Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.2837237214880.0
YPR065W (ROX1)368582385e-22
Sklu_2286.4308572199e-20
ADL331C416591972e-16
CAGL0D05434g241641471e-10
KLLA0B11495g393741456e-10
Sklu_2103.3230601426e-10
Scas_614.4294911421e-09
Kwal_55.21061337611421e-09
AAR026W336621384e-09
YDR174W (HMO1)2461331044e-05
CAGL0E00737g27453890.004
KLLA0D18029g244122840.017
Kwal_26.8043410135830.025
CAGL0L02013g50368830.026
Scas_682.13250130790.064
Scas_378.249363790.082
YKL032C (IXR1)59763790.100
KLLA0E18557g46468760.19
Sklu_2445.817153740.20
AGL141W25253740.30
CAGL0K03047g20152710.48
Scas_715.31115139720.76
CAGL0M10505g19650671.9
Kwal_47.16709168855682.2
YNL118C (DCP2)970105672.8
YMR072W (ABF2)183104652.9
CAGL0F07271g73384655.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.28
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.28                                                           577   0.0  
YPR065W (ROX1) [5493] chr16 (679688..680794) Heme-dependent tran...    96   5e-22
Sklu_2286.4 YPR065W, Contig c2286 4323-5249                            89   9e-20
ADL331C [1410] [Homologous to ScYPR065W (ROX1) - SH] (119995..12...    80   2e-16
CAGL0D05434g complement(518042..518767) some similarities with s...    61   1e-10
KLLA0B11495g complement(1006306..1007487) some similarities with...    60   6e-10
Sklu_2103.3 , Contig c2103 5595-6287                                   59   6e-10
Scas_614.4                                                             59   1e-09
Kwal_55.21061                                                          59   1e-09
AAR026W [212] [Homologous to NOHBY] complement(388824..389834) [...    58   4e-09
YDR174W (HMO1) [1016] chr4 (812104..812844) Protein involved in ...    45   4e-05
CAGL0E00737g complement(66741..67565) similar to tr|Q03973 Sacch...    39   0.004
KLLA0D18029g join(1521909..1521950,1522143..1522835) highly simi...    37   0.017
Kwal_26.8043                                                           37   0.025
CAGL0L02013g complement(233619..235130) some similarities with s...    37   0.026
Scas_682.13                                                            35   0.064
Scas_378.2                                                             35   0.082
YKL032C (IXR1) [3225] chr11 complement(379708..381501) Intrastra...    35   0.100
KLLA0E18557g complement(1642554..1643948) some similarities with...    34   0.19 
Sklu_2445.8 YDR174W, Contig c2445 8497-9012 reverse complement         33   0.20 
AGL141W [4171] [Homologous to ScYDR174W (HMO1) - SH] complement(...    33   0.30 
CAGL0K03047g 283255..283860 weakly similar to sp|Q02486 Saccharo...    32   0.48 
Scas_715.3                                                             32   0.76 
CAGL0M10505g 1051487..1052077 similar to sp|Q03435 Saccharomyces...    30   1.9  
Kwal_47.16709                                                          31   2.2  
YNL118C (DCP2) [4476] chr14 complement(402652..405564) Putative ...    30   2.8  
YMR072W (ABF2) [4031] chr13 (411568..412119) Abundant mitochondr...    30   2.9  
CAGL0F07271g complement(707309..709510) weakly similar to sp|P53...    30   5.0  

>Scas_667.28
          Length = 372

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/372 (79%), Positives = 295/372 (79%)

Query: 1   MTRSLSVADITNTFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNGA 60
           MTRSLSVADITNTFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNGA
Sbjct: 1   MTRSLSVADITNTFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNGA 60

Query: 61  IHNRGKLEKIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENE 120
           IHNRGKLEKIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENE
Sbjct: 61  IHNRGKLEKIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENE 120

Query: 121 KTHWSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHATPWGFXXXXXXXXXXXXXX 180
           KTHWSD                                 HATPWGF              
Sbjct: 121 KTHWSDLAKEEKLEHLKKYPQYKYKPTRRKPRKVPKKLKHATPWGFQKLSNFQQQQHQQQ 180

Query: 181 XXXXXNYVRTDMNGFYXXXXXXXXXXXINQFPSYEASGFQNPNMTLINKQVPSVPRILQP 240
                NYVRTDMNGFY           INQFPSYEASGFQNPNMTLINKQVPSVPRILQP
Sbjct: 181 EMIQPNYVRTDMNGFYQHQQHQQPQQHINQFPSYEASGFQNPNMTLINKQVPSVPRILQP 240

Query: 241 NALPRDASYHPSPPLHSQNIMYQQPNGPIPSYSMVVHNSSRNQQPYMQQGSQSNIVIKSN 300
           NALPRDASYHPSPPLHSQNIMYQQPNGPIPSYSMVVHNSSRNQQPYMQQGSQSNIVIKSN
Sbjct: 241 NALPRDASYHPSPPLHSQNIMYQQPNGPIPSYSMVVHNSSRNQQPYMQQGSQSNIVIKSN 300

Query: 301 YDNNTNVGNNHILRLPYPRTSSLPDRMTQXXXXXXXXXXXXXXNRELARQLPIPPLSAIN 360
           YDNNTNVGNNHILRLPYPRTSSLPDRMTQ              NRELARQLPIPPLSAIN
Sbjct: 301 YDNNTNVGNNHILRLPYPRTSSLPDRMTQPPVLLPSLLSPSSSNRELARQLPIPPLSAIN 360

Query: 361 LNRAGSEEYFKK 372
           LNRAGSEEYFKK
Sbjct: 361 LNRAGSEEYFKK 372

>YPR065W (ROX1) [5493] chr16 (679688..680794) Heme-dependent
           transcriptional repressor of hypoxic genes including
           CYC7 and ANB1 [1107 bp, 368 aa]
          Length = 368

 Score = 96.3 bits (238), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 46/58 (79%)

Query: 69  KIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSD 126
           KIPRPKNAFILFRQHYH+ LIDEWT  G +IPHNS ISKI+G KWK +   +K HW +
Sbjct: 9   KIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWEN 66

>Sklu_2286.4 YPR065W, Contig c2286 4323-5249
          Length = 308

 Score = 89.0 bits (219), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 49/57 (85%)

Query: 68  EKIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
           EKIPRP+NAFILFRQH+HK LID+  + G  IPHNSEISK+LG +W+++S +EK++W
Sbjct: 3   EKIPRPRNAFILFRQHHHKLLIDQLREEGKPIPHNSEISKLLGTRWRSLSTDEKSYW 59

>ADL331C [1410] [Homologous to ScYPR065W (ROX1) - SH]
           (119995..121245) [1251 bp, 416 aa]
          Length = 416

 Score = 80.5 bits (197), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 68  EKIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSD 126
           + IPRP+NAFILFR H  K L D W ++G DIPHN E+SKI+  +WK ++  EK  W D
Sbjct: 22  QHIPRPRNAFILFRSHQQKLLTDYWKQSGQDIPHNCEVSKIISYQWKKLTAEEKKEWHD 80

>CAGL0D05434g complement(518042..518767) some similarities with
           sp|P25042 Saccharomyces cerevisiae YPR065w ROX1,
           hypothetical start
          Length = 241

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 7/64 (10%)

Query: 70  IPRPKNAFILFRQHYHKELIDEWTKA-------GTDIPHNSEISKILGVKWKNISENEKT 122
           IPRP+NAFILFRQH H++L  + TK         +    NSE S+ +G KW+N+   EK 
Sbjct: 146 IPRPRNAFILFRQHMHRKLFPKLTKDKQKSSDNSSSFKTNSECSREIGQKWRNLDPEEKK 205

Query: 123 HWSD 126
           +W++
Sbjct: 206 YWNE 209

>KLLA0B11495g complement(1006306..1007487) some similarities with
           ca|CA0346|CaROX1 Candida albicans Possible
           heme-dependent transcriptional repressor (by homology),
           hypothetical start
          Length = 393

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 11/74 (14%)

Query: 64  RGKLEKIPRPKNAFILFRQHYHKELID-EWTKAGTDIPH----------NSEISKILGVK 112
           R + + IPRP+NAFILFRQH+H+++ D E  K  TD             NS+ S+ +G K
Sbjct: 275 RPQQQHIPRPRNAFILFRQHWHQQVFDQEKEKITTDTSQGTSKLGSFKANSQASRDIGRK 334

Query: 113 WKNISENEKTHWSD 126
           W+++ ++EK +W D
Sbjct: 335 WRSLPDSEKKYWLD 348

>Sklu_2103.3 , Contig c2103 5595-6287
          Length = 230

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 69  KIPRPKNAFILFRQHYHKELIDEWTKAGTD--IPHNSEISKILGVKWKNISENEKTHWSD 126
           +IPRP+NAFILFRQH H+ L        T      N E+S+ +G +W+ +S  E+ +W+D
Sbjct: 123 RIPRPRNAFILFRQHLHQSLFPSQYSQSTQGSFKTNCEVSREIGQRWRQLSNEERQYWND 182

>Scas_614.4
          Length = 294

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (54%), Gaps = 17/91 (18%)

Query: 43  LPNMVMVSSSIDDNNNGAIHNRGKLEKIPRPKNAFILFRQHYH-------KELIDEWTKA 95
           L      + SI++  NG IH       IPRP+NAFILFRQH H       KEL+D+    
Sbjct: 177 LQGKCTCNKSINEKFNG-IHTH-----IPRPRNAFILFRQHLHHSLFPKNKELLDKEGSF 230

Query: 96  GTDIPHNSEISKILGVKWKNISENEKTHWSD 126
            T    NS +S+ +G +W+ + E++K +W D
Sbjct: 231 KT----NSNVSREIGQRWRALDEDDKKYWQD 257

>Kwal_55.21061
          Length = 337

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 4/61 (6%)

Query: 70  IPRPKNAFILFRQHYHKELIDEWTKAG----TDIPHNSEISKILGVKWKNISENEKTHWS 125
           IPRP+NAFILFRQH H++L  + + +          NS+IS+ +G +W+ +++ ++ HW 
Sbjct: 235 IPRPRNAFILFRQHLHQQLFAKQSASCENTEVSFKTNSQISREIGQRWRELNDADRCHWQ 294

Query: 126 D 126
           D
Sbjct: 295 D 295

>AAR026W [212] [Homologous to NOHBY] complement(388824..389834)
           [1011 bp, 336 aa]
          Length = 336

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 5/62 (8%)

Query: 70  IPRPKNAFILFRQHYHKEL-----IDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
           IPRP+NAFILFRQH+H++L     I +  +       NS++S  +G +W+++S  E+  W
Sbjct: 225 IPRPRNAFILFRQHWHQQLFPQERIKQSERGNGSFKTNSQVSVDIGQRWRSLSPEERQKW 284

Query: 125 SD 126
            D
Sbjct: 285 LD 286

>YDR174W (HMO1) [1016] chr4 (812104..812844) Protein involved in
           rDNA transcription mediated by RNA polymerase I,
           contains an HMG-box DNA-binding domain, interacts with
           FK506-binding protein Fpr1p [741 bp, 246 aa]
          Length = 246

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 16/133 (12%)

Query: 6   SVADITNTFDSPTMSNENNHSIFTTAT-SLPPITDRLNLPNMVMVSSS----IDDNNNGA 60
           + + I + +++     E     FTT T SL  +T  +N  ++  +SS     IDD+ +  
Sbjct: 30  TASSIVDFYNAIGDDEEEKIEAFTTLTESLQTLTSGVN--HLHGISSELVNPIDDDKDAI 87

Query: 61  IHN-----RGKLEKIP----RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGV 111
           I       R K+E+ P    +P   F  +  +  +EL ++  KAG     ++EI++ +  
Sbjct: 88  IAAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQKAGLPPLSSTEITQEISK 147

Query: 112 KWKNISENEKTHW 124
           KWK +S+NEK  W
Sbjct: 148 KWKELSDNEKEKW 160

>CAGL0E00737g complement(66741..67565) similar to tr|Q03973
           Saccharomyces cerevisiae YDR174w Non-histone protein,
           hypothetical start
          Length = 274

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
           +P   F  +  +  +EL D   +AG     ++EI++ +  KWKN+S+ EK  W
Sbjct: 123 KPLTVFFAYSAYVRQELRDARAQAGLPPLSSTEITQEISKKWKNLSDEEKEKW 175

>KLLA0D18029g join(1521909..1521950,1522143..1522835) highly similar
           to YDR174w Saccharomyces cerevisiae YDR174w HMO1
           Non-histone protein singleton, hypothetical start
          Length = 244

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 50/122 (40%), Gaps = 22/122 (18%)

Query: 10  ITNTFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNGAIHNRGKLEK 69
           +T      T S    +SI T  T+  PI D   +P     +  +              +K
Sbjct: 54  LTEALQKLTSSTNQLNSISTELTN--PIEDEKEIPTTDAAAKVVK-------------KK 98

Query: 70  IPR-------PKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKT 122
           IPR       P   F  +  +  + L DE  +AG     ++EI++ +  KWK++ ++EK 
Sbjct: 99  IPRDPYAPKKPLTVFFAYSAYVRQALRDERQRAGLPPLSSTEITQEISKKWKDLGDSEKD 158

Query: 123 HW 124
            W
Sbjct: 159 KW 160

>Kwal_26.8043
          Length = 410

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 25/135 (18%)

Query: 6   SVADITNTFDS------PTMSNENNHSIFTTATSLPPITDRLNLPNM--------VMVSS 51
           SVA++ NTF++        M  +     F  A + P + D +  P M        + VS 
Sbjct: 172 SVANVLNTFNAGAHSMNAAMVTQPAQRFFHAAMNTPSMMD-MTHPAMMQPTPQFHLQVSP 230

Query: 52  SIDDNNNGA---IHNRGKLEKI--PRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEIS 106
            +    + +   I  R  L+K    RP +A+ LF     +EL+ ++  A   +P   E+S
Sbjct: 231 PVVKKMSASQSRIEKRKLLKKQGPKRPSSAYFLFSMAVREELVRQYPDA--KVP---ELS 285

Query: 107 KILGVKWKNISENEK 121
           K+   KWK +++ +K
Sbjct: 286 KLASAKWKEMTDEDK 300

>CAGL0L02013g complement(233619..235130) some similarities with
           sp|P33417 Saccharomyces cerevisiae YKL032c IXR1,
           hypothetical start
          Length = 503

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 61  IHNRGKLEKI--PRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISE 118
           I  R +L+K    RP +A+ LF      EL+ ++  A   +P   E+SK+   +W+ +S+
Sbjct: 295 IEKRKQLKKQGPKRPSSAYFLFSMSIRNELLQQFPDA--KVP---ELSKLASARWRELSD 349

Query: 119 NEKTHWSD 126
           +EK  + D
Sbjct: 350 DEKKPYYD 357

>Scas_682.13
          Length = 250

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 22/130 (16%)

Query: 9   DITNTFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNG--AIHN--- 63
           D     D+ T   E   ++ + AT L  I+  L  P        +DD+ +   A+H    
Sbjct: 44  DEEEKIDAFTTLTEALQALTSAATQLHGISSELVNP--------MDDDKDIPIALHTVTP 95

Query: 64  -----RGKLEKIP----RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWK 114
                + K E+ P    +P   F  +  +  +EL DE  + G     ++EI++ +  KWK
Sbjct: 96  IKQAAKKKAERDPNAPKKPLTVFFAYSAYVRQELRDERQRNGLPPLSSTEITQEISKKWK 155

Query: 115 NISENEKTHW 124
            +++ EK  W
Sbjct: 156 ELNDTEKEKW 165

>Scas_378.2
          Length = 493

 Score = 35.0 bits (79), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 61  IHNRGKLEKI--PRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISE 118
           I  R +L+K    RP +A+ LF      EL++++  A   +P   E+SK+   +WK +++
Sbjct: 332 IERRKQLKKQGPKRPSSAYFLFSMSIRNELLEQFPDAK--VP---ELSKLASARWKELTD 386

Query: 119 NEK 121
           +EK
Sbjct: 387 DEK 389

>YKL032C (IXR1) [3225] chr11 complement(379708..381501) Intrastrand
           crosslink recognition protein and transcription factor
           that confers oxygen (O2) regulation on COX5B, has 2
           HMG-box DNA-binding domains [1794 bp, 597 aa]
          Length = 597

 Score = 35.0 bits (79), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 61  IHNRGKLEKI--PRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISE 118
           I  R +L+K    RP +A+ LF      EL+ ++ +A   +P   E+SK+   +WK +++
Sbjct: 350 IERRKQLKKQGPKRPSSAYFLFSMSIRNELLQQFPEA--KVP---ELSKLASARWKELTD 404

Query: 119 NEK 121
           ++K
Sbjct: 405 DQK 407

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSD 126
           RP   FI F Q     ++ E    G       EI+KI+G +W+ +   +K  +++
Sbjct: 436 RPSGPFIQFTQEIRPTVVKENPDKGL-----IEITKIIGERWRELDPAKKAEYTE 485

>KLLA0E18557g complement(1642554..1643948) some similarities with
           sp|P33417 Saccharomyces cerevisiae YKL032c IXR1
           intrastrand crosslink recognition protein and
           transcription factor, hypothetical start
          Length = 464

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 61  IHNRGKLEKI--PRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISE 118
           I  R +L+K    RP +A+ LF      EL+ ++  A   +P   E+SK+   KWK++++
Sbjct: 306 IAKRKELKKQGPKRPSSAYFLFSISIRPELLKQYPDA--KVP---ELSKLSSAKWKSMTD 360

Query: 119 NEKTHWSD 126
            EK  + D
Sbjct: 361 EEKKPFFD 368

>Sklu_2445.8 YDR174W, Contig c2445 8497-9012 reverse complement
          Length = 171

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
           +P   F  +  +  + L ++  KAG     ++EI++ +  KWK +S++EK  W
Sbjct: 31  KPLTVFFAYSAYVRQALREDRQKAGLPPLSSTEITQEISKKWKELSDSEKDKW 83

>AGL141W [4171] [Homologous to ScYDR174W (HMO1) - SH]
           complement(449074..449115,449204..449920) [759 bp, 252
           aa]
          Length = 252

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 28/53 (52%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
           +P   F  +  +  + L +E  + G     ++EI++ +  KWK +S++EK  W
Sbjct: 108 KPLTVFFAYSAYVRQALREERQRTGLPPLSSTEITQEISKKWKELSDSEKDKW 160

>CAGL0K03047g 283255..283860 weakly similar to sp|Q02486
           Saccharomyces cerevisiae YMR072w, hypothetical start
          Length = 201

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNS--EISKILGVKWKNISENEK 121
           RP  AFIL+        + E   A  + P  S  EIS +LG KW+ +SE EK
Sbjct: 57  RPAAAFILY-------TVQERANATAENPGLSTKEISAVLGEKWRQLSEYEK 101

>Scas_715.3
          Length = 1115

 Score = 32.3 bits (72), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 59/139 (42%), Gaps = 10/139 (7%)

Query: 190  TDMNGFYXXXXXXXXXXXINQFPSYEASGFQNPNMTLINKQVPSVPRILQPNALPRDA-- 247
            +++NG             +++ P         P+ +  N+ +P++PR ++ ++ P  A  
Sbjct: 892  SEINGIPLSMLDQTGSVQLDESPMVSGQDATLPSFSNSNEPLPNIPRGIRSHSHPAKAQV 951

Query: 248  -SYHPSPPLHSQNIMYQQPNGPIPSY-------SMVVHNSSRNQQPYMQQGSQSNIVIKS 299
             +  PS P H  +   Q P  PI S        + +  N   N  P  +Q SQ N+  ++
Sbjct: 952  GTSSPSGPYHQSSTSMQTPVSPITSSLRKLANPTSLFGNHRNNSNPLPKQLSQHNLNARN 1011

Query: 300  NYDNNTNVGNNHILRLPYP 318
            N  N+ N+ N  +   P P
Sbjct: 1012 NGTNSGNLKNVDVDLAPLP 1030

>CAGL0M10505g 1051487..1052077 similar to sp|Q03435 Saccharomyces
           cerevisiae YDL002c non-histone protein, hypothetical
           start
          Length = 196

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEK 121
           RP NA++LF      E+  E  K G  +    +++K L   WKN+SE E+
Sbjct: 101 RPTNAYLLF-----CEMNKEKIKEGGSV----DVTKDLTESWKNLSEQER 141

>Kwal_47.16709
          Length = 1688

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 10/55 (18%)

Query: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSD 126
           RPKN      + Y++ ++D+      +I H +EI K L  ++KNI+++ KTH +D
Sbjct: 500 RPKNT-----KDYYRIVVDQ-----VNIVHWTEIMKTLRREFKNIAKDLKTHKTD 544

>YNL118C (DCP2) [4476] chr14 complement(402652..405564) Putative
           pyrophosphatase required with Dcp1p for mRNA decapping,
           suppresses the respiratory deficiency of a petite mutant
           [2913 bp, 970 aa]
          Length = 970

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 218 GFQNPNMTLINKQVPSVPRILQPNALPRDASYHPSPPLHSQNIMYQQPNGPIPSYSMVVH 277
            F  PNM  ++    S P  L P  LPRD+ Y  S P    +I+    N   P  +  V 
Sbjct: 404 AFGVPNMHNLSGPAVSQPFSLPPAPLPRDSGYSSSSPGQLLDIL----NSKKPDSN--VQ 457

Query: 278 NSSRNQQPYMQQGSQSNIVIKSNYDNNTNVGNNHILRLPYPRTSS 322
           +S + +   +Q+G+  N + ++N D   +  +  +L L    TSS
Sbjct: 458 SSKKPKLKILQRGTDLNSIKQNNNDETAHSNSQALLDLLKKPTSS 502

>YMR072W (ABF2) [4031] chr13 (411568..412119) Abundant mitochondrial
           DNA-binding protein required for maintenance,
           transmission and recombination of mitochondrial genome,
           contains two HMG-box DNA-binding domains [552 bp, 183
           aa]
          Length = 183

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 15/104 (14%)

Query: 23  NNHSIFTTA--TSLPPITDRLNLPNMVMVSSSIDDNNNGAIHNRGKLEKIPRPKNAFILF 80
           N++S+ T +   S  P+    NL + ++ +S      N  I    K     RP +A+ L+
Sbjct: 2   NSYSLLTRSFHESSKPL---FNLASTLLKASKRTQLRNELIKQGPK-----RPTSAYFLY 53

Query: 81  RQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHW 124
            Q +  + + E           +EISKI G KW+N+  + K  +
Sbjct: 54  LQDHRSQFVKE-----NPTLRPAEISKIAGEKWQNLEADIKEKY 92

>CAGL0F07271g complement(707309..709510) weakly similar to sp|P53135
           Saccharomyces cerevisiae YGL113w, start by similarity
          Length = 733

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 13  TFDSPTMSNENNHSIFTTATSLPPITDRLNLPNMVMVSSSIDDNNNGAIHNRGKLEKIPR 72
           TF   T ++   ++IF     L    D+L + +++M S+++D+NN  +  ++ +   +  
Sbjct: 374 TFKITTQTDTIQNNIFDFYELLDIYLDKLLITDILMSSTNLDNNNTDSESDQPEENMVET 433

Query: 73  PKNAFILFRQHYHKELIDEWTKAG 96
            K  F    QHY K ++D+  +A 
Sbjct: 434 KKYNF----QHYMKRILDKNDEAS 453

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,748,425
Number of extensions: 444738
Number of successful extensions: 1557
Number of sequences better than 10.0: 58
Number of HSP's gapped: 1539
Number of HSP's successfully gapped: 61
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)