Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.25*1541548261e-115
CAGL0D01562g1551537188e-99
YPR062W (FCY1)1581526962e-95
Kwal_27.126071521506362e-86
KLLA0B08437g1521506154e-83
ADL328C1511505321e-70
Scas_690.232561001196e-08
ACR075C245991117e-07
KLLA0C10989g2381021082e-06
YJL035C (TAD2)2501001055e-06
Kwal_23.2894247991037e-06
CAGL0J01023g2591051002e-05
Kwal_47.17610321124810.009
AFR023W30074760.031
YHR144C (DCD1)31272750.050
Scas_677.24316101750.052
CAGL0G05852g30772720.098
CAGL0A00847g32947720.11
Sklu_2368.332971720.12
KLLA0F24794g59782690.29
AAL030C153954670.59
Kwal_33.1449914454640.79
AFR493C32437651.0
CAGL0C05291g584148632.2
Scas_703.3745993622.3
Scas_670.29*35745622.6
CAGL0F07271g733101622.8
Scas_713.2658265613.3
CAGL0K08294g404134605.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.25*
         (154 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.25*                                                          322   e-115
CAGL0D01562g complement(166898..167365) highly similar to sp|Q12...   281   8e-99
YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,...   272   2e-95
Kwal_27.12607                                                         249   2e-86
KLLA0B08437g complement(750194..750652) highly similar to sp|Q12...   241   4e-83
ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH] (123313..12...   209   1e-70
Scas_690.23                                                            50   6e-08
ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH] (497467..49...    47   7e-07
KLLA0C10989g complement(944739..945455) similar to sp|P47058 Sac...    46   2e-06
YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit t...    45   5e-06
Kwal_23.2894                                                           44   7e-06
CAGL0J01023g complement(100059..100838) similar to sp|P47058 Sac...    43   2e-05
Kwal_47.17610                                                          36   0.009
AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH] complement(...    34   0.031
YHR144C (DCD1) [2432] chr8 complement(387789..388727) Deoxycytid...    33   0.050
Scas_677.24                                                            33   0.052
CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces c...    32   0.098
CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3 Sacch...    32   0.11 
Sklu_2368.3 YHR144C, Contig c2368 5164-6153                            32   0.12 
KLLA0F24794g 2306055..2307848 similar to sp|Q12362 Saccharomyces...    31   0.29 
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    30   0.59 
Kwal_33.14499                                                          29   0.79 
AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH] (1325485..1...    30   1.0  
CAGL0C05291g 504216..505970 similar to sp|Q12362 Saccharomyces c...    29   2.2  
Scas_703.37                                                            28   2.3  
Scas_670.29*                                                           28   2.6  
CAGL0F07271g complement(707309..709510) weakly similar to sp|P53...    28   2.8  
Scas_713.26                                                            28   3.3  
CAGL0K08294g complement(824619..836744) similar to sp|P36022 Sac...    28   5.3  

>Scas_667.25*
          Length = 154

 Score =  322 bits (826), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%)

Query: 1   MSAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGE 60
           MSAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGE
Sbjct: 1   MSAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGE 60

Query: 61  ISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLAS 120
           ISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLAS
Sbjct: 61  ISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLAS 120

Query: 121 RNVQVVQMDDERCKTIMKKFIDERPQDWFEDIGE 154
           RNVQVVQMDDERCKTIMKKFIDERPQDWFEDIGE
Sbjct: 121 RNVQVVQMDDERCKTIMKKFIDERPQDWFEDIGE 154

>CAGL0D01562g complement(166898..167365) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine
           deaminase, hypothetical start
          Length = 155

 Score =  281 bits (718), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 133/153 (86%), Positives = 139/153 (90%)

Query: 2   SAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEI 61
           +A QWD LGM IA+EEAA G+ EGGVPIGGCLINNKDG VLGRGHNMRFQKGSPTLHGEI
Sbjct: 3   NAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEI 62

Query: 62  STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASR 121
           STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIL+YGIPR VIGES NFKSPGE YL SR
Sbjct: 63  STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSR 122

Query: 122 NVQVVQMDDERCKTIMKKFIDERPQDWFEDIGE 154
            V+VVQM+DE CK IMKKFID RPQDWFEDIGE
Sbjct: 123 GVEVVQMNDEPCKAIMKKFIDTRPQDWFEDIGE 155

>YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,
           catalyzes the hydrolysis of cytidine into uridine and
           ammonia [477 bp, 158 aa]
          Length = 158

 Score =  272 bits (696), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 138/152 (90%)

Query: 3   AGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEIS 62
           A +WD+ GMDIA+EEAA GY EGGVPIGGCLINNKDG VLGRGHNMRFQKGS TLHGEIS
Sbjct: 7   ASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEIS 66

Query: 63  TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRN 122
           TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI+MYGIPR V+GE+VNFKS GE YL +R 
Sbjct: 67  TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRG 126

Query: 123 VQVVQMDDERCKTIMKKFIDERPQDWFEDIGE 154
            +VV +DDERCK IMK+FIDERPQDWFEDIGE
Sbjct: 127 HEVVVVDDERCKKIMKQFIDERPQDWFEDIGE 158

>Kwal_27.12607
          Length = 152

 Score =  249 bits (636), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 115/150 (76%), Positives = 130/150 (86%)

Query: 5   QWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTL 64
           +WD+ G+D+A+EEA  GY EGGVPIGGCLINNKDG VLG GHNMRFQKGS TLHGEISTL
Sbjct: 3   KWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEISTL 62

Query: 65  ENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNVQ 124
           ENCGR++G VYKD TLYTTLSPCDMCTGAIL+YGI R V+GE+VNFK  GE YLA R  +
Sbjct: 63  ENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERGCE 122

Query: 125 VVQMDDERCKTIMKKFIDERPQDWFEDIGE 154
           V  +DD+RCK IMK+FI+ERPQDWFEDIGE
Sbjct: 123 VKVLDDDRCKDIMKQFIEERPQDWFEDIGE 152

>KLLA0B08437g complement(750194..750652) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine deaminase
           singleton, start by similarity
          Length = 152

 Score =  241 bits (615), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%)

Query: 5   QWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTL 64
           +WDK GMD A+EEAA GY EGGVPIGGCLI+N  G++LG GHNMRFQKGSPTLHGE STL
Sbjct: 3   EWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTL 62

Query: 65  ENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNVQ 124
           EN GRL+G VYK  T+YTTLSPCDMCTGAIL+YGI RVV+GE+VNFKSPGE YLA R ++
Sbjct: 63  ENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERGIE 122

Query: 125 VVQMDDERCKTIMKKFIDERPQDWFEDIGE 154
           V  +DDERC  IMK FI +RP+DWFEDIGE
Sbjct: 123 VKVVDDERCIEIMKDFIAKRPEDWFEDIGE 152

>ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH]
           (123313..123768) [456 bp, 151 aa]
          Length = 151

 Score =  209 bits (532), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (76%), Gaps = 1/150 (0%)

Query: 4   GQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEIST 63
            QWD+ GM+IA++EA  GYAEGGVPIGGCLI+  DG VLGRG NMRFQ+ S TLHGE + 
Sbjct: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61

Query: 64  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNV 123
           LEN GRL G VYK  TLYTTLSPCDMC GA+L+YGIPR V+GE+  F    EA+L +R V
Sbjct: 62  LENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARGV 120

Query: 124 QVVQMDDERCKTIMKKFIDERPQDWFEDIG 153
           +V  + D RC+ +M++F+  RPQDW EDIG
Sbjct: 121 EVTVLQDARCRALMQQFVAARPQDWNEDIG 150

>Scas_690.23
          Length = 256

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query: 11  MDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRL 70
           M+ A + A         P+    ++    K++  G N   +  +   H E   +E    +
Sbjct: 12  MESAIKLARYALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHAEFMGIEQIKAM 71

Query: 71  EG-----KVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
            G     +++KDT LY T+ PC MC  A+   GI +VV G
Sbjct: 72  VGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFG 111

>ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH]
           (497467..498204) [738 bp, 245 aa]
          Length = 245

 Score = 47.4 bits (111), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 11  MDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRL 70
           M  A   A      G  P+    ++    +++  G N   +  +   H E   +     L
Sbjct: 8   MRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQEL 67

Query: 71  EGK----VYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
            G+    ++K+ T+Y T+ PC MC  A+   GI RV+ G
Sbjct: 68  FGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFG 106

>KLLA0C10989g complement(944739..945455) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2 tRNA-specific
           adenosine deaminase 2 singleton, start by similarity
          Length = 238

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 42/102 (41%), Gaps = 3/102 (2%)

Query: 7   DKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLEN 66
           D L M  A   A         P+    +++K  KV+  G N   +  S   H E   ++ 
Sbjct: 4   DLLHMRTAITLAKYALDHEETPVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQ 63

Query: 67  CGRLEG---KVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
                G   K+  +  LY T+ PC MC  A+   GI +VV G
Sbjct: 64  IQEKYGTDPKILSEVVLYVTVEPCIMCASALKQLGIKKVVFG 105

>YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit
           tRNA[Ala]-specific adenosine deaminase [753 bp, 250 aa]
          Length = 250

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 5/100 (5%)

Query: 11  MDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRL 70
           M  A   A         P+    ++   G+V+  G N   +  +   H E   ++    +
Sbjct: 7   MRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 66

Query: 71  EGK-----VYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
            G      V+KD TLY T+ PC MC  A+    I +VV G
Sbjct: 67  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFG 106

>Kwal_23.2894
          Length = 247

 Score = 44.3 bits (103), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 11  MDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGE---ISTLE-N 66
           M  A + A         P+    ++    ++L  G N   +  +   H E   IS ++  
Sbjct: 10  MRAALKLARYALDHDETPVACIFVHAPTNQILAYGMNDTNRSLTGIAHAEFMGISQIQAK 69

Query: 67  CGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
            G     VYKD  LY T+ PC MC  A+   GI +V+ G
Sbjct: 70  FGVQNTSVYKDIILYVTVEPCIMCASALKQLGIQKVIFG 108

>CAGL0J01023g complement(100059..100838) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2, hypothetical
           start
          Length = 259

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 10/105 (9%)

Query: 11  MDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGE---ISTLENC 67
           +D A + A      G  P+    ++ K   V+  G N      S T H E   +  L + 
Sbjct: 8   IDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLRDA 67

Query: 68  GRLEG-------KVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIG 105
            + +G       +++K+   Y T+ PC MC  A+   GI ++V G
Sbjct: 68  VQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFG 112

>Kwal_47.17610
          Length = 321

 Score = 35.8 bits (81), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 22/124 (17%)

Query: 12  DIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRLE 71
           D +FEE+ +G     +P+    +N K+ + +    + R++  SP  H  +  + +   LE
Sbjct: 170 DKSFEESKSG---NKIPVVSAFVNPKNQETVF-ATDCRYE-DSPLDHSIMRGIRSVAALE 224

Query: 72  GK-------------VYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYL 118
            K             +  D  +YTT  PC MC  A++   I R +   S+    P    L
Sbjct: 225 QKRKNEAKRGSEETYLCLDFDVYTTHEPCSMCAMALIHSRIKRCIYLNSM----PETGCL 280

Query: 119 ASRN 122
            SR+
Sbjct: 281 ESRS 284

>AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH]
           complement(483186..484088) [903 bp, 300 aa]
          Length = 300

 Score = 33.9 bits (76), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 57  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEA 116
           LH E + L   GR   +V +   LY    PC  C+  I+  GI  VV  ++    S    
Sbjct: 220 LHAEENALLEAGR--ERVGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSFK 277

Query: 117 YLASRNVQVVQMDD 130
            L +  V+V Q+ D
Sbjct: 278 VLRAGGVKVRQLQD 291

>YHR144C (DCD1) [2432] chr8 complement(387789..388727)
           Deoxycytidylate deaminase [939 bp, 312 aa]
          Length = 312

 Score = 33.5 bits (75), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 57  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEA 116
           LH E + L   GR   +V ++ TLY    PC  C+  I+  GI  VV  +S         
Sbjct: 232 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFK 289

Query: 117 YLASRNVQVVQM 128
            L +  + V Q 
Sbjct: 290 VLKNAGITVRQF 301

>Scas_677.24
          Length = 316

 Score = 33.5 bits (75), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 38/101 (37%), Gaps = 12/101 (11%)

Query: 30  GGCL-INNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRLEGKVYKDTTLYTTLSPCD 88
           GGC   NN D K L              LH E + L   GR   +V    TLY    PC 
Sbjct: 217 GGCRRCNNGDSKNLS---------TCLCLHAEENALLEAGR--DRVGVKATLYCDTCPCL 265

Query: 89  MCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNVQVVQMD 129
            C+  I+  GI  VV  ++          L S  + V Q +
Sbjct: 266 TCSVKIVQTGIKEVVYSQTYRMDEESFKVLTSAGINVRQFN 306

>CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces
           cerevisiae YHR144c DCD1 deoxycytidylate deaminase, start
           by similarity
          Length = 307

 Score = 32.3 bits (72), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 57  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEA 116
           LH E + L   GR   +V ++ TLY    PC  C+  I+  GI  VV  ++         
Sbjct: 227 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDDASFK 284

Query: 117 YLASRNVQVVQM 128
            L    ++V Q 
Sbjct: 285 VLREAGIKVRQF 296

>CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3, hypothetical
           start
          Length = 329

 Score = 32.3 bits (72), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 63  TLENCGRL-EGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESV 108
           +LE+C  + +  +  D  +YTT  PC MC+ A++   I R +  E +
Sbjct: 236 SLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIFIEQM 282

>Sklu_2368.3 YHR144C, Contig c2368 5164-6153
          Length = 329

 Score = 32.3 bits (72), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 2/71 (2%)

Query: 57  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEA 116
           LH E + L   GR   +V  + TLY    PC  C+  I+  GI  VV  +S         
Sbjct: 249 LHAEENALLEAGR--DRVGSNATLYCDTCPCLTCSVKIVQTGIREVVYSQSYRMDEASFK 306

Query: 117 YLASRNVQVVQ 127
            L S  V + Q
Sbjct: 307 VLQSGGVLIRQ 317

>KLLA0F24794g 2306055..2307848 similar to sp|Q12362 Saccharomyces
           cerevisiae YOL066c RIB2 DRAP deaminase, hypothetical
           start
          Length = 597

 Score = 31.2 bits (69), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 11  MDIAFEEAAN-GYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLEN-CG 68
           M++A +EA N G  +    +G  L+N  D  +L  G++      +   H E   L+    
Sbjct: 449 MELAIDEARNCGETQTAFNVGALLVNGTD--ILSTGYSRELPGNT---HAEQCALDKYFT 503

Query: 69  RLEGKVYKD-TTLYTTLSPCDM 89
           + EG    D T +YTT+ PC +
Sbjct: 504 KSEGAKLPDGTIIYTTMEPCSL 525

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 30.4 bits (67), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 44   RGHNMRFQ--KGSPTLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIL 95
            RG +M  +  +   TL   +  L+N  +LE  +  +     T+  CD+C GAI+
Sbjct: 1179 RGDSMYLKNIQKISTLQSRLKYLQNLTKLEQALKDNMRFNCTICLCDICDGAII 1232

>Kwal_33.14499
          Length = 144

 Score = 29.3 bits (64), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 57  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNF 110
           LH E + L   GR   +V  + TLY    PC  C+  I+  G+  VV  +S + 
Sbjct: 64  LHAEENALLEAGR--DRVGPNATLYCDTCPCLTCSVKIVQTGVREVVYSQSYHM 115

>AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH]
           (1325485..1326459) [975 bp, 324 aa]
          Length = 324

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 68  GRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVI 104
           GR +  +  D  +YTT  PC MC  A++   I R + 
Sbjct: 237 GRTDTYLCLDFDVYTTHEPCSMCAMALIHSRIKRCIF 273

>CAGL0C05291g 504216..505970 similar to sp|Q12362 Saccharomyces
           cerevisiae YOL066c RIB2 DRAP deaminase or sp|Q12069
           Saccharomyces cerevisiae YDL036c, hypothetical start
          Length = 584

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 58/148 (39%), Gaps = 23/148 (15%)

Query: 14  AFEEAAN-GYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRLEG 72
           A EEA   G  +    +G  L+N  +  VL  GH+      +   H E   LE       
Sbjct: 442 AIEEADKCGPTKTAFSVGAVLVNGTE--VLSVGHSRELPGNT---HAEQCALEKYFETHN 496

Query: 73  --KVYKDTTLYTTLSPCDM-------CTGAILMY--GIPRVVIG--ESVNFKSPGEAY-- 117
             KV   T ++TT+ PC         C   I+     I  V +G  E   F     +   
Sbjct: 497 TDKVPPGTVIFTTMEPCSFRLSGNLPCLQRIMAQDGNISTVFVGVMEPDTFVKNNTSLTD 556

Query: 118 LASRNVQVVQMD--DERCKTIMKKFIDE 143
           L + N+  +Q+   +E+CK I  K  DE
Sbjct: 557 LENNNINYIQIPGYEEQCKIIAFKGHDE 584

>Scas_703.37
          Length = 459

 Score = 28.5 bits (62), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 42  LGRGHNMRFQKGSPTLHGEISTLENCGRLEGKVYKD--TTLYTTLSPCDMCTGAILMYGI 99
           L RG  +R +    + H + S L N    E     D  +T+Y   SP  M T   L+Y  
Sbjct: 79  LRRGLTLRLESQWMS-HDDKSKLLNALHAEFDEVTDPSSTIYDPSSPILMLTFGFLIYDS 137

Query: 100 PRVVIGESVNFKSPGEAYLASRNVQVVQMDDER 132
             ++  +   F S  E +   R VQ   ++++R
Sbjct: 138 ASILFDDYKKFCSTEEEFELYRIVQAGALEEKR 170

>Scas_670.29*
          Length = 357

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 68  GRLEGKVYK----DTTLYTTLSPCDMCTGAILMYGIPRVVIGESV 108
           G LE ++      D  +YTT  PC MC+ A++   I R +  + +
Sbjct: 266 GELEDRISTYLCLDFDVYTTHEPCSMCSMALIHSRIRRCIFLQQM 310

>CAGL0F07271g complement(707309..709510) weakly similar to sp|P53135
           Saccharomyces cerevisiae YGL113w, start by similarity
          Length = 733

 Score = 28.5 bits (62), Expect = 2.8,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 40/101 (39%), Gaps = 14/101 (13%)

Query: 2   SAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEI 61
           S  +WD++ +   F    N +AE          + KD K++G    +     S     + 
Sbjct: 117 SKAEWDEIKITKIF----NSFAE----------STKDRKIIGNSSELFMTLPSNNEQNKN 162

Query: 62  STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRV 102
           +  E C   + K+Y +   Y+TL   D      +   +PRV
Sbjct: 163 TRTETCLVSDPKIYFNQRYYSTLFELDNAITYFVKSHLPRV 203

>Scas_713.26
          Length = 582

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 29  IGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTLENCGRLEGKVYKD----TTLYTTL 84
           +G  L+N  +  ++ RG++   +  +   H E   LE     +GK  KD    T LYTT+
Sbjct: 453 VGAILVNGTE--IISRGYSRELEGNT---HAEQCALEKYFSSKGK--KDIPFGTVLYTTM 505

Query: 85  SPCDM 89
            PC  
Sbjct: 506 EPCSF 510

>CAGL0K08294g complement(824619..836744) similar to sp|P36022
            Saccharomyces cerevisiae YKR054c DYN1 Dynein heavy chain
            cytosolic, hypothetical start
          Length = 4041

 Score = 27.7 bits (60), Expect = 5.3,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 117  YLASRNVQVVQMDDERCKTIMKKFIDE-RPQDWF 149
            + A  +V  +Q++DE+ K  MK+ IDE  P++++
Sbjct: 3938 HAAHNHVYSIQLEDEKDKISMKRLIDEILPEEFY 3971

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,102,263
Number of extensions: 204230
Number of successful extensions: 372
Number of sequences better than 10.0: 32
Number of HSP's gapped: 371
Number of HSP's successfully gapped: 32
Length of query: 154
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 61
Effective length of database: 13,376,635
Effective search space: 815974735
Effective search space used: 815974735
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)