Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.2733233216060.0
CAGL0K12254g3352903885e-44
YBR105C (VID24)3622433835e-43
Sklu_2286.33382583241e-34
Kwal_27.126133112053178e-34
ADL330W2762122939e-31
KLLA0B09592g3332192838e-29
Scas_718.43562212822e-28
YGR066C2922242326e-22
CAGL0I07909g303642691.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.27
         (332 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.27                                                           623   0.0  
CAGL0K12254g complement(1196376..1197383) similar to sp|P38263 S...   154   5e-44
YBR105C (VID24) [294] chr2 complement(450838..451926) Protein re...   152   5e-43
Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement        129   1e-34
Kwal_27.12613                                                         126   8e-34
ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH] complement...   117   9e-31
KLLA0B09592g 834414..835415 weakly similar to sp|P38263 Saccharo...   113   8e-29
Scas_718.4                                                            113   2e-28
YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein...    94   6e-22
CAGL0I07909g 763900..773010 similar to sp|P19158 Saccharomyces c...    31   1.7  

>Scas_667.27
          Length = 332

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/332 (91%), Positives = 305/332 (91%)

Query: 1   MMRLHGTASENYQGSSTSKREIPRLKSLLNGPXXXXXXXXXXXXXXPCKILWTPPKATSK 60
           MMRLHGTASENYQGSSTSKREIPRLKSLLNGP              PCKILWTPPKATSK
Sbjct: 1   MMRLHGTASENYQGSSTSKREIPRLKSLLNGPSIIFKSIFFKDIISPCKILWTPPKATSK 60

Query: 61  RSTEYAKELIHAVERKVNCREETSIRLEKKRIRNEDIFIRARNIPKYCPLWENTLSHYLK 120
           RSTEYAKELIHAVERKVNCREETSIRLEKKRIRNEDIFIRARNIPKYCPLWENTLSHYLK
Sbjct: 61  RSTEYAKELIHAVERKVNCREETSIRLEKKRIRNEDIFIRARNIPKYCPLWENTLSHYLK 120

Query: 121 PKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXXHLTGRLNIQGFSDTGEDVTTYFE 180
           PKKRFHGVQVVGPKVYVIKVDLET             HLTGRLNIQGFSDTGEDVTTYFE
Sbjct: 121 PKKRFHGVQVVGPKVYVIKVDLETINFPPFNYNIFNPHLTGRLNIQGFSDTGEDVTTYFE 180

Query: 181 GYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVNKRWSKLPL 240
           GYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVNKRWSKLPL
Sbjct: 181 GYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVNKRWSKLPL 240

Query: 241 RVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKFTGEIEG 300
           RVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKFTGEIEG
Sbjct: 241 RVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKFTGEIEG 300

Query: 301 FYHERGTAAFQRLSLQPVETLTNVSSDSFELC 332
           FYHERGTAAFQRLSLQPVETLTNVSSDSFELC
Sbjct: 301 FYHERGTAAFQRLSLQPVETLTNVSSDSFELC 332

>CAGL0K12254g complement(1196376..1197383) similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 335

 Score =  154 bits (388), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 153/290 (52%), Gaps = 32/290 (11%)

Query: 69  LIHAVERKVNCREETSIRLEKKRIRNEDIFIRARNIPKYC-PLWENTL-SHYLKPKKRFH 126
           L H ++R  +  E   ++ +KK I N+       ++P+Y  P  +NT  +++L+P+  F 
Sbjct: 52  LQHLIDR--SSSESLPLKKKKKYIMNDRSSYTTVSVPRYVTPTHKNTTQTNFLRPRLEFS 109

Query: 127 GVQVVGPKVYVIKVDLETXX--XXXXXXXXXXXHLTGRLNIQGFSDTGEDVTTYFEGYSI 184
           G Q+ G K Y + V L+T               H+TG L I+G +    ++TT+FE Y++
Sbjct: 110 GYQLSGYKRYQVNVSLKTVDLPTVESGNTTTTPHITGYLTIKGLTSQHPEITTFFEAYAV 169

Query: 185 ENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVN------------ 232
           E+++LGFLSS W +    E   +DD  D+ HWL    FR +   +  N            
Sbjct: 170 EHNELGFLSSQWPEENNYEPYKSDDQTDLEHWLNFPAFRELFIAQHANLVKEDEEATPDF 229

Query: 233 --KRWSKLPLRVLKDIVNETEYQNDG------RYVFMKWKERFVIDHAVDDEPVAGITYR 284
             KR S   +  L ++  E + QN+G      RY+FM+WKE+F++  A   E V G +Y 
Sbjct: 230 KKKRQS---INTLAELFMENQAQNEGRNYLNDRYIFMRWKEKFLVPDAF-VENVDGASYD 285

Query: 285 GFYYIVHDKFTGEIEGFYHERGTAAFQRLSLQPVETLTNV--SSDSFELC 332
           GFYY+VHD+ TG ++GFY+ +    FQ+L L P +   ++  SS +FEL 
Sbjct: 286 GFYYVVHDQLTGCMQGFYYHQDAERFQQLELVPCKKAQDLCNSSCTFELA 335

>YBR105C (VID24) [294] chr2 complement(450838..451926) Protein
           required for vacuolar import and degradation of Fbp1p
           (fructose-1,6-bisphosphatase) [1089 bp, 362 aa]
          Length = 362

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/243 (35%), Positives = 132/243 (54%), Gaps = 26/243 (10%)

Query: 116 SHYLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXXHLTGRLNIQGFSDTGEDV 175
           ++YL+P+ +F G Q+ G K Y + V+L+T             HL+G L+I+G ++   ++
Sbjct: 120 TNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEI 179

Query: 176 TTYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRI--------LN 227
           +TYFE Y++ + +LGFLSS+W+D P L +  A D  D+ HW+    FR++        LN
Sbjct: 180 STYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLN 239

Query: 228 KKPVNKRWS--------KLPLRVLKDIVN-------ETEYQN--DGRYVFMKWKERFVID 270
               N   +        +LP     D  N       E ++ N  + R++FMKWKE+F++ 
Sbjct: 240 STDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVP 299

Query: 271 HAVDDEPVAGITYRGFYYIVHDKFTGEIEGFYHERGTAAFQRLSLQPVETLTNVSSD-SF 329
            A+  E V G +Y GFYYIVHD+ TG I+GFY+ +    FQ+L L P       SSD SF
Sbjct: 300 DALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVESSDCSF 359

Query: 330 ELC 332
           E  
Sbjct: 360 EFA 362

>Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement
          Length = 338

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 131/258 (50%), Gaps = 49/258 (18%)

Query: 114 TLSHYLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXXHLTGRLNIQGFSDTGE 173
           T +++LKP+ +F G QV G K Y + VDL+T             HLTG L I+G ++   
Sbjct: 91  TRTNFLKPRMKFTGYQVSGYKKYQVIVDLQTVDLPTTPATTTTPHLTGFLTIRGLTNQHP 150

Query: 174 DVTTYFEGYSIENDKLGFLSSNWEDHPCL-EDLTA---DDIVDIFHWLKLKPFRRILNKK 229
           ++TT+FE +++  D +GFLSS      C+ E+L A   +D VD+ HWL    F+ +  ++
Sbjct: 151 EITTFFESFTVM-DTIGFLSS------CIPEELNAYKGNDHVDLEHWLNFPCFKELCMRR 203

Query: 230 PV--NKRWSKLP-----------------------------LRVLKDIVNETEYQND--- 255
           P   NK  S                                + +L  I+N  +Y ++   
Sbjct: 204 PASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILN-GQYTHENYL 262

Query: 256 -GRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKFTGEIEGFYHERGTAAFQRLS 314
             R++FM+WKE+F++  A  D  V G +Y G+YYIVHD+ TG I GFY+ +    FQ+L 
Sbjct: 263 CNRFIFMRWKEKFLVPDAEIDS-VEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLE 321

Query: 315 LQPVETLTNVSSDSFELC 332
           L PV +    + D FE C
Sbjct: 322 LSPVMSGMESACD-FEFC 338

>Kwal_27.12613
          Length = 311

 Score =  126 bits (317), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 116 SHYLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXX-HLTGRLNIQGFSDTGED 174
           +++L+P+ +F G Q+   K Y + V L+T              H+TG L+I+G +    +
Sbjct: 100 TNFLRPRMQFSGYQISDYKKYQVTVSLQTVALPDAPGSSAMAPHVTGFLSIRGLTSQHPE 159

Query: 175 VTTYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVNKR 234
           +TT+F+GY++  D LGFLSS     P L+   A D  D+ HWL    F+ +   +     
Sbjct: 160 ITTFFDGYAV-TDNLGFLSSALP--PELDAFKATDKTDLEHWLSFPCFKELCRPESACDE 216

Query: 235 WSKLPLRVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKF 294
            + +   VL+   +  +Y  + R+++M+WKE+F++  A  D  V G +Y G+YYIVHD+ 
Sbjct: 217 GTNVLGAVLEGSYSHEDYLQN-RFIYMRWKEKFLVPDAEIDS-VEGASYDGYYYIVHDQV 274

Query: 295 TGEIEGFYHERGTAAFQRLSLQPVE 319
           TG I GFY+ +    FQ+L L P++
Sbjct: 275 TGHILGFYYHQDAEKFQQLELTPLQ 299

>ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH]
           complement(121954..122784) [831 bp, 276 aa]
          Length = 276

 Score =  117 bits (293), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 113 NTLSHYLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXX-HLTGRLNIQGFSDT 171
            T +++L+P   F G Q+ G K Y + V L+T              H+TG L I+G ++ 
Sbjct: 67  TTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQ 126

Query: 172 GEDVTTYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPV 231
             ++TT+FE +++ ND +GFLSS+    P L +  + D VD+ HWL    F+ +      
Sbjct: 127 HPEITTFFESFAV-NDTVGFLSSSMP--PELAEYKSSDRVDLEHWLNFPSFKELCMAGGG 183

Query: 232 NKRWSKLPLRVLKDIVNETEYQND---GRYVFMKWKERFVIDHAVDDE--PVAGITYRGF 286
                      + DI++      D    R+VFM+WKE+F++    D+E   V G +Y G+
Sbjct: 184 T---------TVADIMDGHYTHRDYLARRFVFMRWKEKFLVP---DEEVGAVEGASYDGY 231

Query: 287 YYIVHDKFTGEIEGFYHERGTAAFQRLSLQPV 318
           YYIVHD+ TG + GFY+ +    FQ+L L PV
Sbjct: 232 YYIVHDQVTGSVLGFYYHKDAEKFQQLELTPV 263

>KLLA0B09592g 834414..835415 weakly similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 333

 Score =  113 bits (283), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 114/219 (52%), Gaps = 9/219 (4%)

Query: 116 SHYLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXX-XXHLTGRLNIQGFSDTGED 174
           +H+L  +KRF G Q+ G K + + + +++              HLTG L+I+G +    +
Sbjct: 122 THWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNPE 181

Query: 175 VTTYFEGYSIENDKLGFLSSNWEDHPC-LEDLTADDIVDIFHWLKLKPFRRILNKKPVNK 233
           +TT+FE  ++  D LGFLS   +D P       A D  D+ HWL    F+ +  +     
Sbjct: 182 ITTFFESITV-TDSLGFLS---KDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKY 237

Query: 234 RWSKLPLRVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDK 293
               +   ++    + T+Y N  R+++M+W E+F++  A D E + G +Y G+YYIVHD+
Sbjct: 238 PSKNILQSIIDGTYSHTDYLNQ-RFLYMRWNEKFLVPDA-DLESIDGASYDGYYYIVHDQ 295

Query: 294 FTGEIEGFYHERGTAAFQRLSLQPVETLTNVSSDSFELC 332
             G I GFY+      FQ+L LQP++   ++   SFE  
Sbjct: 296 LLGNILGFYYHEHAERFQQLELQPLQE-PSIGDCSFEFA 333

>Scas_718.4
          Length = 356

 Score =  113 bits (282), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 114/221 (51%), Gaps = 18/221 (8%)

Query: 108 CPLWENTLSHYLKPKKRFHGVQVVGPKVYVIKVDLETXX--XXXXXXXXXXXHLTGRLNI 165
            P    T +++L P  +F G Q+ G K Y + V ++T               H+TG L I
Sbjct: 129 IPSATTTNTNFLTPSMKFKGFQMSGYKKYQVTVTIKTVNLPSSTQETITTQPHMTGSLTI 188

Query: 166 QGFSDTGEDVTTYFEGYSIENDKLGFLSSNWEDH--PCLEDLTADDIVDIFHWLKLKPFR 223
           +G +     +TT+F+ +++ N+   FLSS+W+ +    L DL ++D +D+ HWL    F+
Sbjct: 189 KGLTFQYPQITTFFQSFAV-NENFHFLSSHWDANTRAQLHDLQSNDRIDLEHWLNFPIFK 247

Query: 224 RILNKKPVNKRWSKLPL-RVLKDIVNETEYQNDGRYVFMKWKERFVI---DHAVDDEPVA 279
           ++       +      +   LK  +N        R++FM+WKE+F+I   +H  DD+   
Sbjct: 248 QLFMADVEGEETQDHEIDSYLKQYLN-------NRFIFMRWKEKFLIRDGEHIDDDDEDE 300

Query: 280 --GITYRGFYYIVHDKFTGEIEGFYHERGTAAFQRLSLQPV 318
             G ++ GFYYIVHD+  G I GFY+ +    FQ+L L PV
Sbjct: 301 INGASFDGFYYIVHDQVDGSIHGFYYHKDAEKFQQLELVPV 341

>YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein of
           unknown function, has low similarity to a region of S.
           cerevisiae Vid24p, which is required for vacuolar import
           and degradation of fructose-1,6-bisphosphatase (S.
           cerevisiae Fbp1p) [879 bp, 292 aa]
          Length = 292

 Score = 94.0 bits (232), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 98/224 (43%), Gaps = 18/224 (8%)

Query: 118 YLKPKKRFHGVQVVGPKVYVIKVDLETXXXXXXXXXXXXX-HLTGRLNIQGFSDTGEDVT 176
           +L+P  RF G Q      Y ++V ++T              H+TG   I+  +   + V 
Sbjct: 78  FLRPGLRFGGSQSSKYTYYTVEVKIDTVNLPLYKDSRSLDPHVTGTFTIKNLTPVLDKVV 137

Query: 177 TYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPVNKRWS 236
           T FEGY I  ++    S +W     L+   A    D  HW +   F         +  WS
Sbjct: 138 TLFEGYVINYNQFPLCSLHWPAEETLDPYMAQRESDCSHWKRFGHFG--------SDNWS 189

Query: 237 KLPLRVLKDIVNETEYQNDGRYVFMKWKERFVIDHAV-------DDEPVAGITYRGFYYI 289
            L  R      +E+    + RY+++KWKERF++D          D+  + G ++ GFYY+
Sbjct: 190 -LTERNFGQYNHESAEFMNQRYIYLKWKERFLLDDEEQENLMLDDNHHLEGASFEGFYYV 248

Query: 290 VHDKFTGEIEGFYHERGTAAFQRLSLQPVET-LTNVSSDSFELC 332
             D+ TG +EG+Y+      FQ+L L P      N  S  FE+ 
Sbjct: 249 CLDQLTGSVEGYYYHPACELFQKLELVPTNCDALNTYSSGFEIA 292

>CAGL0I07909g 763900..773010 similar to sp|P19158 Saccharomyces
           cerevisiae YOL081w IRA2 GTPase-activating protein for
           RAS proteins, hypothetical start
          Length = 3036

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 96  DIFIRARNIPKYCPLWENTLSHYLKPKKRFHGVQVVGPKVYV 137
           D +++  N P+YC   +NT++H LK       +    PK YV
Sbjct: 227 DAYLKTNNYPEYCSNMDNTINHILK------FIAAANPKEYV 262

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,805,146
Number of extensions: 467064
Number of successful extensions: 993
Number of sequences better than 10.0: 10
Number of HSP's gapped: 991
Number of HSP's successfully gapped: 11
Length of query: 332
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 230
Effective length of database: 13,065,073
Effective search space: 3004966790
Effective search space used: 3004966790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)