Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.2325825812870.0
YPR060C (ARO7)25624310461e-145
KLLA0B08481g2602439911e-137
Kwal_27.126022572439621e-132
CAGL0K12232g2602489571e-132
ADL326W2592438341e-113
Kwal_55.2117953372730.24
AGL007W536217681.3
CAGL0C01683g111542653.4
KLLA0B07513g45658609.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.23
         (258 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.23                                                           500   0.0  
YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismat...   407   e-145
KLLA0B08481g 752482..753264 highly similar to sp|P32178 Saccharo...   386   e-137
Kwal_27.12602                                                         375   e-132
CAGL0K12232g complement(1194973..1195755) highly similar to sp|P...   373   e-132
ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH] complement(...   325   e-113
Kwal_55.21179                                                          33   0.24 
AGL007W [4304] [Homologous to ScYPL005W - SH] complement(710763....    31   1.3  
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...    30   3.4  
KLLA0B07513g complement(652357..653727) similar to sp|P32604 Sac...    28   9.7  

>Scas_667.23
          Length = 258

 Score =  500 bits (1287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/258 (95%), Positives = 246/258 (95%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL
Sbjct: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120
           DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV
Sbjct: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120

Query: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180
           YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI
Sbjct: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180

Query: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240
           KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP
Sbjct: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240

Query: 241 ITKXXXXXXXXXXXXSDY 258
           ITK            SDY
Sbjct: 241 ITKEVEVEYLLRRLESDY 258

>YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismate
           mutase, required for the synthesis of both phenylalanine
           and tyrosine [771 bp, 256 aa]
          Length = 256

 Score =  407 bits (1046), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/243 (81%), Positives = 219/243 (90%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDF KP+TVLNLQNIR ELV+MED+IIF+FIERSHFATC SVY+ NHPG+ IPNF GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120
           DWAL +LEI HS++RRFESPDETPFFP++I K  LPSINYP ILA YA EVNYNDKIKKV
Sbjct: 61  DWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKV 120

Query: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180
           YI++I+PLISK DGD K N+GSVATRD E LQ+LSRRIHFGKFVAEAKFQS   LY +LI
Sbjct: 121 YIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLI 180

Query: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240
           K+KDVEGIMK+ITNSAVEEKILERLTKKAEVYGVDPTN+ GERRITPEYLVKIYKEIVIP
Sbjct: 181 KSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTNESGERRITPEYLVKIYKEIVIP 240

Query: 241 ITK 243
           ITK
Sbjct: 241 ITK 243

>KLLA0B08481g 752482..753264 highly similar to sp|P32178
           Saccharomyces cerevisiae YPR060c ARO7 chorismate mutase
           singleton, start by similarity
          Length = 260

 Score =  386 bits (991), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/243 (75%), Positives = 214/243 (88%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDF KP+TVL+LQNIR ELVKMEDTIIF FIERSHFATCSSVY+ N P + +P+FDGSFL
Sbjct: 1   MDFFKPETVLDLQNIRDELVKMEDTIIFNFIERSHFATCSSVYESNVPEIKLPDFDGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120
           DWAL+ +EI HSQLRRFESPDETPFFP++ILKPI+PS+NYP ILASYA+++NYNDKIK +
Sbjct: 61  DWALMKMEIVHSQLRRFESPDETPFFPDKILKPIIPSLNYPKILASYANQINYNDKIKSI 120

Query: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180
           YI  IVPL+SK D +  EN+GSVATRD E LQ+LSRRIHFGKFVAEAKFQS KE + +LI
Sbjct: 121 YIKTIVPLLSKRDINTWENFGSVATRDIEALQSLSRRIHFGKFVAEAKFQSEKEKFTKLI 180

Query: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240
            ++DV+GIM  ITNS VEEKIL+RL  KA VYGVDPTN++G+R+ITPEYLVKIYKEIVIP
Sbjct: 181 LDQDVDGIMTAITNSKVEEKILQRLNVKATVYGVDPTNEKGDRKITPEYLVKIYKEIVIP 240

Query: 241 ITK 243
           ITK
Sbjct: 241 ITK 243

>Kwal_27.12602
          Length = 257

 Score =  375 bits (962), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 214/243 (88%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDFLKP+TVL+L NIR ELVKMEDTIIF FIERSHF TC +VY+   P + +P+FDGSFL
Sbjct: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120
           DWAL+H EITHSQLRRFESPD+TPFFP++ILKPILPSI+YP +L+SYA+E+N N +IK V
Sbjct: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120

Query: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180
           YI++I+P++SK+DG+  EN+GSVAT D E LQ+LSRRIHFGKFVAEAKFQ+ + LY ++I
Sbjct: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180

Query: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240
           K +D++GI + ITNSAVEEKILERL  KAEVYGVDP+NKEG R+ITPEYLVKIYKE+VIP
Sbjct: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240

Query: 241 ITK 243
           +TK
Sbjct: 241 LTK 243

>CAGL0K12232g complement(1194973..1195755) highly similar to
           sp|P32178 Saccharomyces cerevisiae YPR060c ARO7
           chorismate mutase, start by similarity
          Length = 260

 Score =  373 bits (957), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 185/248 (74%), Positives = 210/248 (84%), Gaps = 5/248 (2%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDF KP+TVLNLQNIR ELVKMED+IIF+FIERSHF  C+ VY PNHP ++IP+F GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASE-VNYNDKIKK 119
           DWALL +EITHS+LRRF+SPDETPFFPN+I +PILP INYP IL   AS+ VNYN+KIK 
Sbjct: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120

Query: 120 VYIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIEL 179
           +YI  IVPLIS  DGD KENYGSVATRD E LQ+LSRRIHFGKFVAEAKFQS  +LY ++
Sbjct: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180

Query: 180 IKNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPT----NKEGERRITPEYLVKIYK 235
           I+ KDV+GIM  ITN+AVEEKILERL +KA+VYGVDPT    + E  RRITPEYLVKIYK
Sbjct: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240

Query: 236 EIVIPITK 243
           EIVIPITK
Sbjct: 241 EIVIPITK 248

>ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH]
           complement(124969..125748) [780 bp, 259 aa]
          Length = 259

 Score =  325 bits (834), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 187/243 (76%)

Query: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60
           MDFL P +VLNL +IR ELV+MEDTIIF FIERS+F TC  VY  NH  + +P+FDGSFL
Sbjct: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60

Query: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120
           DWA +H+E+T SQLRRFE+PD+ PF+P  IL PILP + YP +LA YA ++NYND+IK +
Sbjct: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120

Query: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180
           Y+D +VPL+S  +G   EN GSV + D + LQ LSRRIHFGKFVAEAKFQ   E Y  LI
Sbjct: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180

Query: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240
           KN+DV+GIM  ITN  VE+KIL+RL  KA VYGVDP ++   +R+TPEYL KIYKE VIP
Sbjct: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240

Query: 241 ITK 243
           ITK
Sbjct: 241 ITK 243

>Kwal_55.21179
          Length = 533

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 32  ERSHFATCSSVYQPNHPGV-----SIPNFDGSFLDWALLHLEITHSQLRRFESPDETPFF 86
           E+  F  C  VY      +     SIP      LD   +++++   +   F S D  PFF
Sbjct: 82  EKLFFQWCRKVYGSFKAKLLYCIASIPYETSLALDCLDVYMQLLEQEATYFASQDGAPFF 141

Query: 87  PNEILKPILPSI 98
           PN+ LK ++ S+
Sbjct: 142 PNKTLKALIVSL 153

>AGL007W [4304] [Homologous to ScYPL005W - SH]
           complement(710763..712373) [1611 bp, 536 aa]
          Length = 536

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 90/217 (41%), Gaps = 25/217 (11%)

Query: 2   DFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFLD 61
           D L P    N +        M + +I+ F ++S +A+C   Y         PN +     
Sbjct: 198 DLLHPQ---NEKTASLRTTTMFNDLIYYFGKKSDYASCREYYSQMKLEKKTPNIE----T 250

Query: 62  WALLHLEITHS-QLRRFESP-DETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKK 119
           + LL L +  + Q+ + + P  E  F+ N++ K  +P+      + +Y   +      KK
Sbjct: 251 YRLLFLNLLKNMQIPKKQLPYKEMIFYLNDMEKFGVPA---DAKIWAYCYHLLVESVSKK 307

Query: 120 VYIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSR-----------RIHFGKFVAEAK 168
           + +++++   +    D   +       DC+ +   ++           R+   K   E K
Sbjct: 308 LLLEKMIQHNAPISPDFIVSILRTLDVDCKAILEFAKEYSIPFTPKLLRLCISKLCKEYK 367

Query: 169 FQSAKELYIELIKNKDV--EGIMKHITNSAVEEKILE 203
           F+SA +L   L ++ DV   G +  + N+A E+  L+
Sbjct: 368 FESAWQLLTSLCRSTDVVTTGSVNILLNAAAEKGRLD 404

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%)

Query: 188 IMKHITNSAVEEKILERLTKKAEVYGV-----DPTNKEGERR 224
           + + +T+++VEEKILER T+K  +  +      PTNK+ E +
Sbjct: 602 VFRFVTDNSVEEKILERATQKLRLDQLVIQQNRPTNKKKENK 643

>KLLA0B07513g complement(652357..653727) similar to sp|P32604
           Saccharomyces cerevisiae YJL155c FBP26 fructose-2,
           6-bisphosphatase, start by similarity
          Length = 456

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 182 NKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVI 239
           NK+   I +H    AVE+ +     K   V  +D TN   ERR   E+++K+ +E  I
Sbjct: 71  NKEAYKIRQHAVTMAVEDMMRWFNEKGGVVAILDATNSTSERR---EWILKLCRENAI 125

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,602,457
Number of extensions: 386292
Number of successful extensions: 1211
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1208
Number of HSP's successfully gapped: 35
Length of query: 258
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 159
Effective length of database: 13,168,927
Effective search space: 2093859393
Effective search space used: 2093859393
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)