655
                               G  SR+   +     SGK  +L++ L+K+K +   ++++ 
Sbjct: 673 NAEERVLKKFG--------DGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGH-RVLIF 723

Query: 656 SNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 715
           S   + LD++      K  +  RLDGT+   +R+  +D FN P+  + +FLLS++AGG G
Sbjct: 724 SQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLG 783

Query: 716 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKM 775
           INL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR +S  ++EE++ +R   KM
Sbjct: 784 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 843

Query: 776 SLSSCVV 782
            L   ++
Sbjct: 844 ILEYAII 850

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  215 bits (548), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 155/485 (31%), Positives = 237/485 (48%), Gaps = 43/485 (8%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKT+Q I+L+  L     + K+ I   +++ P S + NW  E  KW  P +L
Sbjct: 492 ILADEMGLGKTIQSISLITYLY----EVKKDIGPFLVIVPLSTITNWTLEFEKW-AP-SL 545

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
           + +   G  +   S    +                  VL+ +YE + ++   L   D   
Sbjct: 546 NTIIYKGTPNQRHSLQHQIRVGNFD------------VLLTTYEYIIKDKSLLSKHDWAH 593

Query: 429 MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
           M+ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 594 MIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAK 653

Query: 488 EFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHV 547
            F   F  P   +   +  +    +    +++L  ++  F++RR    + K LP K E V
Sbjct: 654 TFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 713

Query: 548 IFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLCNHPNXXX 599
           I   L   Q+ +Y ++LK    N +  G G     K         I  L+K+CNHP    
Sbjct: 714 IKCKLSGLQQQLYQQMLKH---NALFVGAGTEGATKGGIKGLNNKIMQLRKICNHP---- 766

Query: 600 XXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYT 659
                            N     S D+  + +GKF +L+R L K K  S  ++++    T
Sbjct: 767 -------FVFDEVEGVVNPSRGNS-DLLFRVAGKFELLDRVLPKFKA-SGHRVLMFFQMT 817

Query: 660 QTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 719
           Q +D++E   R K    +RLDG+    +R ++++ FN P+   F FLLS++AGG G+NL 
Sbjct: 818 QVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQ 877

Query: 720 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSS 779
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R   K+ +  
Sbjct: 878 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDG 937

Query: 780 CVVDA 784
            V+ A
Sbjct: 938 KVIQA 942

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  215 bits (548), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 235/486 (48%), Gaps = 45/486 (9%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P TL
Sbjct: 583  ILADEMGLGKTIQTISLLTYLY----EFKGIHGPFLVIVPLSTLTNWNAEFDKW-AP-TL 636

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
              LA  G  S   + +  +                  V++ ++E + +    L       
Sbjct: 637  RKLAFKGPPSERKALSGIIKSGNFD------------VVLTTFEYIIKERPLLSKVKWVH 684

Query: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            M+ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 685  MIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 744

Query: 488  EFRKNFELPILRSRDADSTDEEITKGEEQL--QKLSTIVSKFIIRRTNDILSKYLPCKYE 545
             F + F  P   +   D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 745  SFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 802

Query: 546  HVIFVNLKPFQKDVYHRLLKSRDV-------NKMVKGVGGTQPLKAIGVLKKLCNHPNXX 598
             V+   +   Q+ +Y ++LK R +       +K + G+ G      I  LKK+CNHP   
Sbjct: 803  KVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKKMVGLRGFN--NQIMQLKKICNHPFVF 860

Query: 599  XXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNY 658
                             + +            +GKF +LE+ L K K  S  ++++    
Sbjct: 861  EEVEDQINPNRETNANIWRV------------AGKFELLEKILPKFKA-SGHRVLIFFQM 907

Query: 659  TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718
            TQ +D++E   R      +RLDG    + R  L+++FN P    F FLLS++AGG G+NL
Sbjct: 908  TQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGLGLNL 967

Query: 719  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  S+EE I +R   K+ + 
Sbjct: 968  QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRKLDID 1027

Query: 779  SCVVDA 784
              V+ A
Sbjct: 1028 GKVIQA 1033

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  213 bits (542), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 249/534 (46%), Gaps = 69/534 (12%)

Query: 309  IMADEMGLGKTLQCIALMWT--LLRQGPQGKRLIDKC-----IIVCPSSLVNNWANELVK 361
            I+ D+MGLGKTLQ I ++ +   LR     K   +K      +I+CP SL  +W  E  +
Sbjct: 1309 ILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKTRPLPSLIICPPSLTGHWEQEFQQ 1368

Query: 362  WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421
            +    TL+ L   G  S        V  A               +++ SY+  R +VD L
Sbjct: 1369 Y--SPTLNVLVYAGGPSVRYPLQGQVPTA--------------DIVVTSYDVARNDVDFL 1412

Query: 422  RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
            +  D    + DEGH +KN  S    A+  IN   R++L+GTPIQN++ E ++L +F  PG
Sbjct: 1413 KKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPIQNNVVELWSLFDFLMPG 1472

Query: 482  LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541
             LGT   F++ F  PI  SR++ ++ +E   G   L+ L   V  F++RR  + +   LP
Sbjct: 1473 FLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEEVLSDLP 1532

Query: 542  CKYEHVIFVNLKPFQKDVYHRLLK------SRDVNKMVKGVGGTQPLKAIGVLKKLCNHP 595
             K     +  L   QK +Y+  +K       +D+    +        +A+  ++KLCNHP
Sbjct: 1533 PKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQHIFQALQYMRKLCNHP 1592

Query: 596  NXXXXXXXXXXXXXXXXXXXYNMQ--------------------GSKSRDVQPQFSGKFA 635
            +                     M                     G   +DV+ + S K  
Sbjct: 1593 SLVLNSSHPQFQQVQSYLSQTGMDLHDIGHAPKLEALKTLLLECGIGIQDVEKK-SNKNP 1651

Query: 636  ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSV---RLDGTMTINKRQKLV 692
             ++  +      S  ++++       LD++E     KH  SV   RLDG++    RQK+V
Sbjct: 1652 SIDNVI------SQHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSVDSRDRQKVV 1705

Query: 693  DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 752
             +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQKK  
Sbjct: 1706 RKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVV 1764

Query: 753  FIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK---------EDVERLFSSDNL 797
             +YR I+ G++EEKI   Q  KM+++S +V+ +           +  LF +DN+
Sbjct: 1765 NVYRIITKGTLEEKIMGLQKFKMNIASTIVNQQNAGLGSMNTHQLLDLFDADNI 1818

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  211 bits (538), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 145/490 (29%), Positives = 239/490 (48%), Gaps = 72/490 (14%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKTLQ I+ +  L        R I       I+V P S ++NW  E  KW  
Sbjct: 150 ILADEMGLGKTLQTISFLGYL--------RFIKDIDGPFIVVVPKSTLDNWKREFAKW-- 199

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK---PVLIISYETLRRNVDQL 421
              ++ + + G + +                Q     I+     VLI SYE + +    L
Sbjct: 200 TPEVNTIVLHGDRETRT--------------QLIEERILTCDFDVLITSYEMVIKEKAIL 245

Query: 422 RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
           +      ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P 
Sbjct: 246 KKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNFLLPD 305

Query: 482 LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541
           + G    F + F+      ++  + D+EI      +Q+L  ++  F++RR    + K L 
Sbjct: 306 VFGESEVFDEWFQ------QNEKAQDQEIV-----VQQLHAVLQPFLLRRVKADVEKSLL 354

Query: 542 CKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGG----TQPLKAIGVLKKLCNHPNX 597
            K E  ++V +   Q   Y  LL+ +D++ +   VG     T+ L  +  L+K CNHP  
Sbjct: 355 PKIETNVYVGMTAMQLQWYRSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP-- 411

Query: 598 XXXXXXXXXXXXXXXXXXYNMQGSK-----SRDVQPQFSGKFAILERFLHKIKTESDDKI 652
                             Y  +G++     + D    ++    I+   L K K +   ++
Sbjct: 412 ------------------YLFEGAEPGPPYTTDEHLIYNSGKMIVLDKLLKRKKKEGSRV 453

Query: 653 VLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAG 712
           ++ S  ++ LD++E  C  + +   R+DG  +  +R   +D FN  + ++FIFLL+++AG
Sbjct: 454 LIFSQMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAG 513

Query: 713 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQS 772
           G GINL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YR ++  +IEEK+ +R +
Sbjct: 514 GLGINLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAA 573

Query: 773 MKMSLSSCVV 782
            K+ L   V+
Sbjct: 574 QKLRLDQLVI 583

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH]
           (980963..985231) [4269 bp, 1422 aa]
          Length = 1422

 Score =  211 bits (538), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 147/481 (30%), Positives = 238/481 (49%), Gaps = 41/481 (8%)

Query: 309 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  P  
Sbjct: 378 ILADEMGLGKTVQTVSFISWLIFARRQNGPHLV-----VVPLSTMPAWQETFEKW-APEL 431

Query: 368 LSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVG 427
                +  +KS             H+  +   +NI   VL+ +YE + ++  +L      
Sbjct: 432 NCVYYMGNQKSRDVIREYEFYTNPHTKGK---KNIKFNVLLTTYEYILKDRLELGAIKWQ 488

Query: 428 LMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            +  DE HRLKN +S  + +L S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 489 FLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPGKFTIDQ 548

Query: 488 EFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHV 547
           E             D ++ DE   K E  ++ L   +  +I+RR    + K LP K E +
Sbjct: 549 EI------------DFENQDE---KQENYIRDLHKRLQPYILRRLKKDVEKSLPSKTERI 593

Query: 548 IFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQ--PLKAIGVLKKLCNHPNXXXXXXXXX 605
           + V L   Q + Y  +L +++ N +  G  GT    L  +  LKK  NHP          
Sbjct: 594 LRVELSDVQTEYYKNIL-TKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLFGNAENRV 652

Query: 606 XXXXXXXXXXYNMQGSKSRDVQPQ----FSGKFAILERFLHKIKTESDDKIVLISNYTQT 661
                         G++SR+   +     SGK  +L++ L ++K +   ++++ S   + 
Sbjct: 653 LAKFG--------DGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRM 703

Query: 662 LDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 721
           LD++      K  +  RLDGT+  ++R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 704 LDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 763

Query: 722 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+S  ++EE++ +R   KM L   +
Sbjct: 764 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 823

Query: 782 V 782
           +
Sbjct: 824 I 824

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  208 bits (529), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 250/532 (46%), Gaps = 64/532 (12%)

Query: 309  IMADEMGLGKTLQCIALMWT--LLRQGPQGKRLIDKC-----IIVCPSSLVNNWANELVK 361
            I+ D+MGLGKTLQ I ++ +   LRQ         +C     +IVCP SL  +W NE  +
Sbjct: 1335 ILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGHWENEFEQ 1394

Query: 362  WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421
            +      SP      K  + +G  +V + +    Q +  +I+    I SY+  R ++D +
Sbjct: 1395 Y------SPFL----KIVVYAGGPSVRQPLRK--QLSSADII----ITSYDVARNDLDTI 1438

Query: 422  RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
             + D    + DEGH +KN  S    A+  I    R+IL+GTPIQN++ E ++L +F  PG
Sbjct: 1439 SSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNNVVELWSLFDFLMPG 1498

Query: 482  LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541
             LGT   F++ F  PI  SR++ ++ +E   G   L+ L   V  F++RR  + +   LP
Sbjct: 1499 FLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLP 1558

Query: 542  CKYEHVIFVNLKPFQKDVYHRLLK------SRDVNKMVKGVGGTQPLKAIGVLKKLCNHP 595
             K     +  L   QK +Y    K       +D+             +A+  ++KLCNHP
Sbjct: 1559 PKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQHIFQALQYMRKLCNHP 1618

Query: 596  NXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQ--PQFSGKFAIL---------------- 637
                                    G    D++  P+ +    +L                
Sbjct: 1619 ---ALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAPKLTALRTLLFECGIGEADMDKKVTG 1675

Query: 638  ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSV---RLDGTMTINKRQKLVDR 694
            E+ L      S  + ++       LD+IE     ++  SV   RLDG++    RQK+V +
Sbjct: 1676 EQLLTG-SVISQHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLDGSVDPRDRQKVVRK 1734

Query: 695  FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
            FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQKK   +
Sbjct: 1735 FNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNV 1793

Query: 755  YRFISTGSIEEKIYQRQSMKMSLSSCVVD------AKEDVER---LFSSDNL 797
            YR ++ G++EEKI   Q  KM+++S VV+      A  D  +   LF +DN+
Sbjct: 1794 YRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDTDNV 1845

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  207 bits (526), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 149/492 (30%), Positives = 230/492 (46%), Gaps = 57/492 (11%)

Query: 309 IMADEMGLGKTLQCIALMWTL--LRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           I+ADEMGLGKT+Q I+L+  L  ++Q P         +++ P S + NW  E  KW    
Sbjct: 475 ILADEMGLGKTIQSISLITYLYEVKQEP------GPYLVIVPLSTITNWTLEFEKWAPSL 528

Query: 367 TL-----SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421
           T      +P      +  + SGN  V                   L+ +YE + ++   L
Sbjct: 529 TTIIYKGTPNQRHALQHKIRSGNFDV-------------------LLTTYEYIIKDKALL 569

Query: 422 RNCDVGLMLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
              +   M+ DEGHR+KN +S L+FT         R+IL+GTP+QN+L E +ALLNF  P
Sbjct: 570 SKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNFVLP 629

Query: 481 GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL 540
            +  +   F   F  P   +   +  +    +    +++L  ++  F++RR    + K L
Sbjct: 630 KIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDL 689

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA--------IGVLKKLC 592
           P K E V+   L   Q+ +Y ++LK    N +  G G     K         I  L+K+C
Sbjct: 690 PDKVEKVVKCKLSGLQQQLYQQMLKH---NALFVGAGTEGATKGGIKGLNNKIMQLRKIC 746

Query: 593 NHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKI 652
           NHP                    Y +            +GKF +L+R L K K  +  ++
Sbjct: 747 NHPFVFDEVEAVVNPSRGNSDLLYRV------------AGKFELLDRILPKFKA-TGHRV 793

Query: 653 VLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAG 712
           ++    TQ +D++E   R +    +RLDG+     R  ++  FN    + F FLLS++AG
Sbjct: 794 LIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAG 853

Query: 713 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQS 772
           G G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T S+EE I +R  
Sbjct: 854 GLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAM 913

Query: 773 MKMSLSSCVVDA 784
            K+ +   V+ A
Sbjct: 914 QKLDIDGKVIQA 925

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  206 bits (524), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 175/600 (29%), Positives = 275/600 (45%), Gaps = 96/600 (16%)

Query: 241  DEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQ 300
            D +K K  ++PV I       LR +Q EG+ +L           FL              
Sbjct: 1262 DPSKAKPFSLPVAI----KATLRKYQQEGINWL----------AFL-------------- 1293

Query: 301  NNRGAYGCIMADEMGLGKTLQCIALMWT---LLRQGPQGKRLIDK----CIIVCPSSLVN 353
            N+   +G I+ D+MGLGKTLQ I ++ +   L ++  +  + ++      +IVCP SL  
Sbjct: 1294 NHYHLHG-ILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPLPSLIVCPPSLTG 1352

Query: 354  NWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYET 413
            +W  E  ++  P  L+ L   G  S+       + +A               +++ SY+ 
Sbjct: 1353 HWEQEFEQY-AP-FLTVLVYAGGPSTRYPLRGKLGDA--------------DIVVTSYDV 1396

Query: 414  LRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 473
             R ++D +   D    + DEGH +KN  S    A+ SI    R+IL+GTPIQN++ E ++
Sbjct: 1397 ARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVELWS 1456

Query: 474  LLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRT- 532
            L +F  PG LG+   F++ F  PI  SR++ ++ +E   G   L+ L   V  F++RR  
Sbjct: 1457 LFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLK 1516

Query: 533  NDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLK------SRDVNKMVKGVGGTQPLKAIG 586
             D+LS  LP K     +  L   Q+ +Y    K       RD+   ++        +A+ 
Sbjct: 1517 EDVLSD-LPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQALQ 1575

Query: 587  VLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFL----- 641
             ++KLCNHP+                    +  G    D+    + K   L   L     
Sbjct: 1576 YMRKLCNHPS---LVLSKDHPQYNQVQDYLSQTGMDIHDI--AHAPKLGALRNLLLECGI 1630

Query: 642  -------HKIKTESDDKIV------LISNYTQTLDLIEKMCRNKHYSSV---RLDGTMTI 685
                   + I   S + ++      +       LD+IE     K+  SV   RLDG++  
Sbjct: 1631 GVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGSVES 1690

Query: 686  NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 745
              RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R
Sbjct: 1691 RDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAHR 1749

Query: 746  DGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVD------AKEDVER---LFSSDN 796
             GQKK   +YR I+ GS+EEKI   Q  KM+++S VV+      A  D  +   LF +DN
Sbjct: 1750 LGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVVNQQNAGLASMDTHQLLDLFDTDN 1809

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  206 bits (523), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 149/488 (30%), Positives = 229/488 (46%), Gaps = 49/488 (10%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-AP-KL 759

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428
              +A  G                    QA  +N    V++ ++E + +    L       
Sbjct: 760  RKIAFKGPPMERKP------------KQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807

Query: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
             + DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867

Query: 488  EFRKNFELPILRSRDADSTDEEITKGEEQ----LQKLSTIVSKFIIRRTNDILSKYLPCK 543
             F + F  P   +   D    +I   EE+    +++L  ++  F++RR    + K LP K
Sbjct: 868  SFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDK 923

Query: 544  YEHVIFVNLKPFQKDVYHRLLKSRDV-------NKMVKGVGGTQPLKAIGVLKKLCNHPN 596
             E V+   +   Q  +Y ++LK R +       N+      G      I  L+K+CNHP 
Sbjct: 924  VEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFN--NQIMQLRKICNHPF 981

Query: 597  XXXXXXXXXXXXXXXXXXXYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLIS 656
                                     ++ D   + +GKF +LER L K K  +  ++++  
Sbjct: 982  VFEEVEDQINP------------ARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFF 1028

Query: 657  NYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 716
              TQ +D++E   R      +RLDG    + R  L++ FN P    F FLLS++AGG G+
Sbjct: 1029 QMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGL 1088

Query: 717  NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMS 776
            NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  S+EE I  +   K+ 
Sbjct: 1089 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLD 1148

Query: 777  LSSCVVDA 784
            +   V+ A
Sbjct: 1149 IDGKVIQA 1156

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  204 bits (520), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 160/562 (28%), Positives = 260/562 (46%), Gaps = 54/562 (9%)

Query: 309  IMADEMGLGKTLQCIALMWT---LLRQGPQGKRLIDK----CIIVCPSSLVNNWANELVK 361
            I+ D+MGLGKTLQ I ++ +   L ++  +  R ++      +I+CP SL  +W NE  +
Sbjct: 1294 ILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQ 1353

Query: 362  WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421
            +      +P      K  + +G  TV   +    Q +  +I+    + SY+  R ++  L
Sbjct: 1354 Y------APFL----KVVVYAGGPTVRLTLR--PQLSDADII----VTSYDVARNDLAVL 1397

Query: 422  RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
               +    + DEGH +KN  S    A+  I    R+IL+GTPIQN++ E ++L +F  PG
Sbjct: 1398 NKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSLFDFLMPG 1457

Query: 482  LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541
             LGT   F++ F  PI  SR++ ++ +E   G   L+ L   V  F++RR  + +   LP
Sbjct: 1458 FLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLP 1517

Query: 542  CKYEHVIFVNLKPFQKDVYHRLLK------SRDVNKMVKGVGGTQPLKAIGVLKKLCNHP 595
             K     +  L   QK +Y    K       +D+       G     +A+  ++KLCNHP
Sbjct: 1518 PKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGKQHIFQALQYMRKLCNHP 1577

Query: 596  NXXXXXXXXXXXXXXXXXXXYNMQGSKSRDV--QPQFSGKFAIL------ERFLHKIKTE 647
                                    G    D+   P+ S    +L      E  + K  ++
Sbjct: 1578 ---ALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLLFECGIGEEDIDKKASQ 1634

Query: 648  ----------SDDKIVLISNYTQTLDLIEKMCRNKHYSSV---RLDGTMTINKRQKLVDR 694
                      S  + ++       LD++E     K+  SV   RLDG++    RQK+V +
Sbjct: 1635 DQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRK 1694

Query: 695  FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
            FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQKK   +
Sbjct: 1695 FNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNV 1753

Query: 755  YRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHET 814
            YR I+ G++EEKI   Q  KM+++S VV+ +        +  L  LF  ++ T  +  E 
Sbjct: 1754 YRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPDNVTSQDNEEK 1813

Query: 815  YHCKRCNAAGKQSVRSTAMLYG 836
             +     A G + + +   L G
Sbjct: 1814 NNGDSQAAKGMEDIANETGLTG 1835

>Scas_664.9
          Length = 1859

 Score =  201 bits (511), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 244/551 (44%), Gaps = 78/551 (14%)

Query: 309  IMADEMGLGKTLQCIALMWT--LLR-------QGPQGKRLIDKCIIVCPSSLVNNWANEL 359
            I+ D+MGLGKTLQ I ++ +   LR          + ++L    +IVCP SL  +W NE 
Sbjct: 1289 ILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVETRKL--PSLIVCPPSLTGHWENEF 1346

Query: 360  VKWL----------GPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLII 409
             ++           GP    PL     +  L S +                     ++I 
Sbjct: 1347 EQYAPFLKIIVYAGGPSMRIPL-----RDELGSAD---------------------IVIT 1380

Query: 410  SYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLS 469
            SY+  R ++  +   D    + DEGH +KN  S    A+  I+   R+IL+GTPIQN++ 
Sbjct: 1381 SYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNNVV 1440

Query: 470  EYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFII 529
            E ++L +F  PG LGT   F++ F  PI  SR++ ++ +E   G   L+ L   V  F++
Sbjct: 1441 ELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFML 1500

Query: 530  RRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLK------SRDVNKMVKGVGGTQPLK 583
            RR  + +   LP K     +  L   QK +Y    K       +D+             +
Sbjct: 1501 RRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNSQHIFQ 1560

Query: 584  AIGVLKKLCNHPNXXXXXXXXXXXXXXXXXXXYNMQGSKSRDV--QPQFSGKFAIL---- 637
            A+  ++KLCNHP                        G    DV   P+ +    +L    
Sbjct: 1561 ALQYMRKLCNHP---ALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPKLNALRTLLFECG 1617

Query: 638  ------------ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSV---RLDGT 682
                         ++L      S  + ++       LD++E     ++  SV   RLDG+
Sbjct: 1618 IGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMPSVTYMRLDGS 1677

Query: 683  MTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 742
            +    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R
Sbjct: 1678 VDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1736

Query: 743  VWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
              R GQKK   +YR I+ G++EEKI   Q  KM+++S VV+ +        +  L  LF 
Sbjct: 1737 AHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFD 1796

Query: 803  YNDKTICETHE 813
             +D    E  E
Sbjct: 1797 TDDVPSQENEE 1807

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  186 bits (473), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 154/532 (28%), Positives = 244/532 (45%), Gaps = 90/532 (16%)

Query: 307  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
             CI+ADEMGLGKT Q I+ +  L +    G  L+     V PSS + NW  E  K+    
Sbjct: 522  SCILADEMGLGKTCQVISFLAYLKQTHHNGPHLV-----VVPSSTLENWLREFNKFCPHL 576

Query: 367  TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYET---LRRNVDQLRN 423
             + P    G +   A     + E    +           V++ +Y      + +V  LRN
Sbjct: 577  KVEPYY--GSQQERAELRDILEENEGQY----------DVIVTTYNLAAGTKYDVSFLRN 624

Query: 424  CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 483
             +  +++ DEGH LKN  S  F  L  IN   R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 625  RNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPNLF 684

Query: 484  GTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCK 543
             ++ +          R+ DAD     +   E  +++  T++  FI+RR  D + K+LP K
Sbjct: 685  VSKKDDLATVFKQKTRTSDADKGYNPLL-AEHAIERAKTMMKPFILRRKKDQVLKHLPRK 743

Query: 544  YEHVIFVNLKPFQKDVYHRLLKS-----RDVNKMVKGVGGTQPLKA--IGVLKKLCNHPN 596
            + H++   +   QK +Y + +K      R + + VK    ++ +    I  L+K   HP 
Sbjct: 744  HNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNLIMALRKASIHP- 802

Query: 597  XXXXXXXXXXXXXXXXXXXYN----MQGSKSRDVQPQF--SGKFAILE------------ 638
                               YN     + SK+   +P++  +G    ++            
Sbjct: 803  -------------LLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELH 849

Query: 639  ----RF--LHKIKTESDD---------------KIV--------LISNYTQTLDLIEKMC 669
                +F  L+K K +SD+               KI+        + S +TQ LD++E + 
Sbjct: 850  KLCCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVL 909

Query: 670  RNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDP 729
               +   +RLDG   +N RQ L+DRF + +    +FLLS+KAGG GINL+ AN +I+ D 
Sbjct: 910  STLNIKFLRLDGQTQVNDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQ 968

Query: 730  DWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781
             +NP  D+QA  R  R GQ K+  +   IS  +IEEKI      K++L + +
Sbjct: 969  SFNPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  124 bits (312), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 139/265 (52%), Gaps = 27/265 (10%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKT+Q IAL+  +     +G  LI       P S V NW NE  ++  P   
Sbjct: 219 ILADEMGLGKTIQSIALLAFIYEMDTKGPFLI-----AAPLSTVENWMNEFARF-APDI- 271

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSW-AQATGRNIVKPVLIISYETLRRNVDQLRNCDVG 427
            P+        L   NS    A H+   +    N  + V+I SYE + R+++ + +    
Sbjct: 272 -PV--------LKYYNSEGQAARHAMMGKFFKNNKGEGVIITSYEIIIRDIELILSYQWK 322

Query: 428 LMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487
            ++ DEGHRLKN +      L  IN   R++L+GTP+QN+L E ++LLNF  P +     
Sbjct: 323 FLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFE 382

Query: 488 EFRKNFELPILRSRDADSTDEEITK-GEEQLQK-----LSTIVSKFIIRR-TNDILSKYL 540
            F K F+   L   + +S+ E++TK   ++L+K     L TI+  F++RR   ++L+  L
Sbjct: 383 IFNKWFDFSDL---NLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSL 439

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLK 565
           P K E++I   + P QK  Y + LK
Sbjct: 440 PPKREYIITCPVTPLQKKYYKQALK 464

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (51%), Gaps = 11/235 (4%)

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
           SGK  +L++ + ++  +   K+++ S +   LDLIE      ++ S R+DG+M  N R++
Sbjct: 571 SGKLQVLQKLVPEL-IKKKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKE 629

Query: 691 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            ++ F+    +  +FLLS++A G GINL  A+ +I+ D DWNP  D QA+ R  R GQ K
Sbjct: 630 QIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTK 689

Query: 751 DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICE 810
              +YR     +IE  I  R   K  L   V+       ++   + L++L  +N++T  +
Sbjct: 690 PVIVYRLYCDNTIENVIMTRAVNKRKLEKLVI-------QMGKFNTLKKL-AFNEQTFLK 741

Query: 811 TH-ETYHCKRCNAAGKQSVRS-TAMLYGDPTTWNHLNHAALEKTNDHLLQNEFQH 863
            +  +       +A K+ V+  + +L  + T     + + +E ++D L ++E + 
Sbjct: 742 MNGSSLATTTKQSANKELVKELSQLLISNETNQGQADTSKIENSDDILEESEMKE 796

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  122 bits (307), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/308 (30%), Positives = 149/308 (48%), Gaps = 42/308 (13%)

Query: 308 CIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           CI+ADEMGLGKT Q I+ +  L  Q   G  L+     V PSS + NW  E  K+     
Sbjct: 492 CILADEMGLGKTCQVISFLAYLKEQNHTGPHLV-----VVPSSTLENWLREFKKFCPQLK 546

Query: 368 LSPLAVDGKKSS-----LASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLR 422
           + P     ++ +     L   +      V ++  A+G               + +V  L+
Sbjct: 547 IEPYYGSQQERAELRDILEENDGQYDAIVTTYNLASGN--------------KADVSFLK 592

Query: 423 NCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 482
           N    +++ DEGH LKN  S  FT L  I+   R++L+GTP+QN+L E  +LL F  P L
Sbjct: 593 NRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFIMPSL 652

Query: 483 -LGTRSEFRKNFELPILRSRDADST-DEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYL 540
            +  + E    F+    R+R +DS  D      +E + +  TI+  FI+RR  D + K+L
Sbjct: 653 FVSKKDELAAVFK---QRARTSDSNKDYNPLLAQEAIDRAKTIMKPFILRRRKDQVLKHL 709

Query: 541 PCKYEHVIFVNLKPFQKDVYHRLLK-SRDVNKMVK-GV----GGTQPLKA-------IGV 587
           P K+ H+ + ++ P Q+ +Y+R ++   +  +MV+ GV     G + L A       I  
Sbjct: 710 PAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALVAQSTSKNLIMA 769

Query: 588 LKKLCNHP 595
           L+K   HP
Sbjct: 770 LRKAAIHP 777

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 93/157 (59%), Gaps = 2/157 (1%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            SGK   L+  L +      +K ++ S +TQ LD++E +  +   + +RLDG+  +N RQ 
Sbjct: 846  SGKVHRLQPLL-RAAIARREKTLVFSLFTQVLDILELVLSSLGIAFLRLDGSTPVNDRQA 904

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            L+DRF+  +    +FLLS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ +
Sbjct: 905  LIDRFH-TDTDVPVFLLSTKAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTR 963

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKED 787
            +  +   +S  ++EEKI Q    K++L S V D + D
Sbjct: 964  EVAVTTLVSRATVEEKILQLARHKLALDSSVSDRRAD 1000

>Scas_520.5
          Length = 863

 Score =  122 bits (306), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 140/311 (45%), Gaps = 44/311 (14%)

Query: 261 ILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTL 320
           +L+P+Q+EG+ +L                                   I+AD+MGLGKT+
Sbjct: 270 VLKPYQLEGLNWLITLY-------------------------ENGLNGILADDMGLGKTI 304

Query: 321 QCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSL 380
           Q IAL+  +     +G  LI       P S V+NW NE  K+      +P     K    
Sbjct: 305 QSIALLAFIYEMDTKGPFLI-----AAPLSTVDNWMNEFEKF------APDLPVLKYYHP 353

Query: 381 ASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNG 440
              N       + + +  G  IV    + SYE + R+ D + +     ++ DEGHRLKN 
Sbjct: 354 GGKNERNKLMRNFFKKTNGTGIV----VTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNV 409

Query: 441 DSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRS 500
           +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +      F K F+   L  
Sbjct: 410 NCRLIQELKRINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFTDFEIFNKWFDFKDLEM 469

Query: 501 RDADSTDEEITKGEEQ---LQKLSTIVSKFIIRRTND-ILSKYLPCKYEHVIFVNLKPFQ 556
               S   ++   E Q   +  L TI+  F++RR    +L+  LP K E+V+   L P Q
Sbjct: 470 ESNSSKLNKVINEELQKNLISNLHTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQ 529

Query: 557 KDVYHRLLKSR 567
           K  Y R L+ +
Sbjct: 530 KKFYKRGLEGK 540

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 87/152 (57%), Gaps = 1/152 (0%)

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
           SGK   L+R +  +  +   KI++ S +   LDL+E  C     ++ R+DGT+    R++
Sbjct: 650 SGKLKTLQRLVIPLIAKGH-KILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKE 708

Query: 691 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            + +FND + +  +FLLS++A G G+NL+GA+ ++L D DWNP  D QA+ R  R GQ K
Sbjct: 709 QLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTK 768

Query: 751 DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
              +YRF    ++E  I  R + K  L   V+
Sbjct: 769 PVIVYRFCCDNTLEHVILTRAANKRKLERLVI 800

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  122 bits (305), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 173/372 (46%), Gaps = 60/372 (16%)

Query: 229 KSLKELLGSSEEDEAKKKFPNVPVVIDPKLTK--ILRPHQVEGVKFLYRCVTGLVMKDFL 286
           K++ E    S++  A +K P  P +  P L +   L+P+QVEGV +L             
Sbjct: 153 KTVVEFFKRSKQQPADEKQPE-PSIQQPTLVRNCTLKPYQVEGVNWL------------- 198

Query: 287 DAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIV 346
                   I   E    G    I+ADEMGLGKT+Q IAL+  +     +G  L+      
Sbjct: 199 --------ITLYENGLNG----ILADEMGLGKTIQSIALLAFIYEMDTRGPFLV-----T 241

Query: 347 CPSSLVNNWANELVKWLGPG--TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK 404
            P S+V+NW  E  K+  P    L   + DG        ++ + E          +N  +
Sbjct: 242 APLSVVDNWITEFEKF-APSIPVLKYYSADGP----GKRHAILKEFFR-------KNSGE 289

Query: 405 PVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPI 464
            V++ SYE + R+++ + +     ++ DEGHRLKN +      L  IN   R++L+GTP+
Sbjct: 290 GVVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPL 349

Query: 465 QNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQK----- 519
           QN+L+E ++LLNF  P +      F K F+   L  + +    ++I  GEE L+K     
Sbjct: 350 QNNLAELWSLLNFILPDVFADFEIFSKWFDFSDLDLKTSSQRWDKII-GEE-LEKNLVTN 407

Query: 520 LSTIVSKFIIRRTND-ILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGG 578
           L TI+  F++RR    +L+  LP K E++I   L P Q   Y   L  +     +K    
Sbjct: 408 LHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGK-----LKRTVF 462

Query: 579 TQPLKAIGVLKK 590
           TQ +K    L +
Sbjct: 463 TQAIKEFFTLNR 474

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 93/165 (56%), Gaps = 5/165 (3%)

Query: 622 KSRDVQP----QFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSV 677
           K+ D+Q     Q SGK  IL++ L ++   +  K+++ S +   LDLIE  C   +YS+ 
Sbjct: 547 KAEDLQLPVLLQTSGKLQILQQLLPRL-LAAKHKVLIFSQFVSMLDLIEDWCELNNYSAC 605

Query: 678 RLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 737
           R+DG+M    R++ ++ F++      +FLLS++AGG GINL  A+ +IL D DWNP  D 
Sbjct: 606 RIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDL 665

Query: 738 QALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
           QA+ R  R GQ+    +YR     ++E  I  R + K  L   V+
Sbjct: 666 QAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNKRKLEQLVI 710

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  120 bits (302), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 99/334 (29%), Positives = 155/334 (46%), Gaps = 54/334 (16%)

Query: 238 SEEDEAKKKFPNVPVVIDPKLTK--ILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGI 295
           +E+   +   P+   +  P+L K  IL+P+Q+EG+ +L                      
Sbjct: 196 NEDTTTQNGAPDDAAIKQPRLLKNCILKPYQLEGLNWLITLY------------------ 237

Query: 296 VKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNW 355
                        I+ADEMGLGKT+Q IAL+  +     +G  L+       P S ++NW
Sbjct: 238 -------ENGLNGILADEMGLGKTVQSIALLAFIYEMDTKGPFLV-----TAPLSTLDNW 285

Query: 356 ANELVKWLGPG--TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYET 413
            NE  K+  P    L     +G K          A+  + + Q  G  IV    I SYE 
Sbjct: 286 MNEFAKF-APDLPVLKYYGTNGYKER-------SAKLKNFFKQHGGTGIV----ITSYEI 333

Query: 414 LRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 473
           + R+ D + + +   ++ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++
Sbjct: 334 ILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWS 393

Query: 474 LLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKG-EEQLQK-----LSTIVSKF 527
           LLNF  P +      F K F+   L +  + S  E + K   ++LQK     L TI+  F
Sbjct: 394 LLNFIMPDIFADFEIFNKWFDFDSL-NLGSGSNSEALNKLINDELQKNLISNLHTILKPF 452

Query: 528 IIRRTND-ILSKYLPCKYEHVIFVNLKPFQKDVY 560
           ++RR    +L+  LP K E++I   +   Q+  Y
Sbjct: 453 LLRRLKKVVLANILPPKREYIINCPMTSAQEKFY 486

 Score =  112 bits (279), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 89/152 (58%), Gaps = 1/152 (0%)

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
           SGK  IL++ +  + +E   K+++ S +   LDLIE  C    +++ R+DG++    R+ 
Sbjct: 602 SGKLQILQKLIPPLISEGH-KVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKD 660

Query: 691 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            +++FN  + +  IFLLS++A G GINL+GA+ ++L D DWNP  D QA+ R  R GQ+ 
Sbjct: 661 QLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQES 720

Query: 751 DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
              +YR     +IE  I  R + K +L   V+
Sbjct: 721 PVIVYRLCCDNTIEHVILTRAANKRNLERMVI 752

>Scas_548.4
          Length = 1054

 Score =  118 bits (296), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            SGK   L R L +I  E  +K+++ S +TQ LD++E +    +Y  +RLDG+  +N RQ 
Sbjct: 872  SGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQS 931

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 932  LIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 990

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781
            +  I   I+  SIEEKI+Q    K++L S +
Sbjct: 991  EVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

 Score =  108 bits (270), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 135/285 (47%), Gaps = 36/285 (12%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
            CI+AD+MGLGKT Q I+    L +    G  L+     V PSS + NW  E  K+    
Sbjct: 516 SCILADDMGLGKTCQVISFFAYLKQINEPGPHLV-----VVPSSTLENWLREFQKFCPTL 570

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRN---VDQLRN 423
            + P    G ++  A     +      +           V++ +Y     N   V  LRN
Sbjct: 571 KIEPYY--GSQNERADLREILERTAGQYD----------VIVTTYNLAAGNKYDVSFLRN 618

Query: 424 CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 483
               +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 619 RQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLRELMSLLEFIMPALF 678

Query: 484 GTRSEFRKNFELPILRSRDADSTDEEITKG------EEQLQKLSTIVSKFIIRRTNDILS 537
            ++ E      L  +  + A +TD+   KG      +E +++  T++  FI+RR  D + 
Sbjct: 679 ISKKE-----SLASVFKQRAKTTDD--NKGHNPLLVQEAIERAKTMMKPFILRRRKDQVL 731

Query: 538 KYLPCKYEHVIFVNLKPFQKDVYHRLLKS-RDVNKMVKGVGGTQP 581
           K+LP K+  + +  ++  Q+ +Y   +K+  +  KM+  + GT P
Sbjct: 732 KHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMI--LDGTLP 774

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  118 bits (296), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 98/156 (62%), Gaps = 1/156 (0%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            SGK   L++ L  I  +  +K+++ + +TQ LD++EK+    +Y  +RLDG+  +N RQ 
Sbjct: 948  SGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVLSTLNYKFLRLDGSTQVNDRQT 1007

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            ++D+F D +    IF+LS++AGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 MIDKFYD-DNTIPIFMLSTRAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKE 786
            +  +   I+  SIEEKI+Q    K++L S V  +++
Sbjct: 1067 EVTVTTLITKDSIEEKIFQLAKTKLALDSQVSSSED 1102

 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 130/268 (48%), Gaps = 35/268 (13%)

Query: 308 CIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGT 367
           CI+AD+MGLGKT Q I+ +  L + G     LI     V PSS + NW  E  K+     
Sbjct: 593 CILADDMGLGKTCQVISFLAYLKQIGQPSPHLI-----VVPSSTLENWLREFQKFCPSLK 647

Query: 368 LSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETL----RRNVDQLRN 423
           + P    G +   A              +   RN  K  +I++   L    + +V  L+ 
Sbjct: 648 IEPYY--GTQQERAD-----------LREILERNDGKYDVIVTTYNLAAGNKYDVSFLKT 694

Query: 424 CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 483
            +  +++ DEGH LKN  S  F  L  I+   R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 695 RNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIMPNLF 754

Query: 484 GTRSEFRKNFELPILRSRDADSTDEEITKG------EEQLQKLSTIVSKFIIRRTNDILS 537
            ++ E      L  +  + A ++D+   KG      ++ + +  T++  FI+RR  D + 
Sbjct: 755 VSKKE-----SLAAVFKQRAKTSDD--NKGHNPLLAQQAITRAKTMMKPFILRRRKDQVL 807

Query: 538 KYLPCKYEHVIFVNLKPFQKDVYHRLLK 565
           K+LP K+    +  +   Q+++Y+R +K
Sbjct: 808 KHLPAKHVRTSYCAMNDTQREIYNREVK 835

>Kwal_55.20143
          Length = 1494

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/400 (26%), Positives = 177/400 (44%), Gaps = 78/400 (19%)

Query: 223 TNGVRNKSLKE---------LLGSSEEDEAKKKFPNVPVVIDPKLTK-ILRPHQVEGVKF 272
           +N V+ ++LKE         +L + E+DE      +VP    P L +  LR +Q +G+ +
Sbjct: 625 SNDVKTENLKEEQVEEKTEGVLDNEEKDEDSLAVVDVPT---PSLLRGTLRIYQKQGLNW 681

Query: 273 LYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQ 332
           L              A   N        N  G    I+ADEMGLGKT+Q I+L+  L  +
Sbjct: 682 L--------------ASLYNN-------NTNG----ILADEMGLGKTIQTISLLAYLACE 716

Query: 333 ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVA 388
               GP         +I+ P+S++ NW  E  K   PG         K  +         
Sbjct: 717 KHNWGPH--------LIIVPTSVLLNWEMEF-KRFAPGF--------KVLTYYGSPQQRK 759

Query: 389 EAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTAL 448
           E    W +    +    V I SY+ +  +    +      M+ DE H +KN  S  + AL
Sbjct: 760 EKRKGWNRPDAFH----VCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQAL 815

Query: 449 DSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR---------SEFRKNFELP--- 496
            + N  RR++L+GTP+QN+L+E ++LL F  P   GT            F++ F  P   
Sbjct: 816 LNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDK 875

Query: 497 ILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQ 556
           I+++ +  + DEE  K    + KL  ++  +++RR    + K +P K+EHV++  L   Q
Sbjct: 876 IIQTGEGYAQDEETRKT---VTKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQ 932

Query: 557 KDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPN 596
           + +Y   +      + +        +  +  L+K+CNHP+
Sbjct: 933 RFLYDDFMSRAQTKETLSSGNFMSIINCLMQLRKVCNHPD 972

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 94/169 (55%), Gaps = 7/169 (4%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L   L  +K     + ++ +  T+ LD++E+      Y  +RLDG   I +RQ L
Sbjct: 1217 GKLQKLATLLRDLKN-GGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQIL 1275

Query: 692  VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 751
             +RFN  + +   F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1276 TERFN-TDNRITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 752  CFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQL 800
              IYRF+S  +IE  I ++ + K  L + V+   +     F++D L +L
Sbjct: 1335 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGD-----FTTDYLTKL 1378

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 146/314 (46%), Gaps = 50/314 (15%)

Query: 261 ILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTL 320
           +L+P+Q+EG+ +L                              G  G I+ADEMGLGKT+
Sbjct: 218 VLKPYQMEGLNWLITLYEN------------------------GLNG-ILADEMGLGKTI 252

Query: 321 QCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSL 380
           Q IAL+  +     +G  LI       P S V+NW NE  K+  P    P+     K   
Sbjct: 253 QSIALLSFIYEMDTKGPFLI-----AAPLSTVDNWMNEFAKF-APEI--PIL----KYYS 300

Query: 381 ASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNG 440
            +G     + +  + +   R   + V++ SYE + R+ + +       ++ DEGHRLKN 
Sbjct: 301 QNGQDARQKLLKKFFKNNNR---EGVIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNI 357

Query: 441 DSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRS 500
           +      L  IN   R++L+GTP+QN+LSE ++LLNF  P +      F K F+    + 
Sbjct: 358 NCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFADFEIFNKWFD---FKD 414

Query: 501 RDADSTDEEITKG-EEQLQK-----LSTIVSKFIIRRTNDILSK-YLPCKYEHVIFVNLK 553
            D  S   ++ K   ++L+K     L TI+  F++RR   ++ K  LP K E+++   L 
Sbjct: 415 LDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLS 474

Query: 554 PFQKDVYHRLLKSR 567
           P Q   Y   L  +
Sbjct: 475 PIQTKFYRMALSGK 488

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 82/152 (53%), Gaps = 1/152 (0%)

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
           SGK  +L++    +  +   KI++ S +   LDL+E       ++S+R+DG +    R++
Sbjct: 594 SGKLQMLQKLAIPL-IKKGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGGVDNESRKE 652

Query: 691 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            +D FN       IFLLS++A G GINL+ A+ +I+ D DWNP  D QA+ R  R GQ K
Sbjct: 653 YIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTK 712

Query: 751 DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
              +YRF    +IE  I  R   K  L   V+
Sbjct: 713 PVIVYRFCCDNTIEHVILTRAVNKRKLERMVI 744

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 99/163 (60%), Gaps = 1/163 (0%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            SGK   L++ L  I  +  +K+++ S +TQ LD++E +     Y  +RLDG+  +N RQ 
Sbjct: 948  SGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVNDRQL 1007

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 LIDKFYEDKDIP-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFS 793
            +  I   I+  SIEEKI+Q    K++L S + + K+  + L S
Sbjct: 1067 EVNITTLITKDSIEEKIHQLAKNKLALDSYISEDKKSQDVLES 1109

 Score =  112 bits (281), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 129/264 (48%), Gaps = 31/264 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
            CI+AD+MGLGKT Q I+    L +    G  L+     V PSS + NW  E  K+    
Sbjct: 592 SCILADDMGLGKTCQVISFFAYLKQINEPGPHLV-----VVPSSTLENWLREFQKFAPAL 646

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETL----RRNVDQLR 422
            + P            G+    E +    +   RN  K  +I++   L    + +V  L+
Sbjct: 647 KIEPYY----------GSLQEREELRDILE---RNAGKYDVIVTTYNLAAGNKYDVSFLK 693

Query: 423 NCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 482
           N +  +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L
Sbjct: 694 NRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNL 753

Query: 483 LGTRSEFRKNFELPILRSRDADSTDEEITK----GEEQLQKLSTIVSKFIIRRTNDILSK 538
             ++ E   +F+  I + R A +TD+         +E + +  T++  FI+RR  D + K
Sbjct: 754 FISKKE---SFD-AIFKQR-AKTTDDNKNHNPLLAQEAITRAKTMMKPFILRRRKDQVLK 808

Query: 539 YLPCKYEHVIFVNLKPFQKDVYHR 562
           +LP K+ H+ +  L   QK +Y +
Sbjct: 809 HLPPKHTHIQYCELNAIQKKIYDK 832

>Scas_669.20
          Length = 1397

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 146/300 (48%), Gaps = 33/300 (11%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
           I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K++    +
Sbjct: 667 ILADEMGLGKTVQSISVLAHL----AEKHNIWGPYLVVTPASTLHNWVNEITKFVPQFKI 722

Query: 369 SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKP----VLIISYETLRRNVDQLRNC 424
            P            GN+   + +  +         K     V+I SY+ +  +V  L+  
Sbjct: 723 LPYW----------GNAADRKVLRKFWDRKNLRYTKDSPFHVMITSYQMVVSDVTYLQKM 772

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 484
               M+ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P L  
Sbjct: 773 KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFD 832

Query: 485 TRSEFRKNFELPILRSRDADSTDEEITK-GEEQLQKLSTIVSKFIIRRTNDILSKYLPCK 543
           +  EF + F      ++D +S  E  T+   +QL++L  I+  F++RR    +   L  K
Sbjct: 833 SHDEFSEWF------AKDIESHAEANTQLNHQQLRRLHMILKPFMLRRVKKNVQSELGDK 886

Query: 544 YEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKA-------IGVLKKLCNHPN 596
            E  +  +L   Q  +Y ++LKS      ++   G+    +       +   +K+CNHP+
Sbjct: 887 IEIDVLCDLTQRQAKLY-QVLKSTSNYDAIENAAGSDEFSSDQNLVNTVMQFRKVCNHPD 945

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 89/156 (57%), Gaps = 4/156 (2%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L ++K E   ++++    T+ +DL+E+    + Y+ +RLDG+  +  R+ 
Sbjct: 1219 SAKLKKLDELLVQLKREGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1277

Query: 691  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            LV D    PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1278 LVHDWQTKPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1335

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785
            +   +YR +  G+IEE++  R   K  +   V++ K
Sbjct: 1336 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGK 1371

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  110 bits (274), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 89/164 (54%), Gaps = 6/164 (3%)

Query: 623 SRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGT 682
           S DV  Q SGK  IL++ + K+  E   K+++ S +   LDLIE  C    + + R+DG+
Sbjct: 25  SLDVLLQTSGKLQILQQLVPKLINEGH-KVLIFSQFVNMLDLIEDWCELNDFQACRIDGS 83

Query: 683 MTINKRQKLVDRFN----DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQ 738
           M    RQ+ + +FN    D    + +FLLS++AGG GINL  A+ +++ D DWNP  D Q
Sbjct: 84  MDNEVRQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQ 142

Query: 739 ALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
           A+ R  R GQ +   +YR     ++E  I  R   K  L   V+
Sbjct: 143 AMDRTHRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVI 186

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 89/309 (28%), Positives = 149/309 (48%), Gaps = 42/309 (13%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368
            I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K+L    +
Sbjct: 728  ILADEMGLGKTVQSISVLAHL----AENHNIWGPFLVVTPASTLHNWVNEISKFLPQFKI 783

Query: 369  SPLAVDGKKSSLASGNSTVAEAVHS-WAQATGR---NIVKPVLIISYETLRRNVDQLRNC 424
             P            GN+   + +   W +   R   N    V++ SY+ +  + + L+  
Sbjct: 784  LPYW----------GNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKM 833

Query: 425  DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 484
                M+ DE   +K+  S  +  L S +C  R++L+GTPIQN + E +ALL+F  P L  
Sbjct: 834  KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFD 893

Query: 485  TRSEFRKNFELPILRSRDADSTDEEITK-GEEQLQKLSTIVSKFIIRRTNDILSKYLPCK 543
            +  EF + F      S+D +S  E  TK  ++QL++L  I+  F++RR    +   L  K
Sbjct: 894  SHDEFNEWF------SKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDK 947

Query: 544  YEHVIFVNLKPFQKDVYHRLLKSR---------------DVNKMVKGVGGTQPL-KAIGV 587
             E  +  +L   Q  +Y ++LKS+                 +      G  Q L  A+  
Sbjct: 948  IEIDVLCDLTQRQAKLY-QVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQ 1006

Query: 588  LKKLCNHPN 596
             +K+CNHP+
Sbjct: 1007 FRKVCNHPD 1015

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 91/156 (58%), Gaps = 4/156 (2%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L K+K+E   ++++    T+ +DL+E+    + Y+ +RLDG+  +  R+ 
Sbjct: 1298 SAKLRKLDELLVKLKSEGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1356

Query: 691  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            LV D   +PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1357 LVHDWQTNPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1414

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785
            +   +YR +  G+IEE++  R   K  +   V++ K
Sbjct: 1415 RQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1450

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  115 bits (289), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L   L ++K +   + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1178 GKLQKLAILLQQLK-DGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1236

Query: 692  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
             +RFN DP+    +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1237 TERFNSDPKIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1294

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
            D  IYRF+S  +IE  I ++ + K  L   ++   E     FS  +++ LF
Sbjct: 1295 DVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEFTTDYFSKLSVKDLF 1345

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 145/303 (47%), Gaps = 38/303 (12%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  K   
Sbjct: 650 ILADEMGLGKTIQTISLLSYLACEKHNWGPH--------LIVVPTSVLLNWEMEF-KRFA 700

Query: 365 PGTLSPLAVDGKKSSLASGN-STVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRN 423
           PG          K     GN     E    W +    +    V I+SY+ + ++    + 
Sbjct: 701 PGF---------KVLTYYGNPQQRKEKRKGWNKPDAFH----VCIVSYQLIVQDQHSFKR 747

Query: 424 CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 483
                M+ DE H +KN  S  + AL + N  RR++L+GTP+QN+++E ++LL F  P  +
Sbjct: 748 KKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTV 807

Query: 484 ---------GTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTND 534
                         F++ F  P+ +  +   T E+  + +  ++KL  ++  +++RR   
Sbjct: 808 IDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKA 867

Query: 535 ILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPL-KAIGVLKKLCN 593
            + K +P KYEH+++  L   Q+ +Y   + SR   K     G    +   +  L+K+CN
Sbjct: 868 DVEKQIPGKYEHIVYCKLSKRQRFLYDDFM-SRAQTKATLASGNFMSIVNCLMQLRKVCN 926

Query: 594 HPN 596
           HP+
Sbjct: 927 HPD 929

>Kwal_27.11388
          Length = 1334

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 174/375 (46%), Gaps = 62/375 (16%)

Query: 239 EEDEAKKKFPNV--PVVID-PKL-TKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTG 294
           E+DE   + P     + ID PKL T  L+ +Q++G+ +L              A   + G
Sbjct: 567 EDDELNFQNPTSLGEITIDQPKLLTCTLKEYQLKGLNWL--------------ANLYDQG 612

Query: 295 IVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNN 354
           I             I+ADEMGLGKT+Q I+++  L     +   +    I+V P+S ++N
Sbjct: 613 I-----------NGILADEMGLGKTVQSISVLAHL----AENYNIWGPFIVVTPASTLHN 657

Query: 355 WANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQAT---GRNIVKPVLIISY 411
           W NE+ K+L    + P   +G    +             W +     G++    V++ SY
Sbjct: 658 WVNEISKFLPDFKILPYWGNGNDRKILR---------RFWDRKQFRYGKDAPFHVMVTSY 708

Query: 412 ETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEY 471
           + +  +   L+      M+ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E 
Sbjct: 709 QMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQEL 768

Query: 472 FALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITK-GEEQLQKLSTIVSKFIIR 530
           +ALL+F  P L  +  EF   F      S+D +S  +  TK  ++QL++L  I+  F++R
Sbjct: 769 WALLHFIMPSLFDSHDEFSDWF------SKDIESHAQSNTKLNQQQLRRLHMILKPFMLR 822

Query: 531 RTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSR--DVNKMVKGVGGTQP------- 581
           R    +   L  K E  +  +L   Q  +Y ++LKS+       ++   G+         
Sbjct: 823 RIKKNVQSELGEKIEIDVMCDLTRRQHKLY-QVLKSQMSAAYDAIENAAGSDEASSDQNI 881

Query: 582 LKAIGVLKKLCNHPN 596
           +  +   +K+CNHP+
Sbjct: 882 VNTVMQFRKVCNHPD 896

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 95/165 (57%), Gaps = 7/165 (4%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L  +K ++D ++++    T+ +DL+E+    + Y  +RLDG+  +  R+ 
Sbjct: 1169 STKLKKLDELLVNLK-KNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRD 1227

Query: 691  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            LV D    PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1228 LVHDWQTKPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1285

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK---EDVERL 791
            +   +YR +  G+IEE++  R   K  +   V++ K   +D+++L
Sbjct: 1286 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQEKDIQQL 1330

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
            complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 94/171 (54%), Gaps = 4/171 (2%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L   L ++K E   + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1217 GKLQSLAVLLRRLKEEGH-RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 692  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1276 TERFNTDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1333

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
            D  IYRF S  +IE  I ++ + K  L + V+   E     FS  +++ L 
Sbjct: 1334 DVHIYRFASEHTIESNILKKANQKRQLDNIVIQKGEFTTDYFSRLSVKDLL 1384

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 157/368 (42%), Gaps = 66/368 (17%)

Query: 245 KKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRG 304
           +K   V V + P L   LR +Q +G+ +L              A   N        N  G
Sbjct: 654 EKLSVVDVPVPPLLRGTLRTYQKQGLNWL--------------ASLYNN-------NTNG 692

Query: 305 AYGCIMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELV 360
               I+ADEMGLGKT+Q IAL+  L  +    GP         +I+ P+S++ NW  E  
Sbjct: 693 ----ILADEMGLGKTIQTIALLAYLACEKENWGPH--------LIIVPTSVLLNWEMEF- 739

Query: 361 KWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQ 420
           K   PG         K  S         E    W +    +    V I SY+ +  +   
Sbjct: 740 KRFAPGF--------KVLSYYGSPQQRKEKRRGWNKLDAFH----VCITSYQLVVHDQHS 787

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
            +      M+ DE H +KN  S  + AL + N  RR++L+GTP+QN+++E ++LL F  P
Sbjct: 788 FKRKKWQYMILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFLMP 847

Query: 481 GL---------LGTRSEFRKNFELP---ILRSRDADSTDEEITKGEEQLQKLSTIVSKFI 528
                            F++ F  P   I+ + D++  DE        + KL  ++  ++
Sbjct: 848 QTALENGKISGFADLDAFQQWFGKPVDKIIAANDSEHDDE----TRRTVSKLHQVLRPYL 903

Query: 529 IRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVL 588
           +RR    + K +P KYEH+++  L   Q+ +Y   +        +        +  +  L
Sbjct: 904 LRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLASGNFMSIINCLMQL 963

Query: 589 KKLCNHPN 596
           +K+CNHP+
Sbjct: 964 RKVCNHPD 971

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 152/306 (49%), Gaps = 43/306 (14%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
            I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ +++ 
Sbjct: 768  ILADEMGLGKTVQSISVLAHLADRYNIWGP--------FIVVTPASTLHNWVNEISRFVP 819

Query: 365  PGTLSPLAVDGKKSSLASGNSTVAEAVHS-WAQA---TGRNIVKPVLIISYETLRRNVDQ 420
               + P            GN+   + +   W +     GR+    V++ SY+ +  +   
Sbjct: 820  QFKILPYW----------GNANDRKTLRKFWDRKHLRYGRDAPFHVMVTSYQMVVSDASY 869

Query: 421  LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
            L+      M+ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P
Sbjct: 870  LQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMP 929

Query: 481  GLLGTRSEFRKNFELPILRSRDADSTDEEITK-GEEQLQKLSTIVSKFIIRRTNDILSKY 539
             L  +  EF   F      S+D +S  E  T+  +EQL++L  ++  F++RR    +   
Sbjct: 930  SLFDSHDEFSDWF------SKDIESHAESNTELNQEQLRRLHMVLKPFMLRRIKKNVQSE 983

Query: 540  LPCKYEHVIFVNLKPFQKDVYHRLLKSR-----DVNKMVKG---VGGTQPL-KAIGVLKK 590
            L  K E  +  +L  F++   +++LKS+     D  +   G   V   Q L   +   +K
Sbjct: 984  LGDKIEIDVLCDL-TFRQAKLYQVLKSQVSGGYDAIENAAGNDDVTSDQKLVNLVMEFRK 1042

Query: 591  LCNHPN 596
            +CNHP+
Sbjct: 1043 VCNHPD 1048

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 91/156 (58%), Gaps = 4/156 (2%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L K+K E D ++++    T+ +DL+E+    + Y+ +RLDG+  ++ R+ 
Sbjct: 1318 SAKLKKLDELLVKLK-EEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRD 1376

Query: 691  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            LV D    P+   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1377 LVHDWQTKPDI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1434

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785
            +   +YR +  G+IEE++  R   K  +   V++ K
Sbjct: 1435 RQVTVYRLLIRGTIEERMRDRAKQKEHVQQVVMEGK 1470

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 96/170 (56%), Gaps = 2/170 (1%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L   L ++K ++  + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1246 GKLQKLAILLQQLK-DNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQIL 1304

Query: 692  VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 751
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1305 TERFN-TDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1363

Query: 752  CFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
              IYRF+S  +IE  I ++ + K  L + V+   +     FS  ++R L 
Sbjct: 1364 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLL 1413

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 142/302 (47%), Gaps = 36/302 (11%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  K   
Sbjct: 718 ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEF-KRFA 768

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
           PG         K  +         E    W +    +    V I+SY+ + ++    +  
Sbjct: 769 PGF--------KVLTYYGSPQQRKEKRKGWNKPDAFH----VCIVSYQLVVQDQHSFKRK 816

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL- 483
               M+ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P  + 
Sbjct: 817 RWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVI 876

Query: 484 --------GTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDI 535
                        F++ F  P+ +  +      +  + ++ + KL  ++  +++RR    
Sbjct: 877 DGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKAD 936

Query: 536 LSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPL-KAIGVLKKLCNH 594
           + K +P KYEH+++  L   Q+ +Y   + SR   K     G    +   +  L+K+CNH
Sbjct: 937 VEKQMPAKYEHIVYCKLSKRQRFLYDDFM-SRAQTKATLASGNFMSIVNCLMQLRKVCNH 995

Query: 595 PN 596
           PN
Sbjct: 996 PN 997

>Kwal_26.7123
          Length = 1081

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 126/269 (46%), Gaps = 33/269 (12%)

Query: 303 RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKW 362
           R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 540 RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594

Query: 363 LGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRN---VD 419
                + P    G +   A     + +    +           V++ +Y     N   V 
Sbjct: 595 CPDLKIEPYY--GSQQERAELRDILEDNDGQY----------DVIVTTYNLASGNKYDVS 642

Query: 420 QLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 479
            L+N    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +LL F  
Sbjct: 643 FLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIM 702

Query: 480 PGLLGTRSE-----FRKNFELPILRSRDADST-DEEITKGEEQLQKLSTIVSKFIIRRTN 533
           P L  ++       FR+       R+R +DS  D      +E + +  T++  FI+RR  
Sbjct: 703 PNLFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRK 755

Query: 534 DILSKYLPCKYEHVIFVNLKPFQKDVYHR 562
           D + K+LP K+  + +  +   Q+ +Y+R
Sbjct: 756 DQVLKHLPHKHSKIEYCEMSDVQRTIYNR 784

 Score =  111 bits (278), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            SGK   L + L  I     +K+++ S +TQ LD++E      + + +RLDG+  +N RQ 
Sbjct: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            L+D+F+D +    +F+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 964  LIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781
               I   I+  SIEEKI Q    K++L + +
Sbjct: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053

>Scas_646.3*
          Length = 1456

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 89/152 (58%), Gaps = 4/152 (2%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L + L  +K ++  + ++ +  T+ LD++E+      Y  +RLDG   +  RQ L
Sbjct: 1189 GKLQKLAKLLQDLK-DNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQIL 1247

Query: 692  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1248 TERFNNDPRVT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1305

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
            D  IYRF+S  +IE  I ++ + K  L + V+
Sbjct: 1306 DVHIYRFVSEHTIESNILKKANQKRQLDNVVI 1337

 Score =  112 bits (279), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 145/302 (48%), Gaps = 36/302 (11%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  K   
Sbjct: 666 ILADEMGLGKTIQTISLLAYLACEKQNWGPH--------LIVVPTSVLLNWEMEF-KRFC 716

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
           PG L  L   G             E    W +    +    V I+SY+ + ++    +  
Sbjct: 717 PG-LKVLTYYGSPQQRK-------EKRKGWNKPDAFH----VCIVSYQLVVQDQHSFKRK 764

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL- 483
               M+ DE H +KN  S  + AL + N  RR++++GTP+QN+L+E ++LL F  P  + 
Sbjct: 765 KWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTVI 824

Query: 484 --------GTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDI 535
                        F++ F  P+ +  +  +  ++  + ++ + KL  ++  +++RR    
Sbjct: 825 DGKKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKAD 884

Query: 536 LSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPL-KAIGVLKKLCNH 594
           + K +P KYEH+++  L   Q+ +Y   + SR   K     G    +   +  L+K+CNH
Sbjct: 885 VEKQMPAKYEHIVYCRLSKRQRFLYDDFM-SRSQTKATLASGNFMSIVNCLMQLRKVCNH 943

Query: 595 PN 596
           P+
Sbjct: 944 PD 945

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 138/301 (45%), Gaps = 34/301 (11%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
            I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  K   
Sbjct: 787  ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEF-KRFA 837

Query: 365  PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
            PG         K  +         E    W +    +    V I SY+ +  +    +  
Sbjct: 838  PGF--------KVLTYYGSPQQRREKRKGWNKPDAFH----VCITSYQLVVHDQHSFKRK 885

Query: 425  DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-- 482
                M+ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P    
Sbjct: 886  KWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAL 945

Query: 483  -------LGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDI 535
                         F++ F  P+ +  +     E+  + ++ + KL  ++  +++RR    
Sbjct: 946  ENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQVLRPYLLRRLKAD 1005

Query: 536  LSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHP 595
            + K +P KYEH+I+  L   Q+ +Y   +      + +        +  +  L+K+CNHP
Sbjct: 1006 VEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQLRKVCNHP 1065

Query: 596  N 596
            +
Sbjct: 1066 D 1066

 Score =  112 bits (279), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query: 632  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKL 691
            GK   L + L  +K ++  + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1310 GKLQKLAQLLQNLK-DNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQIL 1368

Query: 692  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1369 TERFNSDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1426

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
            D  IYRF+S  +IE  I ++ + K  L + V+   +     F+  +++ L 
Sbjct: 1427 DVHIYRFVSDHTIESNILKKANQKRHLDNVVIQTGDFTTDYFTKLSVKDLL 1477

>Kwal_47.18077
          Length = 809

 Score =  111 bits (277), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 85/158 (53%), Gaps = 1/158 (0%)

Query: 625 DVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMT 684
           D   Q SGK  IL++ +  +  +   K+++ + +   LDLIE  C        R+DG+M 
Sbjct: 548 DFLLQSSGKLQILQQLVPPL-IKKGHKVLIFTQFVGMLDLIEDWCELNDVRVCRIDGSMG 606

Query: 685 INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 744
              RQ+ ++RFNDP+     FL+S++AGG GINL  A+ +IL D DWNP  D QA  R  
Sbjct: 607 NETRQEHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQATDRTH 666

Query: 745 RDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVV 782
           R GQ K   +YR     +IE  I  R + K  L   V+
Sbjct: 667 RIGQTKPVIVYRLCCDNTIEHVILTRAASKRKLEKMVI 704

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/331 (28%), Positives = 149/331 (45%), Gaps = 48/331 (14%)

Query: 244 KKKFPNVPVVIDPKLTK--ILRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQN 301
           K++ P   +   P L K   L+P+Q+EGV +L                     I   E  
Sbjct: 160 KEEIPEPVLHQQPSLLKNCQLKPYQLEGVNWL---------------------ITLYENG 198

Query: 302 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVK 361
             G    I+ADEMGLGKTLQ IAL+  +      G  LI       P S ++ W NE  +
Sbjct: 199 LNG----ILADEMGLGKTLQSIALLAFITEMDTGGPFLI-----AAPLSTLDTWVNEFSR 249

Query: 362 WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQAT-GRNIVKPVLIISYETLRRNVDQ 420
           +  P       +   K     G S     +  + ++T G+ +V    I SYE + R+++ 
Sbjct: 250 F-APD------IQVLKYYSTQGQSYRQSLLKKFFKSTKGQGVV----ITSYEIIIRDIEL 298

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 480
           + +     ++ DEGHR+KN +      L  IN   R++++GT +QN+LSE ++LLNF  P
Sbjct: 299 ILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQNNLSELWSLLNFIMP 358

Query: 481 GLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQ---LQKLSTIVSKFIIRRTND-IL 536
            +      F K F+   L  + +      +   E +   +  L  I+  F++RR    +L
Sbjct: 359 DIFADFEIFHKWFDFSDLELKSSSQGLNRLINDELEKNLISNLHAILKPFLLRRLKKVVL 418

Query: 537 SKYLPCKYEHVIFVNLKPFQKDVYHRLLKSR 567
           +  LP K E+++   L   QK +Y   L  +
Sbjct: 419 AGSLPPKREYIVNCPLTSVQKKLYKSALNGK 449

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 148/323 (45%), Gaps = 72/323 (22%)

Query: 309  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
            I+ADEMGLGKT+Q I+++  L       GP         ++V P+S ++NW NE+ K++ 
Sbjct: 744  ILADEMGLGKTVQSISVLAHLAEHHNIWGP--------FLVVTPASTLHNWVNEISKFVP 795

Query: 365  PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKP----------------VLI 408
               + P                       W  A  R +++                 V+I
Sbjct: 796  QFKILPY----------------------WGSANDRKVLRKFWDRKNLRYSEKSPFHVMI 833

Query: 409  ISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDL 468
             SY+ +  +   L+      M+ DE   +K+  S  +  L S +C  R++L+GTPIQN++
Sbjct: 834  TSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNM 893

Query: 469  SEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDE-EITKGEEQLQKLSTIVSKF 527
             E +ALL+F  P L  +  EF + F      SRD +S  E   +  ++QL++L  I+  F
Sbjct: 894  QELWALLHFIMPSLFDSHDEFNEWF------SRDIESHAEGNSSLNQQQLRRLHMILKPF 947

Query: 528  IIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSR-----DV--NKMVKG---VG 577
            ++RR    +   L  K E  +  +L   Q  +Y ++LKS+     D   N   +G    G
Sbjct: 948  MLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLY-QVLKSQMSSNYDAIENAAAEGSDIAG 1006

Query: 578  GTQP----LKAIGVLKKLCNHPN 596
            G       + A+   +K+CNHP+
Sbjct: 1007 GGNSDQSIINAVMQFRKVCNHPD 1029

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 92/156 (58%), Gaps = 4/156 (2%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L ++K ++D ++++    T+ +DL+E+    + Y+ +RLDG+  +  R+ 
Sbjct: 1294 SAKLKKLDELLVELK-KNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1352

Query: 691  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            LV D   +PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1353 LVHDWQTNPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1410

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785
            K   +YR +  G+IEE++  R   K  +   V++ K
Sbjct: 1411 KQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1446

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
            complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 87/155 (56%), Gaps = 2/155 (1%)

Query: 631  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
            S K   L+  L ++K   + ++++    T+ +DLIE+    + Y  +RLDG+  +  R+ 
Sbjct: 1239 SAKLKKLDELLVRLKA-GEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRD 1297

Query: 691  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 750
            LV  +   +   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ K
Sbjct: 1298 LVHDWQ-TKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTK 1356

Query: 751  DCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785
               +YR +  G+IEE++  R   K  +   V++ K
Sbjct: 1357 QVTVYRLLIKGTIEERMRDRAKQKEHVQQVVMEGK 1391

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/311 (27%), Positives = 147/311 (47%), Gaps = 46/311 (14%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELVKWLG 364
           I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ K++ 
Sbjct: 677 ILADEMGLGKTVQSISVLAHLAERYNIWGP--------FIVVTPASTLHNWVNEIQKFVP 728

Query: 365 PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNC 424
              + P   +G    +           +S      ++    V+I SY+ +  +   L+  
Sbjct: 729 DFKILPYWGNGNDRKILRRFWDRKHLRYS------KDAPFHVMITSYQMIVSDAAYLQKM 782

Query: 425 DVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 484
               M+ DE   +K+  S  +  L S +C  R++L+GTPIQN + E +ALL+F  P L  
Sbjct: 783 KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFD 842

Query: 485 TRSEFRKNFELPILRSRDADSTDEEITK-GEEQLQKLSTIVSKFIIRRTNDILSKYLPCK 543
           +  EF   F      S+D +S  +  T+  ++QL++L  I+  F++RR    +   L  K
Sbjct: 843 SHDEFNDWF------SKDIESHAQSNTQLNQQQLRRLHMILKPFMLRRIKKNVQSELGDK 896

Query: 544 YEHVIFVNLKPFQKDVYHRLLKSR------------------DVNKMVKGVGGTQPLKAI 585
            E  +  +L   Q  +Y ++LKS+                  D   M   +  ++ +  +
Sbjct: 897 IEIDVMCDLTHRQAKLY-QVLKSQVSASYDAIENAASNSSGDDSGNM--SLSDSKIMNTV 953

Query: 586 GVLKKLCNHPN 596
              +K+CNHP+
Sbjct: 954 MEFRKVCNHPD 964

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 89/147 (60%), Gaps = 4/147 (2%)

Query: 648  SDDKIVLISNYTQTLDLIEKMCRNK-HYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFL 706
            +D+K+++ S +T   D+++   +   + S +R DGTM  N R  +++RF   E  E + L
Sbjct: 1417 TDEKLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLL 1475

Query: 707  LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEK 766
            +S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q+++ +I+R +   +IE++
Sbjct: 1476 ISMKAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDR 1535

Query: 767  IYQRQSMKMSLSSCVVDAKE--DVERL 791
            I + Q+ K +L    +D  E  +V RL
Sbjct: 1536 IVELQNRKRTLVENAMDPTELREVNRL 1562

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 106/255 (41%), Gaps = 40/255 (15%)

Query: 307  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANEL-VKWLGP 365
            G ++AD+MGLGKT+Q IALM                 ++V P +++  W +E+  K    
Sbjct: 917  GGLLADDMGLGKTVQAIALMLA----NRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQ 972

Query: 366  GTLSPL---AVDGKKSS-----------LASGNSTVAEAVHSWA---QATGRNIVKPVLI 408
               S +      GKK             L S  +   E    W    Q T  N  +   +
Sbjct: 973  AQFSVMIYGGFGGKKVENFKAMHNYDVVLVSYQTLAVEFKKHWPARLQGTSENGGQLPEV 1032

Query: 409  ISYETLRRNVDQLRN----------CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVI 458
             S + +  N  +LRN           +   ++ DE   +KN  +    A  ++N   R  
Sbjct: 1033 ASIKAM--NSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKACCTLNGTYRWA 1090

Query: 459  LSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPIL-RSRDADSTDEEITKGEEQL 517
            LSGTPIQN++ E ++LL F          +F+++    +L R  D DS D      +  L
Sbjct: 1091 LSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALLSRGGDFDSMD-----TKRAL 1145

Query: 518  QKLSTIVSKFIIRRT 532
            +K+  ++   ++RR 
Sbjct: 1146 KKVRVLLRAIMLRRA 1160

>Kwal_47.17771
          Length = 972

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 650 DKIVLISNYTQTLDLIE---KMCRNKHYSSV-RLDGTMTINKRQKLVDRFNDPEGQEF-I 704
           ++IV+ S ++  LD+IE     C +K  + V + DG +++ +R K++  F   +     I
Sbjct: 816 EQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLKI 875

Query: 705 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
            LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ R+ R GQ  +  + RFI   SIE
Sbjct: 876 LLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSIE 935

Query: 765 EKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
           EK+ + Q  K +L    VDA ED  R    + ++ LF+
Sbjct: 936 EKMLRIQERKRTLGEA-VDADEDERRKRRIEEIKMLFE 972

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 88/210 (41%), Gaps = 49/210 (23%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----------------------- 343
           G I+ADEMGLGKT+  +A++ T+      GK  + +                        
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 344 ----IIVCPSSLVNNWANELVK-----------WLGPGTLSPLAVDGK-KSSLASGNSTV 387
               ++V P SL++ W  E  K           + G  T S  ++  K KS      +T 
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLLTKTKSPPTVLITTY 454

Query: 388 AEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTA 447
               H W++   +N            +  +V  L + +   ++ DEGH ++N ++ T  +
Sbjct: 455 GTVQHEWSRLLNKN----------GQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRS 504

Query: 448 LDSINCPRRVILSGTPIQNDLSEYFALLNF 477
           L  +   R  IL+GTPI N L + ++L+ F
Sbjct: 505 LMDLKSTRSWILTGTPIINRLDDLYSLVKF 534

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 5/152 (3%)

Query: 635  AILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSV----RLDGTMTINKRQK 690
            A++    H   T +++++V+ S ++  LD++E   R    S +    + DG + + +R  
Sbjct: 914  ALIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSN 973

Query: 691  LVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
            ++ +F +    +  + LLS KAGG G+NL  A+   +MDP W+P  + QA+ R+ R GQ 
Sbjct: 974  VLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRIGQS 1033

Query: 750  KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCV 781
                IYRFI   SIEEK+ + Q  K SL   V
Sbjct: 1034 NTVKIYRFIVENSIEEKMLRIQEKKRSLGEFV 1065

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 91/214 (42%), Gaps = 59/214 (27%)

Query: 307 GCIMADEMGLGKTLQCIAL-----------MWTLLRQGPQGKRLID------------KC 343
           G I+ADEMGLGKT+  +AL           + T   + P G   ++              
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 344 IIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIV 403
           +IV P SL+  W NE V+                  +  GN    E  ++   +  R ++
Sbjct: 515 LIVVPMSLLPQWRNEFVR------------------VNDGNGLYCEVYYAGNVSNLRTLL 556

Query: 404 ------KPVLIISYETLRRNVDQLRNCDV-----GL-------MLADEGHRLKNGDSLTF 445
                   V++ +Y  ++    +L+  D      GL       ++ DEGH ++N  + T 
Sbjct: 557 VKQKSPPSVVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTS 616

Query: 446 TALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 479
            A+ ++   R+ +L+GTPI N L + F+L+ F N
Sbjct: 617 KAVMALTSRRKWVLTGTPIMNRLDDLFSLIKFMN 650

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 99/178 (55%), Gaps = 9/178 (5%)

Query: 632  GKFAILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRNKHYSSVRL-----DGTMTI 685
             K   L R L +++  S  +++V+ S ++  LD++E    N+ YSS +L     DG +++
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQL-NEVYSSNKLKVYKFDGRLSL 1033

Query: 686  NKRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 744
             +R  +++ F   +   + + LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ 
Sbjct: 1034 KERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIH 1093

Query: 745  RDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
            R GQ     + RF+  GSIEEK+ + Q  K +L    +D  ED  R    + ++ LF+
Sbjct: 1094 RIGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEA-MDTDEDERRKRRIEEIQMLFE 1150

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 57/231 (24%)

Query: 291 VNTGIVKTEQNNRGAY--GCIMADEMGLGKTLQCIALMW-----------TLLRQG---- 333
           ++TG    E+    ++  G I++DEMGLGKT+  ++L+            +L  Q     
Sbjct: 490 LHTGEFSLERPTMNSFKNGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNL 549

Query: 334 ----------PQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLS-PLAVDGKKSSLAS 382
                     P+        +I+ P SL+  W +E  K      L+  L   G  SSL S
Sbjct: 550 SSDDVIEIKEPERSYAYKTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKS 609

Query: 383 -----------GNSTVAEAVHSWAQATG-----RNIVKPVLIISYETLRRNVDQLRNCDV 426
                        +T     + W + +      R++ +   I S E  R           
Sbjct: 610 LLIKRKNPPTVVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFR----------- 658

Query: 427 GLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 477
             ++ DEGH ++N  ++T  A+  ++   R IL+GTPI N L + ++L+ F
Sbjct: 659 --IILDEGHTIRNKSTITSKAVLELSSKYRWILTGTPIINRLDDLYSLVKF 707

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (52%), Gaps = 1/167 (0%)

Query: 635 AILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDR 694
           A+LE   +   +    K ++ S +T  LDL+E   +   + + +L G+MT  +R + ++ 
Sbjct: 579 ALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINY 638

Query: 695 FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
           F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I
Sbjct: 639 FMDNVHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKI 697

Query: 755 YRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
            RF    SIE +I + Q  K ++    +   E      +  +L+ LF
Sbjct: 698 TRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADLQFLF 744

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (48%), Gaps = 21/185 (11%)

Query: 299 EQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 358
           ++NN    G ++ADEMG+GKT+Q I+L+     +GP         ++V P+  +  W NE
Sbjct: 156 QENNERYRGGVLADEMGMGKTVQMISLLLHA-NKGPT--------LVVAPTVALIQWKNE 206

Query: 359 LVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNV 418
           + K+ G G L  L   G   S  S     A+ V      T   +++ V     +  RR  
Sbjct: 207 IDKYTG-GALRSLVFHGPGRSAVSEELAAADVV-----LTTYAVLESVYRKQTQGFRRKA 260

Query: 419 DQLRN------CDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 472
             +R        D   ++ DE H +K+  S T  +++++   RR  L+GTP+QN + E +
Sbjct: 261 GVVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMY 320

Query: 473 ALLNF 477
           +L+ F
Sbjct: 321 SLIRF 325

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 97/178 (54%), Gaps = 7/178 (3%)

Query: 631  SGKFAILERFLHKIK-TESDDKIVLISNYTQTLDLIEKMCRNK----HYSSVRLDGTMTI 685
            S K   L R L +I+ T   ++I++ S ++  LD++E   R+          + DG + +
Sbjct: 938  STKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDM 997

Query: 686  NKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 744
             +R +++++F+D +     + LLS K GG G+NL  A+R  +MDP W+P  + QA+ R+ 
Sbjct: 998  KERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIH 1057

Query: 745  RDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
            R GQ++   + RFI   S+EEK+ + Q  K  L   +V+  E   R    + ++ LFQ
Sbjct: 1058 RIGQQQTVKVVRFIIDNSVEEKMLRIQERKRMLGD-IVEGDEAERRQKRIEEIQMLFQ 1114

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 135/332 (40%), Gaps = 64/332 (19%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRL--------------IDK---------- 342
           G I+ADEMGLGKT+  +AL+ T        K++              +D           
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 343 -------CIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWA 395
                   +IV P SL+N W +E  K      L       K+  +  GN+      +   
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEK--ANKDLK------KRCEIYYGNNIKDLRAYVLG 590

Query: 396 QATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPR 455
                 I+    II  E  R +   L N     ++ DEGH ++N  + T  A+ ++   R
Sbjct: 591 PNAPSVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIALRSSR 650

Query: 456 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEE 515
           + IL+GTPI N L + F+L+ F N       + +++   +P  +   A + D        
Sbjct: 651 KWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFD-------- 702

Query: 516 QLQKLSTIVSKFIIRRT---NDILSK---YLPCKYEHVIFVNLKPFQKDVYHRLLKSRDV 569
               ++ ++   ++RRT    D+  K    LP K   V  + L   +K VY  +L+  + 
Sbjct: 703 ---VINAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAE- 758

Query: 570 NKMVKGVGG-------TQPLKAIGVLKKLCNH 594
           N + +G+         T  L  I  L+++C H
Sbjct: 759 NSVKEGLAKGDLLKNYTNILVHILRLRQVCCH 790

>Kwal_23.3660
          Length = 768

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 651 KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSK 710
           K ++ S +T  LDL+E   +   + +V+L G+MT  +R + +  F D    E +FL+S K
Sbjct: 617 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMDNTHCE-VFLVSLK 675

Query: 711 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQR 770
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    SIE +I + 
Sbjct: 676 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIEL 735

Query: 771 QSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
           Q  K ++    ++  +      +  +L+ LF
Sbjct: 736 QEKKANMIHATINQDDAAINRLTPGDLQFLF 766

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 84/179 (46%), Gaps = 20/179 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           G ++ADEMG+GKT+Q IAL+   + + P         ++V P+  +  W NE+ +  G G
Sbjct: 183 GGVLADEMGMGKTIQTIALLMNDVTKKPS--------LVVAPTVALMQWKNEIEQHTG-G 233

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNV------DQ 420
            L      G     A+  S V E        T   +++ V        +R          
Sbjct: 234 KLKTHIFHG-----ANRTSNVGEFKDVDVLLTTYAVLESVFRKQNYGFKRKSGVYKEPSV 288

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 479
           L N +   ++ DE H +K+  S T  A++S+   ++  L+GTP+QN + E ++L+ F N
Sbjct: 289 LHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGEMYSLIRFLN 347

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 89/155 (57%), Gaps = 5/155 (3%)

Query: 641  LHKIKTESD-DKIVLISNYTQTLDLIEKMCRNK-HYSSVRLDGTMTINKRQKLVDRFNDP 698
            ++K+  +SD +KI++ S +T  LDL+E +   +   S ++  G M    R +++ RF   
Sbjct: 1241 INKVFEKSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSE 1300

Query: 699  EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI 758
            E +  + L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q ++  ++R  
Sbjct: 1301 EDKR-VLLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLF 1359

Query: 759  STGSIEEKIYQRQSMKMSLSSCVVDAK--EDVERL 791
               S+E++I + Q +K  +    +DAK  +D+ +L
Sbjct: 1360 IKNSVEDRILELQKLKRDMVDAAMDAKKIKDINKL 1394

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 114/267 (42%), Gaps = 67/267 (25%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           G ++AD+MGLGKT+Q IALM    R   + K+     +IV P S++  W  E        
Sbjct: 754 GGLLADDMGLGKTVQAIALMLAN-RSSNESKKT---NLIVAPVSVLRVWKGE-------- 801

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVH-----SWAQATGRNIVKPVLIISYETLRRNV--- 418
                 ++ K    +  NS +   V+     SW + +  +    V+++SY+TL   +   
Sbjct: 802 ------IETKIKESSDFNSAIYGGVNGIKFRSWDKLSNFD----VILVSYQTLANELKKH 851

Query: 419 --DQLRN--------CDVGLM-----------------------LADEGHRLKNGDSLTF 445
             ++L+          D+  M                       + DEG  +KN  +   
Sbjct: 852 WPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQAA 911

Query: 446 TALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADS 505
            A  ++N   R ILSGTPIQN++ E ++L+ F           F+++   P   S    +
Sbjct: 912 KACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPF--SNLKQN 969

Query: 506 TDEEITKGEEQLQKLSTIVSKFIIRRT 532
            D E  K  + ++K+  ++   ++RR+
Sbjct: 970 YDSESRK--QAIKKVRVLLRAIMLRRS 994

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 631 SGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQ 689
           S K   L   L+K+++     K ++ S +T  LDL+E   +   + +V+L G+M+  +R 
Sbjct: 658 STKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 717

Query: 690 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 749
           + +  F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 718 QTIKYFMDNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 776

Query: 750 KDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
           +   I RF    SIE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 777 RPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAINRLTPADLQFLF 828

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 82/177 (46%), Gaps = 20/177 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           G ++ADEMG+GKT+Q IAL+     + P         ++V P+  +  W NE+ +    G
Sbjct: 246 GGVLADEMGMGKTIQTIALLMNDRSKKPS--------LVVAPTVALMQWKNEIEQHTN-G 296

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRR------NVDQ 420
            LS     G   ++   +    + +      T  ++++ V        RR          
Sbjct: 297 ALSTYIYHGASRTINIHDLKDIDVI-----LTTYSVLESVFRKQNYGFRRKNGLVKEKSL 351

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 477
           L N D    + DE H +K+  S T  A++++   +R  LSGTP+QN + E ++L+ F
Sbjct: 352 LHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIRF 408

>Scas_721.100
          Length = 1137

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 97/177 (54%), Gaps = 7/177 (3%)

Query: 632  GKFAILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRNKHYSSV----RLDGTMTIN 686
             K + L + L  ++  S  +++V+ S ++  LD++E   +    + V    + DG +++ 
Sbjct: 962  AKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLK 1021

Query: 687  KRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 745
            +R  ++  F   +  ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R
Sbjct: 1022 ERSTVLQDFQIKDLSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHR 1081

Query: 746  DGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
             GQ  +  + RFI   SIEEK+ + Q  K ++    +DA ED  R    + ++ LF+
Sbjct: 1082 IGQTNNVKVVRFIIENSIEEKMLRIQERKRTIGEA-MDADEDERRKRRIEEIKMLFE 1137

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 86/202 (42%), Gaps = 38/202 (18%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK------------------------ 342
           G I++DEMGLGKT+  +AL+ +     P    ++DK                        
Sbjct: 501 GGILSDEMGLGKTISTLALILSC----PYDSEVVDKKLFKGEEDDIRETQPHLKPYASKT 556

Query: 343 CIIVCPSSLVNNWANELVKWLGPGTL-SPLAVDGKKSSL------ASGNSTVAEAVHSWA 395
            +IV P SL+N W  E  K      + S +   G  SSL           TV    +   
Sbjct: 557 TLIVVPMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIV 616

Query: 396 QATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPR 455
           Q+    I K   I +     ++   L + D   ++ DEGH ++N  +LT  A+  +    
Sbjct: 617 QSEWSKIFKKQNIGAE---IQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLTSKC 673

Query: 456 RVILSGTPIQNDLSEYFALLNF 477
           + +L+GTPI N L + ++L+ F
Sbjct: 674 KWVLTGTPIINRLDDLYSLVRF 695

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 651 KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSK 710
           K ++ S +T  LDL+E   +   + +V+L G+MT  +R + +  F +    E +FL+S K
Sbjct: 649 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMENIHCE-VFLVSLK 707

Query: 711 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQR 770
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    SIE +I + 
Sbjct: 708 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIEL 767

Query: 771 QSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
           Q  K S+    ++  E      +  +L+ LF
Sbjct: 768 QEKKASMIHATINQDEAAINRLTPADLQFLF 798

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 95/201 (47%), Gaps = 37/201 (18%)

Query: 294 GIVKTEQNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLV 352
           G+   +Q     Y G ++ADEMG+GKT+Q IAL+ + + + P         ++V P+  +
Sbjct: 201 GLHWLQQQEESDYNGGVLADEMGMGKTIQTIALLMSDITRKPS--------LVVAPTVAL 252

Query: 353 NNWANELVK----------WLGPGTLSPLA----VDGKKSSLASGNSTVAEAVHSWAQAT 398
             W NE+ +          + G    + L     VD   ++ A   S   + V+ + +  
Sbjct: 253 MQWKNEIEQHTNKKLSVYMYHGANRTNNLGDFKDVDVILTTYAVLESVYRKQVYGFKRKA 312

Query: 399 GRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVI 458
           G         +  ++L  +++  R      ++ DE H +K+  S T  A++S+   +R  
Sbjct: 313 G--------TVKEKSLLHSINFYR------VILDEAHNIKDRTSNTAKAVNSLQTKKRWC 358

Query: 459 LSGTPIQNDLSEYFALLNFSN 479
           LSGTP+QN + E ++L+ F N
Sbjct: 359 LSGTPLQNRIGEMYSLIRFLN 379

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 85.9 bits (211), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 93/174 (53%), Gaps = 2/174 (1%)

Query: 629 QFSGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINK 687
           Q S K   L   L+K+++     K ++ S +T  LDL+E   +   + +V+L G+M+  +
Sbjct: 616 QSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQ 675

Query: 688 RQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 747
           R + +  F +    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R G
Sbjct: 676 RDETIKYFMNNIQCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 734

Query: 748 QKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 801
           Q +   I RF    SIE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 735 QYRPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAISRLTPADLQFLF 788

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 83/179 (46%), Gaps = 20/179 (11%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
           G ++ADEMG+GKT+Q IAL+   L + P         ++V P+  +  W NE ++    G
Sbjct: 205 GGVLADEMGMGKTIQTIALLMNDLTKSPS--------LVVAPTVALMQWKNE-IEQHTKG 255

Query: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRR------NVDQ 420
            L      G     AS  + + +        T   +++ V        RR          
Sbjct: 256 QLKIYIYHG-----ASRTTDIKDLQGYDVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSV 310

Query: 421 LRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 479
           L N D   ++ DE H +K+  S T  A++++   +R  LSGTP+QN + E ++L+ F N
Sbjct: 311 LHNIDFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYSLIRFLN 369

>Scas_591.10
          Length = 772

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 100/187 (53%), Gaps = 10/187 (5%)

Query: 617 NMQGSKSRDVQPQFSGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRNKHYS 675
           NM+G+       Q S K   L   L+K+++     K ++ S +T  LDL+E   +   + 
Sbjct: 592 NMKGTW------QSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQ 645

Query: 676 SVRLDGTMTINKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPA 734
           +V+L G+M+  +R + +  F N+ E +  +FL+S KAGG  +NL  A+++ ++DP WNP+
Sbjct: 646 TVKLQGSMSPTQRDETIKYFMNNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPS 703

Query: 735 ADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSS 794
            + Q+  RV R GQ +   I RF    SIE +I + Q  K ++    ++  E      + 
Sbjct: 704 VEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQEKKANMIHATINQDEAAIGRLTP 763

Query: 795 DNLRQLF 801
            +L+ LF
Sbjct: 764 ADLQFLF 770

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 21/187 (11%)

Query: 300 QNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 358
           Q   G + G ++ADEMG+GKT+Q IAL+   L + P         ++V P+  +  W NE
Sbjct: 179 QQEEGIFKGGVLADEMGMGKTIQTIALLMNDLTKRPS--------LVVAPTVALMQWKNE 230

Query: 359 LVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRR-- 416
           + +    G L      G   ++     +  + V      T   +++ V        +R  
Sbjct: 231 INQHTD-GKLKVYMFHGTSKNIDIKTLSEYDVV-----LTTYAVLESVFRKQNYGFKRKH 284

Query: 417 ----NVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 472
                +  L N +   ++ DE H +K+  S T  A++++   +R  L+GTP+QN + E +
Sbjct: 285 GVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTPLQNRIGEMY 344

Query: 473 ALLNFSN 479
           +L+ F N
Sbjct: 345 SLIRFLN 351

>Kwal_14.1868
          Length = 1357

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 78/149 (52%), Gaps = 5/149 (3%)

Query: 636  ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSS-VRLDGTMTINKRQKLVDR 694
            I+     K KTE   KI++ S +T   DL++   R    +  +R DG+M    R   ++ 
Sbjct: 1184 IIRDVFLKSKTE---KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEE 1240

Query: 695  FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
            F     +  I L+S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q +D  +
Sbjct: 1241 FYR-SLERRILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQV 1299

Query: 755  YRFISTGSIEEKIYQRQSMKMSLSSCVVD 783
            +R +   S+E++I + Q  K  L    +D
Sbjct: 1300 HRLLVKNSVEDRILELQKKKRELVEIAMD 1328

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 142/354 (40%), Gaps = 104/354 (29%)

Query: 228 NKSLKELL----GSSEEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMK 283
           N SL ELL     +  E E ++  P       P++T  L  HQ +G+ +L          
Sbjct: 644 NDSLHELLEGLKTAETEIEGEELTP-------PEMTINLMKHQRQGLHWL---------- 686

Query: 284 DFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC 343
                       +  E++NR   G ++AD+MGLGKT+Q IALM          K  ++ C
Sbjct: 687 ------------LTVEKSNRK--GGLLADDMGLGKTVQAIALMLA-------NKSGVENC 725

Query: 344 ---IIVCPSSLVNNWANEL-VKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATG 399
              +IV P +++  W  E+  K      L  L   G       GN    E   S      
Sbjct: 726 KTNLIVAPVAVLRVWQAEVKTKVKKTSGLKVLIYGG-------GNGAKVENYRSL----- 773

Query: 400 RNIVKPVLIISYETLRRNV------------DQLRNCDVGLMLA---------------- 431
             +   V+++SY+TL   +            ++ +  D+  + A                
Sbjct: 774 --LRHDVVLVSYQTLASELKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYC 831

Query: 432 ----------DEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481
                     DE   +KN  + +  A  +++   R  LSGTP+QN++ E ++L+ F    
Sbjct: 832 NESKFYRIILDEAQNIKNKKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKIS 891

Query: 482 LLGTRSEFRKNFELPILR-SRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTND 534
                 +F+ +   P+ + + D DS D      ++ ++K+  ++   ++RRT D
Sbjct: 892 PYKREQKFKLDIGNPLGKATNDYDSHDR-----QQAIKKVQVLLRAIMLRRTKD 940

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 87/158 (55%), Gaps = 6/158 (3%)

Query: 650  DKIVLISNYTQTLDLIEKMCRNKHYSSV----RLDGTMTINKRQKLVDRFNDPE-GQEFI 704
            +++V+ S ++  LD++EK   +     V    + DG +++ +R  ++  F   +  ++ I
Sbjct: 1013 EQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQKI 1072

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R GQ     + RFI   SIE
Sbjct: 1073 LLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSIE 1132

Query: 765  EKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 802
            EK+ + Q  K ++    +D  ED  R    + ++ LF+
Sbjct: 1133 EKMLRIQEKKRTIGEA-MDTDEDERRKRRIEEIQMLFE 1169

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 89/211 (42%), Gaps = 51/211 (24%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK------------------------ 342
           G I++DEMGLGKT+      ++L+   P    ++DK                        
Sbjct: 527 GGILSDEMGLGKTVAA----YSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKP 582

Query: 343 -----CIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQA 397
                 +IV P SL+  W+NE  K       SP   D        GN +  + + +  + 
Sbjct: 583 YASKTTLIVVPMSLLTQWSNEFTK----ANNSP---DMYHEVYYGGNVSSLKTLLTKTKT 635

Query: 398 TGRNIVKPVLIISYETLRRNVDQLRNCDVGL-----------MLADEGHRLKNGDSLTFT 446
               ++    I+  E  + +  ++ + DV +           ++ DEGH ++N  ++T  
Sbjct: 636 PPTVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSK 695

Query: 447 ALDSINCPRRVILSGTPIQNDLSEYFALLNF 477
           A+ ++    + +L+GTPI N L + ++L+ F
Sbjct: 696 AVMALQGKCKWVLTGTPIINRLDDLYSLVKF 726

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 646  TESDDKIVLISNYTQTLDLIEKMCR-NKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFI 704
            + +D+K+V+ S +T   +++    + N   + +R DG+M+ ++R   ++ F        +
Sbjct: 1443 SNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQDNNYR-V 1501

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             L+S KAG  G+ L  AN +IL DP WNP  ++QA+ R  R  Q+++ +++R +   S+E
Sbjct: 1502 MLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVE 1561

Query: 765  EKIYQRQSMKMSLSSCVVD 783
            ++I + Q+ K +L +  +D
Sbjct: 1562 DRIVELQNKKKTLVNLAMD 1580

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 107/263 (40%), Gaps = 54/263 (20%)

Query: 307  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366
            G ++AD+MGLGKT+Q +AL   L+   P+ K  I   ++V P +++  W +E+   +   
Sbjct: 940  GGLLADDMGLGKTVQSLAL---LMANKPEPKSAIKTTLVVAPVAVLRVWKDEVAVKIKKD 996

Query: 367  TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQ------ 420
                + + G       G    +    SW      +IV    ++SY+TL     +      
Sbjct: 997  VNVKVVIFG-------GGENNSSKFRSWKDLAEYDIV----LVSYQTLASEFKKHWPLSW 1045

Query: 421  --------LRNCDVGLM-----------------------LADEGHRLKNGDSLTFTALD 449
                    +   D+ LM                       + DE   +KN  +    A  
Sbjct: 1046 KNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKNKKTQAAKACC 1105

Query: 450  SINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEE 509
            +I+   R  LSGTPIQN++ E ++L+ F         ++F  +    +   +  D  D E
Sbjct: 1106 TISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNTKKPYDYNDSE 1165

Query: 510  ITKGEEQLQKLSTIVSKFIIRRT 532
              +    ++K+  ++   ++RRT
Sbjct: 1166 RQRA---MKKVQVLLRAIMLRRT 1185

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 83/150 (55%), Gaps = 7/150 (4%)

Query: 636  ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNK-HYSSVRLDGTMTINKRQKLVDR 694
            +++R   +  TE   KI++ S +T   +++E   +NK ++  ++  G+M   +R  +++ 
Sbjct: 1451 VIQRVFDESATE---KIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRRSDVINE 1507

Query: 695  F-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 753
            F  DPE +  I L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q K   
Sbjct: 1508 FYRDPEKR--ILLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQ 1565

Query: 754  IYRFISTGSIEEKIYQRQSMKMSLSSCVVD 783
            +++     S+E++I + Q  K  +    +D
Sbjct: 1566 VHKLFIKDSVEDRISELQKRKKEMVDSAMD 1595

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 91/214 (42%), Gaps = 57/214 (26%)

Query: 302  NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANEL-V 360
            N    G ++AD+MGLGKT+Q IALM  L  +  + K      +IV P S++  W  EL  
Sbjct: 959  NSAKKGGLLADDMGLGKTIQAIALM--LANRSEESK--CKTNLIVAPVSVLRVWKGELET 1014

Query: 361  KWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-PVLIISYETLR---- 415
            K       +     G      SGN  V      W     R++ +   +++SY+TL     
Sbjct: 1015 KVKKRAKFTTFIFGG------SGNGKVKH----W-----RDLARYDAVLVSYQTLANEFK 1059

Query: 416  ----RNVDQLRN-------------------------CDVGL---MLADEGHRLKNGDSL 443
                + +D  +N                         C+      +L DEG  +KN ++ 
Sbjct: 1060 KHWPKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRILLDEGQNIKNKNTR 1119

Query: 444  TFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 477
               A  +IN   R +LSGTPIQN + E ++L+ F
Sbjct: 1120 ASKACCTINGMYRWVLSGTPIQNSMDELYSLIRF 1153

>Scas_674.12d
          Length = 1323

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 80/148 (54%), Gaps = 9/148 (6%)

Query: 641  LHKIKTESD-DKIVLISNYTQTLDL----IEKMCRNKHYSSVRLDGTMTINKRQKLVDRF 695
            + K+   SD +KI++ S +T   D+    +EK+ +  +   ++  G MT  +R  ++ +F
Sbjct: 1156 IKKVFENSDTEKIIIFSQFTSFFDIFQHFLEKLLKVPY---LKYTGAMTAQQRADVITKF 1212

Query: 696  NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 755
               +  E I L+S KAG  G+ L  AN +I++DP WNP  ++QA  R +R  Q ++  ++
Sbjct: 1213 YR-QANERILLISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVH 1271

Query: 756  RFISTGSIEEKIYQRQSMKMSLSSCVVD 783
            R     S+E++I + Q  K  +    +D
Sbjct: 1272 RLFIKDSVEDRIAELQEKKREMVDAAMD 1299

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 106/248 (42%), Gaps = 31/248 (12%)

Query: 307 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANEL-VKWLGP 365
           G ++AD+MGLGKT+Q IALM     +    K      +IV P +++  W  EL  K    
Sbjct: 671 GGLLADDMGLGKTVQGIALMLANRSKDQACK----TNLIVAPVAVLRVWGGELETKIKKE 726

Query: 366 GTLSPLAVDGKK------------SSLASGNSTVAEAVHSWAQATGRNIVK-PVL--IIS 410
              S     G              + + S  +   E    W  + G++  + P +  + +
Sbjct: 727 ANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGKDQKQLPAIPQLAA 786

Query: 411 YETLRRNVDQLRN--CDVGL---MLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQ 465
             +L++  +      C+      ++ DEG  +KN  +    A  S++   R + SGTPIQ
Sbjct: 787 MNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLDATYRWVFSGTPIQ 846

Query: 466 NDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSR-DADSTDEEITKGEEQLQKLSTIV 524
           N + E ++L+ F           F  +   P LR   + D  D      ++ ++K+  ++
Sbjct: 847 NSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDDFDR-----KQAIKKVQVLL 901

Query: 525 SKFIIRRT 532
           S  ++RR+
Sbjct: 902 SAIMLRRS 909

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 5/137 (3%)

Query: 650  DKIVLISNYTQTLDLIEKMCRNKHYSS----VRLDGTMTINKRQKLVDRF-NDPEGQEFI 704
            +++V+ S ++  LD++E    +    +     + DG + +  R +++D F      +  I
Sbjct: 971  EQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLKI 1030

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ RV R GQ+ +  I RFI   SIE
Sbjct: 1031 LLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSIE 1090

Query: 765  EKIYQRQSMKMSLSSCV 781
            EK+   Q  K +L   V
Sbjct: 1091 EKMLSIQDRKRTLGEAV 1107

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 87/209 (41%), Gaps = 51/209 (24%)

Query: 307 GCIMADEMGLGKTLQCIALMWTL-----------LRQGPQG---------KRLIDKC-II 345
           G ++ADEMGLGKT+  +A++  +            R+   G         K    K  +I
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 346 VCPSSLVNNWANELVKWLG-PGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK 404
           V P SL+  W  E  K    P     +   G+  +L +               T      
Sbjct: 555 VVPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAGNLIT-------------LLTKTKNPP 601

Query: 405 PVLIISYETLRRNVDQLRNCD---------VGL-------MLADEGHRLKNGDSLTFTAL 448
            +++ SY  ++    +L  C+         +GL       ++ DEGH ++N  + T  A+
Sbjct: 602 TIILTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAV 661

Query: 449 DSINCPRRVILSGTPIQNDLSEYFALLNF 477
             ++  R+ +L+GTPI N L + F+L+ F
Sbjct: 662 MDLSSSRKWVLTGTPIINRLDDLFSLVKF 690

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 98/196 (50%), Gaps = 25/196 (12%)

Query: 636  ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRF 695
            I ++ L K   + + +IV+ S+++  L ++  +    + +  R    +   K  K VD F
Sbjct: 1338 IKQQHLEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTF 1394

Query: 696  -NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 754
              DP       LL+  +   G+ L+ A  LIL++P  + + + QA++R+ R GQK   ++
Sbjct: 1395 RKDPNCT--CLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYV 1452

Query: 755  YRFISTGSIEEKIYQRQS------------MKMSLSSCVV-DAKEDVERLFSSDNLRQLF 801
            + F+   ++EE I + ++            ++ S S   V +A++++ER FS DN+ +  
Sbjct: 1453 WNFMVRNTVEESIMKYKAVLEGKKKKKTEELRASGSKISVEEAEQEIERNFSMDNITE-- 1510

Query: 802  QYNDKTICETHETYHC 817
               D +  +TH  +HC
Sbjct: 1511 ---DDSEGKTH-LWHC 1522

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ------------GPQGKRLIDKCIIVCPSSLVNNWA 356
           ++ADEMGLGKT++ + L+ T +R               +  R +   +IVCP S++  W 
Sbjct: 354 VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQWI 413

Query: 357 NEL 359
           +E+
Sbjct: 414 DEI 416

>Kwal_14.1287
          Length = 1518

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 651  KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFN-DPEGQEFIFLLSS 709
            +I++ S Y++ L L+ K+ +     S++   T    K  K+V++F  +PE      LL+ 
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLKQH---SIQHCNTAGSGKFSKIVEKFKKNPEVT--CLLLNV 1386

Query: 710  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIS---------- 759
                 G+ L+ A  + +MDP  N + + QA+ R  R GQ ++ +++ F+           
Sbjct: 1387 TRQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIVR 1446

Query: 760  -TGSIEEKIYQRQSMKMSLSSCVVDAKEDV 788
              G +EE+I  RQ +K   S  +   +E++
Sbjct: 1447 LKGVLEERIASRQRLKTQPSKTIPMKREEI 1476

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQ---GP----QGKRLIDKC---IIVCPSSLVNNWANE 358
           ++++EMGLGKTL+ +ALM    R     P      K+ I K    +IVCP S++  W +E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 359 L 359
           +
Sbjct: 416 V 416

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 67/125 (53%), Gaps = 7/125 (5%)

Query: 651  KIVLISNYTQTLDLIEKMCRNKHYSSVR-LDGTMTINKRQKLVDRFN-DPEGQEFIFLLS 708
            +IV+ S Y + L+++  + +    +S++ L  T  +    K+V+ F  DPE      LL 
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQ---NSIKFLTTTKNVRNFAKVVETFKADPEIT--CLLLD 1413

Query: 709  SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIY 768
            +K    G+ LI A  + L++P  N + + QA+ R+ R GQ  + +++ F+   ++E  I 
Sbjct: 1414 TKRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL 1473

Query: 769  QRQSM 773
            + +S+
Sbjct: 1474 RYKSI 1478

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 85/177 (48%), Gaps = 37/177 (20%)

Query: 208 ETKTGSKKFAH-PKLMTNGV--RNKSLKELLGSSEEDEAKKKFPNVPVVIDPKLTKILRP 264
           +T TGS   AH P+L    +  + +S++ +L   E++  KK +       D +L   L  
Sbjct: 284 QTLTGSGDLAHVPQLKVELLPFQQESVQWML---EKETVKKTYGRS----DEELLSFLNE 336

Query: 265 ------HQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGK 318
                 H++ G  + +  ++G V+ +  D   +    ++ E + +G    ++++EMGLGK
Sbjct: 337 QISYGYHKLSG-DWFWNKLSGYVITE-ADVLLLYQAYLRDEIHAKG----MLSEEMGLGK 390

Query: 319 TLQCIAL--------------MWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVK 361
           T++ +AL              ++ ++  G + +R +   +IVCP  +V  W +E+ K
Sbjct: 391 TVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMRR-VKTNLIVCPQVIVQQWLDEIAK 446

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 626  VQPQFSGKFAILERFLHKIKTESDD------KIVLISNYTQTLDLIEKMCRNKHYSSVRL 679
            ++  F  K   + + +  ++ +S+       +++L S  T+ L +I K+ +  H     +
Sbjct: 1350 IKESFGAKIDFVIKLISYLRLKSEQENADPPQVILYSQKTEYLKVIGKVLKLYH-----I 1404

Query: 680  DGTMTINKRQKLVDRFNDPEGQEFI--FLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 737
            +    ++    + +  N+ + Q  +   LL+ K  G G+NLI A  + L+DP  N + + 
Sbjct: 1405 EHLACLSNTANVGETINNFKRQPSVTCLLLNVKTLGAGLNLINAKHIFLLDPILNNSDEL 1464

Query: 738  QALARVWRDGQKKDCFIYRFISTGSIEEKI 767
            QA+ R  R GQ ++ F++ F+   ++EE I
Sbjct: 1465 QAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 77/192 (40%), Gaps = 45/192 (23%)

Query: 309 IMADEMGLGKTLQCIALMW-----------TLLRQGPQGKRLIDKCIIVCPSSLVNNWAN 357
           ++A+EMGLGKT++ ++L+            T +    +        +I+CP++++  W  
Sbjct: 388 VLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLE 447

Query: 358 EL------VKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQ----ATGRNIVKPVL 407
           E+      +KW      + +  D K         TV EAV    Q     T  NI+    
Sbjct: 448 EIELHANSLKWYTYRGYNEIMKDCK---------TVDEAVQQLCQYDIIVTSYNIIATE- 497

Query: 408 IISYETLRRNVDQLR--------NCDVGLM-----LADEGHRLKNGDSLTFTALDSINCP 454
            + +    R++   R        +  + LM     + DE   L++  + +      ++  
Sbjct: 498 -VHHAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRI 556

Query: 455 RRVILSGTPIQN 466
               +SGTPIQN
Sbjct: 557 HTWGVSGTPIQN 568

>Scas_573.9
          Length = 1502

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             LL+ K  G G+NL+ A  + L+DP  N + + QA+ R  R GQK + +++  I   S+E
Sbjct: 1384 LLLNVKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVE 1443

Query: 765  EKIYQ 769
            E I++
Sbjct: 1444 ENIFK 1448

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 10/60 (16%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----------CIIVCPSSLVNNWANE 358
           ++++EMGLGKT++ +AL+    R   +    ID            +IVCP++++  W NE
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             LL+ ++ G G+NL+ A  + L+DP  N   + QA++R  R GQ+++ +++ F+   ++E
Sbjct: 1350 LLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVE 1409

Query: 765  EKI 767
            E I
Sbjct: 1410 ESI 1412

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 23/113 (20%)

Query: 269 GVKFLYRCVTGLVMKDF----------LDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGK 318
            V F Y  +  LV K F          L  E V +      +   GA G ++A+EMGLGK
Sbjct: 304 SVSFGYSTIKDLVSKQFYFWNKYTGYILSQEEVRSLKSSFNEYEVGAKG-VLAEEMGLGK 362

Query: 319 TLQCIALMWTLLRQG---------PQGKRLIDKC---IIVCPSSLVNNWANEL 359
           TL+ +AL+    R+           +  ++I KC   +IVCP S++  W +E+
Sbjct: 363 TLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSILKQWIDEM 415

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%)

Query: 705  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIE 764
             L++ K    G+ L  A  +ILM+P       +QA+ R+ R GQ KD F++  ++  + E
Sbjct: 1352 LLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLMTRNTAE 1411

Query: 765  E 765
            E
Sbjct: 1412 E 1412

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 309 IMADEMGLGKTLQCIALMWTLLRQG----------PQGKRLIDK--CIIVCPSSLVNNWA 356
           I++D+ GLGKT++ +AL+    R+           P+G+ ++     +I CP  ++  W 
Sbjct: 353 ILSDDTGLGKTVETLALVCLHRRKFRPDEPRSYTLPEGREILKAKTTLICCPGPILQQWL 412

Query: 357 NE 358
           +E
Sbjct: 413 DE 414

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 12/68 (17%)

Query: 295 IVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC---IIVCPSSL 351
           ++  E++N+   G ++AD+MGLGKT+Q IALM          +  ++ C   +IV P ++
Sbjct: 896 LLNVEKSNK--RGGLLADDMGLGKTVQAIALMIA-------NRSELESCKTNLIVAPVAV 946

Query: 352 VNNWANEL 359
           +  W  E+
Sbjct: 947 LRVWQAEI 954

>Kwal_34.16080
          Length = 290

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 760 TGSIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 801
            GSIEEKIY RQ  K  L++ ++ D K+  +R F S+ L+ LF
Sbjct: 3   AGSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKSNELQDLF 43

>KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces
           cerevisiae YPL237w SUI3 translation initiation factor
           eIF2 beta subunit singleton, start by similarity
          Length = 278

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 11/99 (11%)

Query: 461 GTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKL 520
           G P Q+ LS +F +LN +NP L G RS  +     PI +     +    I +  E+LQ+ 
Sbjct: 121 GLPYQDLLSRFFKILNTNNPELAGDRSGPKFKIPPPICQRDGKKTIFANIQEISEKLQRS 180

Query: 521 STIVSKFIIRRTND-----------ILSKYLPCKYEHVI 548
              V +++                 I  K+LP + E+++
Sbjct: 181 PEHVIQYLFAELGTSGSVDGQKRLVIKGKFLPKQMENLL 219

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 15/153 (9%)

Query: 637 LERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFN 696
           L + L     + D KI++ ++  +T D I    R + + ++ + G    N+R  ++  F 
Sbjct: 348 LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 697 DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 756
              G+  I ++++     GI++ G N +I  D    P   +  + R+ R G        R
Sbjct: 408 --SGRSPI-MVATDVAARGIDVKGINYVINYD---MPGNIEDYVHRIGRTG--------R 453

Query: 757 FISTG-SIEEKIYQRQSMKMSLSSCVVDAKEDV 788
             STG +I       +S+  +L   + +AK+D+
Sbjct: 454 AGSTGTAISFFTEGNKSLGAALIKIMREAKQDI 486

>ACL033C [1016] [Homologous to ScYIL075C (RPN2) - SH]
           (304166..306958) [2793 bp, 930 aa]
          Length = 930

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%)

Query: 380 LASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKN 439
           L SG+ TVAE ++++AQ T    +   L I+   L    ++L +  +  ML  E   ++ 
Sbjct: 482 LGSGDETVAENLYTYAQETSHGEITKGLAIALALLNYGREELADETIKKMLEHENDSMRY 541

Query: 440 GDSLTF 445
           G   T 
Sbjct: 542 GAVYTI 547

>Sklu_2393.10 YIL162W, Contig c2393 16513-18165
          Length = 550

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 11/119 (9%)

Query: 467 DLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRD--ADSTDEEITKGEEQLQKLSTIV 524
           DL ++    NFS+ GLLG + E     ++PI+R  D  ++STD   +K  E+     +I 
Sbjct: 204 DLKKWELYSNFSHHGLLGYQYECPGLAKVPIVRQSDDNSNSTDSADSKANEKWVMFLSIN 263

Query: 525 SKFIIRRTNDILSKYLPCKYEHVIFV------NLKPFQKDVYHRLLKSRDVNKMVKGVG 577
               +  +    ++Y    ++   FV      NL  F KD Y     S   N  V GV 
Sbjct: 264 PGGPLGGS---FTQYFVGDFDGKQFVPDTNQTNLLDFGKDYYAFQAFSSTPNDDVLGVA 319

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 158 RPLHDPTDEFAIVLYDPSVDGDMIMHDNSQDVRNDKKDSTKEKG-TDSKDEETKTGSKKF 216
           + ++ P   F  + +   +  D ++ D+S+D+ ND      EKG T S++E+ K   K +
Sbjct: 18  KNMYKPETMFGTMNWPKLMSKDTLISDSSEDITNDSTTGKTEKGHTGSENEKLKQSIKPY 77

Query: 217 AHPKLMT 223
            H  ++T
Sbjct: 78  -HVFMIT 83

>AGL004C [4307] [Homologous to ScYFL002C (SPB4) - SH]
           (715488..717416) [1929 bp, 642 aa]
          Length = 642

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 660 QTLDLIEKMCRN-KHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718
           Q L  + KM  N K YS   L G +  N R K +DRF    G+    LL++     GI++
Sbjct: 325 QHLAKLNKMDENLKLYS---LHGKLLTNSRMKTLDRFTQELGKA--VLLTTDVAARGIDI 379

Query: 719 IGANRLILMDP 729
              + ++ MDP
Sbjct: 380 PDIDLVLQMDP 390

>CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces
           cerevisiae YNR052c POP2, start by similarity
          Length = 478

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 411 YETLRRNVDQLRNCDVGLMLADE-GHRLKNGDS 442
           Y+T+R NVD L    +GL L+DE G++  NG S
Sbjct: 264 YQTMRANVDFLNPIQLGLSLSDENGNKPDNGPS 296

>Scas_588.16
          Length = 693

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 631 SGKFAILERFLHKI----KTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGT 682
           SGKF + ++ L K+    K E   K++LIS+  + LD++E     +     R+ GT
Sbjct: 126 SGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>KLLA0E04763g complement(429714..431624) similar to sgd|S0006383
           Saccharomyces cerevisiae YPR179c PLO1, start by
           similarity
          Length = 636

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 631 SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQK 690
           SGKFA+L R L  +  E +   VL++   +T+DL+E +      + VR DG  TI  + K
Sbjct: 113 SGKFAVL-RDLITLVQEYETHTVLMARSDRTMDLLEALLLGNKVNIVRHDG-QTIKTKNK 170

>YML091C (RPM2) [3880] chr13 complement(87123..90731) Bifunctional
           protein that acts as the protein component of
           mitochondrial Ribonuclease P (RNase P) involved in tRNA
           maturation, and is also required for optimal translation
           of certain mitochondrial mRNAs [3609 bp, 1202 aa]
          Length = 1202

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 336 GKRLIDKCIIVCPSSL-VNNWANELVKWLGPGTLSPLAVDGKKSS 379
            K++IDKC+ VCP S+ + N  N ++  +    L+ L ++  K S
Sbjct: 804 NKQIIDKCLEVCPDSIELKNIVNLMISKIPGRNLTQLIINNPKFS 848

>AAL069C [118] [Homologous to ScYDR295C (PLO2) - SH]
           (226816..228813) [1998 bp, 665 aa]
          Length = 665

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 630 FSGKFAILERFLHKIKTESDD----KIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTI 685
            S KF +L + +  I +        ++VL+S+  + LDLIE     K     RL GT   
Sbjct: 114 MSEKFRVLNQMMEAILSRRRRQRPLQLVLVSHSVKELDLIEGFMLGKMVKIKRLSGTSLF 173

Query: 686 NKRQKLVDR 694
           +++ +  +R
Sbjct: 174 DEKHQYTER 182

>KLLA0A04983g complement(445032..448787) similar to sp|P32790
           Saccharomyces cerevisiae YBL007c SLA1 cytoskeleton
           assembly control protein singleton, start by similarity
          Length = 1251

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 42  VPYKTAKPRALSSEHEKEVVQVNGRILRKRSHTVSYSGLDISSAAADVDE 91
           +P +  +P A ++EH   V +V+GR   K + TVS   +   SA   VD+
Sbjct: 293 LPSRNGRPSASTAEHVWSVSEVDGRKKCKATLTVSAERIHFFSAKTKVDQ 342

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,071,642
Number of extensions: 1301363
Number of successful extensions: 5455
Number of sequences better than 10.0: 155
Number of HSP's gapped: 5233
Number of HSP's successfully gapped: 251
Length of query: 875
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 765
Effective length of database: 12,788,129
Effective search space: 9782918685
Effective search space used: 9782918685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)