Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.26*1261266693e-92
YPR063C1401193928e-50
CAGL0D01540g1271273794e-48
ADL329W111941882e-19
KLLA0B08415g1211071875e-19
Kwal_27.1261072831801e-18
Scas_562.571260640.81
KLLA0F08811g63649640.93
KLLA0D00550g57944585.2
Sklu_1454.138556585.4
KLLA0B07535g87969569.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.26*
         (126 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.26*                                                          262   3e-92
YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....   155   8e-50
CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...   150   4e-48
ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....    77   2e-19
KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...    77   5e-19
Kwal_27.12610                                                          74   1e-18
Scas_562.5                                                             29   0.81 
KLLA0F08811g complement(819834..821744) some similarities with s...    29   0.93 
KLLA0D00550g complement(55088..56827) similar to sp|Q08579 Sacch...    27   5.2  
Sklu_1454.1 YHR004C, Contig c1454 1069-2226 reverse complement         27   5.4  
KLLA0B07535g complement(654189..656828) similar to sp|P34110 Sac...    26   9.4  

>Scas_667.26*
          Length = 126

 Score =  262 bits (669), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60
           MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV
Sbjct: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60

Query: 61  HYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSDEI 120
           HYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSDEI
Sbjct: 61  HYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSDEI 120

Query: 121 PITEEK 126
           PITEEK
Sbjct: 121 PITEEK 126

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score =  155 bits (392), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 76/119 (63%), Positives = 91/119 (76%), Gaps = 3/119 (2%)

Query: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60
           M LNNV RPDLC    +  PPKGLYS  PS+SG+VNQSMPMAAIFLRN+F+AWF++IQSV
Sbjct: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60

Query: 61  HYYLNTDEDEANA-KDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSD 118
           HYYLNTDED   A K+ K  S ++Q P IK+ M+++GL VCYMNLVFP   Q+ QP S 
Sbjct: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFP--QQIAQPSSS 117

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score =  150 bits (379), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 98/127 (77%), Gaps = 2/127 (1%)

Query: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60
           M LNNV+R DLC +  ++ PP+G+YS   S+SGIVNQ+MPMAAIFL+N+F+AWF++IQSV
Sbjct: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60

Query: 61  HYYLNTDEDEANAKDGKQ-SSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSDE 119
           H YLNTDE+       K  +S+++Q P++KVAM++VG++VCYMNLVFP  +  P P S++
Sbjct: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPD-APPPSSEK 119

Query: 120 IPITEEK 126
             + EEK
Sbjct: 120 KILDEEK 126

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score = 77.0 bits (188), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 7/94 (7%)

Query: 14  RASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSVHYYLNTDEDEANA 73
           R +  + P   Y+   +  G+V+QSMPM A+F+RN+F+AWF+++ + H YL  D +    
Sbjct: 17  RYTHVLAPDTAYTG--ASQGVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRD 74

Query: 74  KDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFP 107
           ++G      E  PI+K+ MA+V ++VCY  +V P
Sbjct: 75  REGT-----EVGPIMKLGMAVVAVVVCYTGMVLP 103

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score = 76.6 bits (187), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 9/107 (8%)

Query: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60
           M LNNV+RPDL A  +    PKGLYS+  S  G+++QSMPMAA+F++N+F+AWFAV+ + 
Sbjct: 1   MPLNNVRRPDLVATYNHTPAPKGLYSSSSSSQGMLSQSMPMAAMFMKNKFLAWFAVLTTW 60

Query: 61  HYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFP 107
           H +L +  D +N  D         +P +K+ MA++ + + Y+ L FP
Sbjct: 61  HVFLTSQPDPSNPTD---------SPFMKIGMAVLAVGMNYLGLFFP 98

>Kwal_27.12610
          Length = 72

 Score = 73.9 bits (180), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 17/83 (20%)

Query: 39  MPMAAIFLRNRFVAWFAVIQSVHYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLI 98
           MPMAA+F+RN+F+AWFA++ +VHY L T+ D ANA         +Q+ ++KV M++V L 
Sbjct: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD-ANA---------DQSAVVKVLMSLVSLA 50

Query: 99  VCYMNLVFPVVNQMPQP-PSDEI 120
           VCY+N+ F      PQP P+D I
Sbjct: 51  VCYINVAF------PQPGPADAI 67

>Scas_562.5
          Length = 712

 Score = 29.3 bits (64), Expect = 0.81,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 9   PDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSVHYYLNTDE 68
           PDLC     AI P+       +++G    S P+A+  +    ++  + +  +HYYL +DE
Sbjct: 394 PDLCTNYYGAIDPQD------AVTGNAPTS-PLASSVMSTEIISNLSRVSKLHYYLVSDE 446

>KLLA0F08811g complement(819834..821744) some similarities with
           sp|P38915 Saccharomyces cerevisiae YLR055c SPT8
           transcriptional adaptor or co-activator singleton,
           hypothetical start
          Length = 636

 Score = 29.3 bits (64), Expect = 0.93,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 69  DEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPS 117
           D  N  DGK S +I+Q   +  ++   G++  Y        N++PQPPS
Sbjct: 218 DFLNTVDGKLSLTIQQKNALVDSIVNAGILTSYWE------NEVPQPPS 260

>KLLA0D00550g complement(55088..56827) similar to sp|Q08579
           Saccharomyces cerevisiae YOR192c, hypothetical start
          Length = 579

 Score = 26.9 bits (58), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 29  PSMSGIVNQSMPMAAI------FLRNRFVAWFAVIQSVHYYLNT 66
           P + G++N + P   I      F +  F+  FAV  +++Y +NT
Sbjct: 463 PGLPGLINAANPNIPINTGIEHFFQGSFIFQFAVTFALYYIINT 506

>Sklu_1454.1 YHR004C, Contig c1454 1069-2226 reverse complement
          Length = 385

 Score = 26.9 bits (58), Expect = 5.4,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query: 44  IFLRNRFVA------WFAV---IQSVHYYLNTDEDEANAKDGKQSSSIEQTPIIKV 90
           +FL N F+       W+ +   +  + +    DEDE N ++G  +   E+TP I +
Sbjct: 66  LFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSINI 121

>KLLA0B07535g complement(654189..656828) similar to sp|P34110
           Saccharomyces cerevisiae YJL154c VPS35 protein-sorting
           protein, vacuolar singleton, start by similarity
          Length = 879

 Score = 26.2 bits (56), Expect = 9.4,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 55  AVIQSVHYYL---NTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQ 111
           A+IQ++++     NTDE+E +A DG+  S+ E+     V+     L   +   +  +  +
Sbjct: 303 AIIQNLNHLKLDSNTDEEEHSADDGE--STAEKLDSEPVSRNKFDLFFVFWKYLTKITEE 360

Query: 112 MPQPPSDEI 120
            P  P  EI
Sbjct: 361 RPDLPLHEI 369

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,008,456
Number of extensions: 139977
Number of successful extensions: 385
Number of sequences better than 10.0: 14
Number of HSP's gapped: 382
Number of HSP's successfully gapped: 14
Length of query: 126
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 37
Effective length of database: 13,515,107
Effective search space: 500058959
Effective search space used: 500058959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)