Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_667.2230630615500.0
YPR058W (YMC1)30730813460.0
CAGL0D01606g30530612851e-180
Sklu_1926.230530711771e-164
Kwal_27.1259930430611511e-160
KLLA0B08503g30330611491e-159
YBR104W (YMC2)32932710751e-148
Scas_718.532432410341e-141
CAGL0K12210g31131110131e-139
Kwal_33.129883033059811e-134
Sklu_2398.43093059461e-128
Kwal_56.230113033059221e-125
Sklu_1275.13113059211e-125
KLLA0F17864g3073088571e-115
Scas_697.473283023072e-32
YOR100C (CRC1)3273082932e-30
ADL264C3292992896e-30
KLLA0C13431g3283022871e-29
CAGL0B04543g3173202861e-29
Sklu_2127.52782802771e-28
Kwal_23.29133203122782e-28
Kwal_33.154463052912747e-28
KLLA0E09680g3072942693e-27
YOR130C (ORT1)2922902589e-26
Kwal_55.213353172882563e-25
KLLA0E02772g2842952447e-24
ADL049W9122892538e-24
AFR146W2812912438e-24
Sklu_2075.33453102469e-24
CAGL0B03883g3063062361e-22
AGL311C3623072391e-22
Scas_714.183053082326e-22
Scas_632.92922972309e-22
CAGL0K10362g3013072291e-21
Sklu_2334.23192922265e-21
KLLA0E13453g9062842307e-21
Scas_691.43343182257e-21
Kwal_26.86692962922221e-20
YJR095W (SFC1)3222922212e-20
YOR222W (ODC2)3072972194e-20
Sklu_2037.23103092185e-20
CAGL0K02365g9192802236e-20
YPR021C (AGC1)9022812201e-19
YPL134C (ODC1)3103002123e-19
Kwal_47.173218812892165e-19
ACR109W2992852089e-19
KLLA0F03212g3052952081e-18
Kwal_47.182163333192011e-17
CAGL0M09020g3483282002e-17
Scas_640.253062981992e-17
YIL006W3732861976e-17
KLLA0D07073g2972931931e-16
Scas_662.123083111885e-16
Sklu_2359.69022921926e-16
Scas_602.88852901918e-16
CAGL0J02002g3612961825e-15
Scas_379.23013121799e-15
CAGL0J04114g3033001781e-14
YPR011C3262911772e-14
Scas_709.93652871773e-14
Scas_589.103163001754e-14
Scas_716.293162521745e-14
KLLA0E15532g3263221737e-14
YJL133W (MRS3)3143121673e-13
Sklu_2363.23232861649e-13
ACR260W3113201641e-12
CAGL0G03135g3072541603e-12
Kwal_23.47313143001595e-12
CAGL0L05742g3053121577e-12
CAGL0G01166g2952311577e-12
YFR045W2852061551e-11
CAGL0J01661g3273271551e-11
Kwal_55.208683803041561e-11
YGR096W (TPC1)3142581542e-11
AGL047C3162611542e-11
KLLA0F04697g3072981533e-11
CAGL0K08250g2972971505e-11
Kwal_26.79672972951505e-11
Scas_582.73293051506e-11
Kwal_33.140503142121506e-11
YKR052C (MRS4)3043031489e-11
AER366W2932981481e-10
Kwal_14.22103152541481e-10
YEL006W3352971444e-10
KLLA0D15015g3172341434e-10
YIL134W (FLX1)3113021435e-10
Scas_717.203563271436e-10
ADL009W3793141411e-09
YBL030C (PET9)3181791382e-09
YLR348C (DIC1)2981631382e-09
YBR291C (CTP1)2992931382e-09
Kwal_27.120813693051383e-09
Sklu_2432.52882241373e-09
CAGL0K02915g3423271373e-09
Kwal_0.2322742371363e-09
CAGL0G08910g2891731364e-09
KLLA0E08877g2941901364e-09
KLLA0C11363g5173161374e-09
Sklu_1149.22962951354e-09
AGL065C3352891364e-09
YNL083W5452091367e-09
Scas_578.3*5241911358e-09
Scas_489.42972961339e-09
Sklu_2374.75132101341e-08
YBR085W (AAC3)3071791321e-08
KLLA0D14036g4313311321e-08
Scas_718.243371751294e-08
AER184W3051931284e-08
CAGL0J05522g5192671304e-08
Sklu_2430.103241851285e-08
YNL003C (PET8)2842211275e-08
Scas_558.22892601266e-08
AEL253W3653101277e-08
CAGL0F04213g3061931251e-07
YHR002W (LEU5)3573211251e-07
Scas_721.1293231841241e-07
Scas_702.103021631241e-07
Sklu_2431.53703081242e-07
KLLA0D04290g1881911202e-07
CAGL0H10538g2971881222e-07
YKL120W (OAC1)3242751232e-07
Sklu_2442.82752511222e-07
KLLA0B12826g3192051222e-07
CAGL0H03839g2822441222e-07
Kwal_26.76533251801223e-07
Scas_721.273743421204e-07
CAGL0K11616g3201861205e-07
AGR383W2931851187e-07
CAGL0F07711g3683281189e-07
KLLA0A09383g3662741171e-06
Scas_667.43081751171e-06
AAL014C2712531161e-06
KLLA0E23705g3683061161e-06
YMR056C (AAC1)3091911161e-06
KLLA0E18810g3773051162e-06
CAGL0L02079g2971871142e-06
Kwal_23.39653071241143e-06
Kwal_27.116262991901133e-06
CAGL0J09790g3001901124e-06
Kwal_27.124813041751124e-06
KLLA0D04950g2742341114e-06
KLLA0E12353g3051511125e-06
YDL198C (YHM1)3002481116e-06
Scas_328.12271141071e-05
AER419W4932501091e-05
AAR036W3172591063e-05
Scas_562.123001921053e-05
Kwal_26.79723582661053e-05
Kwal_23.30425423091055e-05
AGR191W2982561028e-05
YJR077C (MIR1)3112201011e-04
KLLA0F13464g300791001e-04
Kwal_47.19228281144991e-04
Sklu_1119.130780992e-04
AFR542W310173992e-04
CAGL0F00231g307187992e-04
YER053C300236982e-04
Kwal_33.1559730580982e-04
Sklu_2115.4299185982e-04
Sklu_2435.2344145983e-04
Sklu_2117.229886983e-04
Scas_715.45305210983e-04
YMR166C368252974e-04
Scas_669.6373139965e-04
Kwal_27.11419298246956e-04
KLLA0D04312g10391870.001
AFR253W344112930.001
CAGL0M05225g381178920.002
Scas_673.1731480910.002
AER450C308175910.002
YBR192W (RIM2)377344910.002
Kwal_23.4354343274890.003
KLLA0E18788g38186890.004
Scas_613.24177163850.005
ABL023W309152860.007
KLLA0E02750g304243860.007
KLLA0B11319g355200860.007
YPR128C (ANT1)32893860.008
AFL196W361205860.009
Sklu_2433.8420334860.009
Sklu_2194.3312186850.011
Kwal_23.3529395197830.021
AFR131C344110820.022
Scas_645.9391193820.024
AGL064W296279810.030
ADR036C340134800.045
YMR241W (YHM2)314172790.050
CAGL0K07436g307195790.057
AFR147C315217780.078
KLLA0D09889g364288780.089
CAGL0C02013g329155770.098
Kwal_55.21338323249750.16
Scas_705.932376750.19
Scas_687.15*32881750.19
Kwal_23.5757307173740.23
KLLA0B14454g30567730.28
KLLA0A00979g34371730.31
Kwal_55.2110632834710.63
YDL119C307187700.82
Scas_696.9312161691.1
CAGL0D04774g322163681.4
YGR257C (MTM1)36639652.8
CAGL0F08305g374217652.9
AFR352C64268653.7
Sklu_2127.4323138644.4
Sklu_2409.557994619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_667.22
         (306 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_667.22                                                           601   0.0  
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   523   0.0  
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   499   e-180
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         457   e-164
Kwal_27.12599                                                         447   e-160
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   447   e-159
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   418   e-148
Scas_718.5                                                            402   e-141
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   394   e-139
Kwal_33.12988                                                         382   e-134
Sklu_2398.4 , Contig c2398 9476-10405                                 369   e-128
Kwal_56.23011                                                         359   e-125
Sklu_1275.1 , Contig c1275 314-1249                                   359   e-125
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   334   e-115
Scas_697.47                                                           122   2e-32
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   117   2e-30
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   115   6e-30
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   115   1e-29
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   114   1e-29
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        111   1e-28
Kwal_23.2913                                                          111   2e-28
Kwal_33.15446                                                         110   7e-28
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   108   3e-27
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   103   9e-26
Kwal_55.21335                                                         103   3e-25
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    99   7e-24
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   102   8e-24
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    98   8e-24
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                99   9e-24
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    96   1e-22
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    97   1e-22
Scas_714.18                                                            94   6e-22
Scas_632.9                                                             93   9e-22
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    93   1e-21
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         92   5e-21
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    93   7e-21
Scas_691.4                                                             91   7e-21
Kwal_26.8669                                                           90   1e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    90   2e-20
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    89   4e-20
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         89   5e-20
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    91   6e-20
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    89   1e-19
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    86   3e-19
Kwal_47.17321                                                          88   5e-19
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    85   9e-19
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    85   1e-18
Kwal_47.18216                                                          82   1e-17
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    82   2e-17
Scas_640.25                                                            81   2e-17
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    80   6e-17
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    79   1e-16
Scas_662.12                                                            77   5e-16
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          79   6e-16
Scas_602.8                                                             78   8e-16
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    75   5e-15
Scas_379.2                                                             74   9e-15
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    73   1e-14
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    73   2e-14
Scas_709.9                                                             73   3e-14
Scas_589.10                                                            72   4e-14
Scas_716.29                                                            72   5e-14
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    71   7e-14
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    69   3e-13
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          68   9e-13
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    68   1e-12
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    66   3e-12
Kwal_23.4731                                                           66   5e-12
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    65   7e-12
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    65   7e-12
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    64   1e-11
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    64   1e-11
Kwal_55.20868                                                          65   1e-11
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    64   2e-11
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    64   2e-11
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    64   3e-11
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    62   5e-11
Kwal_26.7967                                                           62   5e-11
Scas_582.7                                                             62   6e-11
Kwal_33.14050                                                          62   6e-11
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    62   9e-11
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    62   1e-10
Kwal_14.2210                                                           62   1e-10
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    60   4e-10
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    60   4e-10
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    60   5e-10
Scas_717.20                                                            60   6e-10
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    59   1e-09
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    58   2e-09
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    58   2e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    58   2e-09
Kwal_27.12081                                                          58   3e-09
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       57   3e-09
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    57   3e-09
Kwal_0.232                                                             57   3e-09
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    57   4e-09
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    57   4e-09
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    57   4e-09
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         57   4e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    57   4e-09
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    57   7e-09
Scas_578.3*                                                            57   8e-09
Scas_489.4                                                             56   9e-09
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       56   1e-08
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    55   1e-08
KLLA0D14036g complement(1203522..1204817) some similarities with...    55   1e-08
Scas_718.24                                                            54   4e-08
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    54   4e-08
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    55   4e-08
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         54   5e-08
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    54   5e-08
Scas_558.2                                                             53   6e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    54   7e-08
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    53   1e-07
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    53   1e-07
Scas_721.129                                                           52   1e-07
Scas_702.10                                                            52   1e-07
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            52   2e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    51   2e-07
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    52   2e-07
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    52   2e-07
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          52   2e-07
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    52   2e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    52   2e-07
Kwal_26.7653                                                           52   3e-07
Scas_721.27                                                            51   4e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    51   5e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    50   7e-07
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    50   9e-07
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    50   1e-06
Scas_667.4                                                             50   1e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    49   1e-06
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    49   1e-06
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    49   1e-06
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    49   2e-06
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    49   2e-06
Kwal_23.3965                                                           49   3e-06
Kwal_27.11626                                                          48   3e-06
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    48   4e-06
Kwal_27.12481                                                          48   4e-06
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    47   4e-06
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    48   5e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    47   6e-06
Scas_328.1                                                             46   1e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    47   1e-05
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    45   3e-05
Scas_562.12                                                            45   3e-05
Kwal_26.7972                                                           45   3e-05
Kwal_23.3042                                                           45   5e-05
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    44   8e-05
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    44   1e-04
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    43   1e-04
Kwal_47.19228                                                          43   1e-04
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             43   2e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    43   2e-04
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    43   2e-04
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    42   2e-04
Kwal_33.15597                                                          42   2e-04
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            42   2e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         42   3e-04
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            42   3e-04
Scas_715.45                                                            42   3e-04
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    42   4e-04
Scas_669.6                                                             42   5e-04
Kwal_27.11419                                                          41   6e-04
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    38   0.001
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    40   0.001
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    40   0.002
Scas_673.17                                                            40   0.002
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    40   0.002
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    40   0.002
Kwal_23.4354                                                           39   0.003
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    39   0.004
Scas_613.24                                                            37   0.005
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    38   0.007
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    38   0.007
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    38   0.007
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    38   0.008
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    38   0.009
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       38   0.009
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            37   0.011
Kwal_23.3529                                                           37   0.021
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    36   0.022
Scas_645.9                                                             36   0.024
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    36   0.030
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    35   0.045
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    35   0.050
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    35   0.057
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    35   0.078
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    35   0.089
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    34   0.098
Kwal_55.21338                                                          33   0.16 
Scas_705.9                                                             33   0.19 
Scas_687.15*                                                           33   0.19 
Kwal_23.5757                                                           33   0.23 
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    33   0.28 
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    33   0.31 
Kwal_55.21106                                                          32   0.63 
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    32   0.82 
Scas_696.9                                                             31   1.1  
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    31   1.4  
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    30   2.8  
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    30   2.9  
AFR352C [3544] [Homologous to ScYJR045C (SSC1) - SH; ScYEL030W (...    30   3.7  
Sklu_2127.4 , Contig c2127 6322-7293                                   29   4.4  
Sklu_2409.5 YBR296C, Contig c2409 19658-21397                          28   9.9  

>Scas_667.22
          Length = 306

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/306 (95%), Positives = 293/306 (95%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG
Sbjct: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
           LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD
Sbjct: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           VIKSVMQTDNLKSPKYGNSISSVAKTLY             PTMLRAAPANGATFATFEL
Sbjct: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFEL 300

Query: 301 AMRLLG 306
           AMRLLG
Sbjct: 301 AMRLLG 306

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/308 (81%), Positives = 273/308 (88%), Gaps = 3/308 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFP+PQLIDDLE HP+HDNARV+KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT
Sbjct: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TAMEV+RKLL NEGP+GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH RN D +S  LS
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS-TLS 119

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           LPQYY CG+TGGI NSFLASPIEHVRIRLQTQTGSG N EFKGPL+CI+KLR     +RG
Sbjct: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINK--GFKRTEVPAWKLCLFGALSGTTLWMMVYP 238
           LTPT+LREGHGCGTYFLVYEA++AN++NK  G +R ++PAWKLC+FGALSGT LW+MVYP
Sbjct: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239

Query: 239 LDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATF 298
           LDVIKSVMQTDNL+ PK+GNSISSVAKTLY             PTMLRAAPANGATFATF
Sbjct: 240 LDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299

Query: 299 ELAMRLLG 306
           ELAMRLLG
Sbjct: 300 ELAMRLLG 307

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  499 bits (1285), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 262/306 (85%), Gaps = 1/306 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFPTPQLIDDLE+HP  DN RV+KDLLAGTAGGIAQVL+GQPFDTTKVRLQTS  PT
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           +A EV++ LLKNEGPKGFYKGTLTPL+GVGACVS+QFGVNEAMKRFFH+RN D  +  LS
Sbjct: 61  SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNA-TLS 119

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           L QYY+CGLTGG+TNSFLASPIEHVRIRLQTQTGSG   EFKGP+DCI+KLR+Q G MRG
Sbjct: 120 LSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRG 179

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
           L PTMLREGHGCGTYFLVYEA+V+ +IN+G KRTE+P WKLCL+GALSGT LW+MVYP+D
Sbjct: 180 LIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPID 239

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           V+KSVMQTDNL  P+ G ++  VA+ LY             PTMLRAAPANG TFATFEL
Sbjct: 240 VVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFEL 299

Query: 301 AMRLLG 306
           AMRLLG
Sbjct: 300 AMRLLG 305

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  457 bits (1177), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 217/307 (70%), Positives = 252/307 (82%), Gaps = 3/307 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+EE PTP +IDDL+    HD+ RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTSS PT
Sbjct: 1   MTEELPTPLIIDDLDG--AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDST-SQIL 119
           TA++V++KL+KNEG +GFYKGTLTPL+GVGACVS+QFGVNEAMKRFFHSRN +S  ++ L
Sbjct: 59  TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMR 179
            L QYY+CG  GG  NSFLASPIEHVRIRLQTQTG+G   +F GPLDCI+KL A    MR
Sbjct: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178

Query: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPL 239
           GLTPTMLRE HGCG YFL YEA++ANE++KG  R+E+P WKLCLFGA SGTTLW+M+YPL
Sbjct: 179 GLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPL 238

Query: 240 DVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           DVIKSVMQTD+L  PK G ++  VAKT+Y             PTMLRAAPANGATFATFE
Sbjct: 239 DVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFE 298

Query: 300 LAMRLLG 306
           LAMR+LG
Sbjct: 299 LAMRVLG 305

>Kwal_27.12599
          Length = 304

 Score =  447 bits (1151), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/306 (70%), Positives = 247/306 (80%), Gaps = 2/306 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M EE  +P LIDD++  P HD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS+TPT
Sbjct: 1   MPEETSSPLLIDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT 59

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA+EV++KL+KNEG +GFYKGTLTPL+GVGACVS QFGVNEAMKRFF   + D   + L+
Sbjct: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADP-HKTLT 118

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           LPQYYICG  GG+ NSFLASPIEHVRIRLQTQT SG   EFKGPLDCI KLRA G  MRG
Sbjct: 119 LPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRG 178

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
           L+PT+LRE  GC TYFL YEA+VAN+I KG  R++VPAWKLCLFGA+SG TLW+ VYPLD
Sbjct: 179 LSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLD 238

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           VIKS+MQTDNLK+P  G +I  VA+ +              PTMLRAAPANGATFATFEL
Sbjct: 239 VIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

Query: 301 AMRLLG 306
           AMR LG
Sbjct: 299 AMRFLG 304

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  447 bits (1149), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/306 (73%), Positives = 253/306 (82%), Gaps = 3/306 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+EEFPTPQLIDDLE+   HDN RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS T T
Sbjct: 1   MTEEFPTPQLIDDLES--PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
            A++VI+ L+KNEGP GFYKGTLTPL+GVGACVSLQFGVNEAMKRFFH+ + ++ SQ LS
Sbjct: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD-EAASQHLS 117

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           L QYYICG+ GG TNSFLASPIEH+RIRLQTQTGSG   EFKGP+DCI+KLR  G  MRG
Sbjct: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
           LTPTMLRE HGCG YFL YEA++ +++  G +R ++PAWKLCLFGA SGT LW MVYPLD
Sbjct: 178 LTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLD 237

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           VIKSVMQTDNLK+PK GN+I +V +T+              PTMLRAAPAN ATFATFE 
Sbjct: 238 VIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFET 297

Query: 301 AMRLLG 306
           AMRLLG
Sbjct: 298 AMRLLG 303

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  418 bits (1075), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 245/327 (74%), Gaps = 21/327 (6%)

Query: 1   MSEEFPTPQLIDDLENHPK---------HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKV 51
           MSEEFPTPQL+D+LE+  K           + RV+KD+ AGT GGIAQVLVGQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 52  RLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH--- 108
           RLQT++T TT +EV+R L+KNEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF    
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 109 -SRNPDSTSQ--------ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNV 159
            S+NP+ +SQ         L L QYY+CGLTGG+ NSFLASPIE +RIRLQTQT +G + 
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 160 EFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAW 219
           EFKGP DCI+KL+AQGG MRGL PTM+R GHG GTYFLVYEA+VA EI  G  R E+P W
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 220 KLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXX 279
           KLCLFGA SGT LW+ VYPLDV+KS++Q D+L+ PKY NSIS VAKT+Y           
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 280 XXPTMLRAAPANGATFATFELAMRLLG 306
             PTM+R+AP NGATF TFEL MR LG
Sbjct: 301 FGPTMVRSAPVNGATFLTFELVMRFLG 327

>Scas_718.5
          Length = 324

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/324 (59%), Positives = 236/324 (72%), Gaps = 18/324 (5%)

Query: 1   MSEEFPTPQLIDDLE----------NHPKH----DNARVIKDLLAGTAGGIAQVLVGQPF 46
           MSE+F +PQLI++ +          N   H    D+ RV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 47  DTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106
           DTTKVR+QTS+    A+++IRKL+KNEG   FYKG+L P++GVGACVS+QFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 107 FHSRNPDSTSQ----ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162
           F   N    +Q     L L QYYICGLTGG+ NSFLASPIEHVRIRLQTQTG+G   EFK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 163 GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLC 222
           GPLDCIRKL  +   MRGL P MLR GHG G YFL YEA++ANEI KG  R+E+ +WKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 223 LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXP 282
            +G+LSG  LW+ +YPLDV+KS++QTD L++P++ NS+ +V   LY             P
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 283 TMLRAAPANGATFATFELAMRLLG 306
           TMLRAAP NGATF TFEL MRLLG
Sbjct: 301 TMLRAAPVNGATFVTFELVMRLLG 324

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  394 bits (1013), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/311 (60%), Positives = 227/311 (72%), Gaps = 5/311 (1%)

Query: 1   MSEEFPTPQLIDDLEN-HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           MSEEFPTPQL+++LE+  P     RV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 60  TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
              +EV++ LL+NEG   FYKG LTPL+GVG CVS+QFGVNE+MKRFF + N D      
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 120 SLP----QYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG 175
            +P    QYY+CGLTGG+ NSFLA+PIEHVRIRLQTQT  G   +FKGP DCI+KL    
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMM 235
             MRGL PTM+R GHG GTYF  YEA+V  E  KG  R ++PAWKLC FGALSGT LW+ 
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240

Query: 236 VYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATF 295
           VYP+DV+KSV+QTD++++PKY NSI    + LY             PTM+RAAPAN ATF
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATF 300

Query: 296 ATFELAMRLLG 306
            +FE+ MR+LG
Sbjct: 301 VSFEMTMRVLG 311

>Kwal_33.12988
          Length = 303

 Score =  382 bits (981), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 182/305 (59%), Positives = 220/305 (72%), Gaps = 3/305 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E   PQ++DDL +  K D  R +KD+ AGT GGIAQVLVGQPFD TKVRLQTSSTPT
Sbjct: 1   MSDELTMPQVVDDLTD--KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPT 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA+ V++ L+KNEG +GFYKGT  PLIGVG CVS QFG NEAMKR+FH RN +  S  L 
Sbjct: 59  TALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRN-NFQSTSLR 117

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           LP+YY CG   G  N+FLA+PIEHVRI LQ QT S  + E++G +DCI+KL  +G  MRG
Sbjct: 118 LPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
            TPT+LR  HG G YF  YEAM+ +E  KG  R ++PAWKLCL+GA SG+ LW MVYP D
Sbjct: 178 FTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFD 237

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           VIKSVMQ+D L++P YG ++  VAK +Y             PTMLR+ P NGATF  FE+
Sbjct: 238 VIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEM 297

Query: 301 AMRLL 305
           AMR+L
Sbjct: 298 AMRIL 302

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  369 bits (946), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 217/305 (71%), Gaps = 3/305 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E   PQ++DDL +    D  R IKD+L+GTAGGIAQVLVGQPFD TKVR+QTS+   
Sbjct: 1   MSDELTAPQVVDDLSD--SLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSA 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA++V+  L+KNEG  GFYKGTL PL+GVGACVS QFGVNEAMKR F   N D  S+ LS
Sbjct: 59  TAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDP-SKPLS 117

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           L QYY+CG+  G  N+FLA+PIEHVRIRLQ QT S  N E++G LDC+RKL  QG  MRG
Sbjct: 118 LKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
            T T++R  HG G YF  YEA++AN+  KG  R ++  WK+C+FGA SG   W M YP+D
Sbjct: 178 FTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPID 237

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           V+KS+MQ+D L SP +G ++  VAK++Y             P MLR+ P NGATFATFE+
Sbjct: 238 VVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEM 297

Query: 301 AMRLL 305
            MRLL
Sbjct: 298 TMRLL 302

>Kwal_56.23011
          Length = 303

 Score =  359 bits (922), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 209/305 (68%), Gaps = 3/305 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEE  +PQ++DDL +   HD  + +KD+  GT GG+AQVLVGQPFD TKVRLQTS  PT
Sbjct: 1   MSEELTSPQVVDDLVD--THDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPT 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA +VI+ L+KNEG   FYKGTL PL GVGACVS QFGVNEA+K++F  ++  +  Q L+
Sbjct: 59  TAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKD-GNFDQPLA 117

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           L QYY CG   G  N+FLA+PIEHVRIRLQ QT S    E+ G LDC RKL  QG  MRG
Sbjct: 118 LRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
            T T LR  HG G YFL YE ++AN+ + G  R  +PAWK+C++GA SG   W M YP D
Sbjct: 178 FTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFD 237

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           V+KSVMQ D LK+P YG +  +VAK +Y             PTMLR+ P NGATFA FE+
Sbjct: 238 VVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEI 297

Query: 301 AMRLL 305
            MRL+
Sbjct: 298 TMRLI 302

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  359 bits (921), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/305 (56%), Positives = 213/305 (69%), Gaps = 3/305 (0%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E  TPQ++DDL + P+   A  IKD+++GT+GGIAQVLVGQPFD TKVR+QTSS   
Sbjct: 1   MSDELTTPQVVDDLSDAPEFRKA--IKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSP 58

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA+EVI+ L+KNEG   FYKGTL PLIGVGACVS QFGVNEAMKR+F   N     Q LS
Sbjct: 59  TAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVN-GYKDQHLS 117

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           L QYY CG   G  N+FLA+PIEHVRIRLQ QT +    E++G LDC++KL  Q   MRG
Sbjct: 118 LLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240
            T T++R  HG G YFL YEA++ N+   G  R ++P WK+C+FGA SG   W M YP D
Sbjct: 178 FTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFD 237

Query: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           V+KS+MQ D L SP +G ++  VAK+++             PTMLR+ P NGATFATFE+
Sbjct: 238 VVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEV 297

Query: 301 AMRLL 305
            MRLL
Sbjct: 298 TMRLL 302

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  334 bits (857), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 203/308 (65%), Gaps = 5/308 (1%)

Query: 1   MSEEF-PTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           MS+E   TPQ+++DL +   H   + +KD+ +GT GG+AQVLVGQPFD  KVRLQT    
Sbjct: 1   MSDELLITPQVVEDLTD--LHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGN 58

Query: 60  TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH--SRNPDSTSQ 117
            TA E I  L+K EG  GFYKGT+ PL+GVGACVS QFG+NEAMKR+F   +R+      
Sbjct: 59  ATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDN 118

Query: 118 ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF 177
            LSL QYY CG   G  N+ LA+PIEHVRIRLQ Q  +  N E+K  LDC  KL  QG  
Sbjct: 119 TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSL 178

Query: 178 MRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY 237
           MRG T T++R  HG G YFL YE ++A+++  GF+R ++ AWK C+FGALSG   W M Y
Sbjct: 179 MRGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTY 238

Query: 238 PLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           P DV+KSVMQ D L +P YG ++  VAK +Y             PTMLR+ P NGATFA 
Sbjct: 239 PFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAA 298

Query: 298 FELAMRLL 305
           FE+ M++L
Sbjct: 299 FEVTMQML 306

>Scas_697.47
          Length = 328

 Score =  122 bits (307), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 136/302 (45%), Gaps = 37/302 (12%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKN-----------EG 74
           +K L+AG  GG+  VL G PFD  KVR Q+    +T +  I+ +LK+             
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASST-IHAIKIILKDARAIPTSNMLVNS 95

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGIT 134
            KGFYKG + PL+GV    ++ F   +  K+       DS+S  L++ Q    G    I 
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIV--TRSDSSSAQLTMGQMAAAGFISAIP 153

Query: 135 NSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGT 194
            + + +P E +++ LQT  G+     F G    I K        +G   T+ R+G G   
Sbjct: 154 TTLVTAPTERIKVVLQT-AGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSAL 212

Query: 195 YFLVYEAMVANEINKGF----------KRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
           YF  Y      EI+K F          K  EV    +CL G ++G ++W++V+P+D IK+
Sbjct: 213 YFASY------EISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKT 266

Query: 245 VMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXX-XXXPTMLRAAPANGATFATFELAMR 303
            +Q     S     S+ +  + +Y              P +LR+ PAN ATF   EL   
Sbjct: 267 KLQ-----SSSGSQSMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHS 321

Query: 304 LL 305
           L 
Sbjct: 322 LF 323

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  117 bits (293), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 132/308 (42%), Gaps = 28/308 (9%)

Query: 14  LENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV-------- 65
           ++++P  +N   IK  +AG  GG+  V  G PFD  KVR Q     +T   +        
Sbjct: 27  IKSNPVREN---IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAK 83

Query: 66  --IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ 123
             ++  L     KGFYKG + PL+GV    ++ F   +  K+     N    S  L++ Q
Sbjct: 84  TQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQ 143

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
               G    I  + + +P E V++ LQT +       F      I K        +G   
Sbjct: 144 MAAAGFISAIPTTLVTAPTERVKVVLQTSSKG----SFIQAAKTIVKEGGIASLFKGSLA 199

Query: 184 TMLREGHGCGTYFLVYEAMVANEINKGFKRTE------VPAWKLCLFGALSGTTLWMMVY 237
           T+ R+G G   YF  YE +  N +N    R +      V    +CL G ++G ++W+ V+
Sbjct: 200 TLARDGPGSALYFASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVF 258

Query: 238 PLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           P+D IK+ +Q  + +     N +S+  +                P +LR+ PAN ATF  
Sbjct: 259 PIDTIKTKLQASSTRQ----NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLG 314

Query: 298 FELAMRLL 305
            E+   L 
Sbjct: 315 VEMTHSLF 322

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 78/209 (37%), Gaps = 21/209 (10%)

Query: 109 SRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCI 168
           SR P  ++ +    + ++ G  GG+   F   P + +++R Q       N       + I
Sbjct: 23  SRPPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQA---NSTVHAITNII 79

Query: 169 RKLRAQ----------GGFMRGLTPTMLREGHGCGTYFLVYEA--MVANEINKGFKRTEV 216
           ++ + Q           GF +G+ P +L         F  Y+    +    NK     E+
Sbjct: 80  KEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNEL 139

Query: 217 PAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXX 276
              ++   G +S     ++  P + +K V+QT +        S    AKT+         
Sbjct: 140 TMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSS------KGSFIQAAKTIVKEGGIASL 193

Query: 277 XXXXXPTMLRAAPANGATFATFELAMRLL 305
                 T+ R  P +   FA++E++   L
Sbjct: 194 FKGSLATLARDGPGSALYFASYEISKNYL 222

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  115 bits (289), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 133/299 (44%), Gaps = 32/299 (10%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGP---- 75
           ++NA   K L AG  GG+  VL G PFD  KVR Q++    T ++ +RK+L         
Sbjct: 45  YENA---KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGT-VDAVRKILVEARAQSGL 100

Query: 76  ------KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
                 +GFYKG + PL+GV    ++ F   +  K+       +  S  L+  Q    G 
Sbjct: 101 SAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLV---TWNDNSGKLTTAQLATAGF 157

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTML 186
              I  + + +P E V++ LQTQ+               + + A GG     RG   T+ 
Sbjct: 158 ISAIPTTLVMAPTERVKVVLQTQSNHSLG-------SAAKHILATGGVRSLFRGSLATLA 210

Query: 187 REGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVM 246
           R+G G   YF  YEA  A  +N      E+    +CL G ++G ++W+ V+P+D IK+ +
Sbjct: 211 RDGPGSALYFASYEATKA-YLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTEL 269

Query: 247 QTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           Q+ N +       + +  K                P +LR+ PAN ATF   EL   L 
Sbjct: 270 QSSNTRQ----TMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLF 324

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  115 bits (287), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 140/302 (46%), Gaps = 35/302 (11%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLL----KNEGP------ 75
           +K L AG  GG+  VL G PFD  KVR Q S+   +AM+ +  +L    +  GP      
Sbjct: 29  LKSLAAGGVGGVCAVLTGHPFDLVKVRCQ-SNQARSAMDAVSHILQAARQAAGPTSLNAV 87

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS------RNPDSTSQILSLPQYYICGL 129
           +GFYKG + PL+GV    ++ F   +  K+   S          +    L+L Q    G 
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTML 186
              I  + + +P E V++ LQT  G          LD  +++ R QG     +G   T+ 
Sbjct: 148 ISAIPTTLVTAPTERVKVVLQTTQGKASF------LDAAKQIVRTQGFQSLFKGSLATLS 201

Query: 187 REGHGCGTYFLVYEAMVANEINK--GFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
           R+G G   YF  YE +    +NK  G    E+    +C+ G ++G ++W++V+P+D +K+
Sbjct: 202 RDGPGSALYFASYE-ICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKT 260

Query: 245 VMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXX-XXXPTMLRAAPANGATFATFELAMR 303
            +Q+ + +      S+  V + +Y              P +LR+ PAN ATF   EL   
Sbjct: 261 QLQSSSKR-----QSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVELTHS 315

Query: 304 LL 305
           L 
Sbjct: 316 LF 317

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  114 bits (286), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 146/320 (45%), Gaps = 42/320 (13%)

Query: 7   TPQLIDDLENHPKHDNARV-IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--AM 63
           TP   + LE+  K D  R  +K L+AG  GG+  VL G PFD  KVR Q++   +T  A+
Sbjct: 4   TPAETNILEH--KTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAV 61

Query: 64  EVIRK---------------LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
            +I K               L      KGFYKG + PLIGV    ++ F   +  KR   
Sbjct: 62  SIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVT 121

Query: 109 SRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP-LDC 167
            +   ++   L+  Q    G    I  + + +P E +++ LQT      N EFKG  +  
Sbjct: 122 WKQ--ASDAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQT------NSEFKGSFIKA 173

Query: 168 IRKLRAQGG---FMRGLTPTMLREGHGCGTYFLVYE---AMVANEINKGFKRTEVPAWKL 221
            + + + GG      G   T+ R+G G   YF  YE   A +   + K   + EV    +
Sbjct: 174 AKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKK-DKDEVNLANV 232

Query: 222 CLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXX-XX 280
           CL G ++G ++W++V+P+D IK+ +Q     +P    S+    K +Y             
Sbjct: 233 CLAGGIAGMSMWLVVFPIDTIKTRLQVAT--TPI---SMVQATKDIYIQRGGIKGFFPGL 287

Query: 281 XPTMLRAAPANGATFATFEL 300
            P +LR+ PAN ATF   EL
Sbjct: 288 GPALLRSFPANAATFLGVEL 307

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  111 bits (277), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 128/280 (45%), Gaps = 21/280 (7%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEG-PKGFYKGT 82
           KD+L G+  G    ++  PFDT KVRLQT      PTT    I+    NEG  +GFY+G 
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTT-WSCIKFTYDNEGLWRGFYQGI 66

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
            +PL G     ++ F      KR       D  S +  L +    G   G   SF+ +P+
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLL-----DVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYFLVY 199
           E ++ +LQ    S         L  I+ + ++ GF+   +G + T +RE  G   +F  Y
Sbjct: 122 ELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

Query: 200 EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259
           E +V N +    +  +   W+L   GA +G      ++P D IKS MQTD++        
Sbjct: 182 E-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI-------D 233

Query: 260 ISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           +SS  + +Y              T++RA PAN A F T+E
Sbjct: 234 LSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 72/185 (38%), Gaps = 20/185 (10%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVIRKLLKNEGPKGFYK 80
           K + AG   G     V  P +  K +LQ S+  TT       +  I+ +L   G  G ++
Sbjct: 102 KTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQ 161

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSR---NPDSTSQILSLPQYYICGLTGGITNSF 137
           G     I      +  F   E +K +  SR     ++T ++L+       G + G+  + 
Sbjct: 162 GQSGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLA------SGASAGLAFNA 215

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFL 197
              P + ++  +QT      +++       I   +   GF RGL  T++R        F 
Sbjct: 216 SIFPADTIKSTMQTD-----HIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFY 270

Query: 198 VYEAM 202
            YE +
Sbjct: 271 TYETL 275

>Kwal_23.2913
          Length = 320

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 141/312 (45%), Gaps = 39/312 (12%)

Query: 19  KHDNARVIKD----LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLL---- 70
           +  N+  ++D    L AG  GG+  VL G PFD  KVR Q++    T ++ I ++L    
Sbjct: 18  QASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGT-LDAISRVLHEAK 76

Query: 71  KNEGP------KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF-HSRNP-----DSTSQI 118
              GP      KGFY+G + PL+GV    ++ F   +  KR      NP      S+S++
Sbjct: 77  SKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKL 136

Query: 119 --LSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG 176
             L+  Q  + G    I  + + +P E V++ LQT        E    L   R L  +GG
Sbjct: 137 TPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTS-------ESGSFLGAARTLIREGG 189

Query: 177 ---FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLW 233
                +G   T+ R+G G   YF  YE +    +++      +    +C+ G ++G ++W
Sbjct: 190 VRSLFQGTLATLARDGPGSALYFASYE-VSKRFLSRNQDTDALSVVSICVAGGVAGMSMW 248

Query: 234 MMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
           + V+P+D IK+      L+S     S+   A+ +Y             P ++R+ PAN A
Sbjct: 249 IGVFPIDTIKT-----KLQSSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAA 303

Query: 294 TFATFELAMRLL 305
           TF   E   +L 
Sbjct: 304 TFLGVEFTHQLF 315

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%)

Query: 14  LENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNE 73
           L  +   D   V+   +AG   G++  +   P DT K +LQ+SS   + ++  R++    
Sbjct: 222 LSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQAAREIYTRA 281

Query: 74  GPKGFYKG 81
           G +GF+ G
Sbjct: 282 GLRGFFPG 289

>Kwal_33.15446
          Length = 305

 Score =  110 bits (274), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 131/291 (45%), Gaps = 26/291 (8%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVIRKLLKNEGPKGFYKGTLTP 85
            ++G   GIA+  VG PFDT KVRLQTS         ++ + + ++ +G +GFY G   P
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81

Query: 86  LIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHV 145
           L+G     S+  G      R    +      + L L    + G+  G + SF+A+P+E  
Sbjct: 82  LVGWILMDSVMLGCLHNY-RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELA 140

Query: 146 RIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGH---GCGTYFLVY 199
           + +LQ Q        ++GPLD I+K+ A  G     +GL  T++   H     G+Y L+ 
Sbjct: 141 KAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLT 199

Query: 200 EAMVANEINKGFKRTEVPAWKLCLFGALSGTT-LWMMVYPLDVIKSVMQTDNLKSPKYGN 258
               AN        T +  W     G  S +   W   YP DVIK V+    L + KY  
Sbjct: 200 RWFKANT---NLSDTAINFWA----GGFSASFGFWTTAYPSDVIKQVI----LCNDKYDG 248

Query: 259 SISS---VAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
           S+ S    A  ++             P+ LR+ PAN A  A+FE  +R+ G
Sbjct: 249 SLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRVSG 299

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 130/294 (44%), Gaps = 26/294 (8%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVIRKLLKNEGPKGFYKGT 82
           I   +AG   G+A+  VG PFDT KVRLQTS   T     ++ + K  +N+G +GFY G 
Sbjct: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
             PL+G     S+  G     +   H +      + L L    I G+  G + SF+A PI
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMH-KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGH---GCGTYF 196
           E  + +LQ Q        +KGPLD I+K+  AQG  G  +GL  T++   H     G+Y 
Sbjct: 143 ELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYE 201

Query: 197 LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTT-LWMMVYPLDVIKSVMQTDNLKSPK 255
           L+         N       +  W     G  S +   W   YP DV+K V+  ++    K
Sbjct: 202 LLTRWF---RENTKMSEAAINFWA----GGFSASFGFWTTAYPSDVVKQVVLCND----K 250

Query: 256 YGNSISS---VAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
           Y  S  S     K +Y             P+ LR+ PAN A  A FE  +R  G
Sbjct: 251 YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRTSG 304

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  103 bits (258), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 134/290 (46%), Gaps = 32/290 (11%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEG-PKGFYKG 81
           I D++ G+  G    ++  PFDT KVRLQT ++   PTT    I+   +NEG  +GF++G
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTT-WSCIKFTYQNEGIARGFFQG 72

Query: 82  TLTPLIGVGACV---SLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
             +PL  VGAC+   +L    N+       S+  +  + +  L Q  I G   G   S +
Sbjct: 73  IASPL--VGACLENATLFVSYNQC------SKFLEKHTNVFPLGQILISGGVAGSCASLV 124

Query: 139 ASPIEHVRIRLQT---QTGSGPNVEFKG--PLDCIRKLRAQGGFMRGLTPTMLREGHGCG 193
            +P+E V+ +LQ    Q  S      K    +  I   R   G  +G + T +RE  G  
Sbjct: 125 LTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGV 184

Query: 194 TYFLVYEAMVANEINKGF----KRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTD 249
            +F  YE +  +  ++      KR E   W+L + G  +G      ++P D +KSVMQT+
Sbjct: 185 AWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTE 244

Query: 250 NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           ++       S+++  K ++              T+ RA PAN A F  FE
Sbjct: 245 HI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGP 75
           + PK D +++ + L++G + G+A      P DT K  +QT     T    ++K+    G 
Sbjct: 204 DDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHISLT--NAVKKIFGKFGL 261

Query: 76  KGFYKG 81
           KGFY+G
Sbjct: 262 KGFYRG 267

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 22/200 (11%)

Query: 19  KHDNARVI-KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--------STPTTAMEVIRKL 69
           KH N   + + L++G   G    LV  P +  K +LQ +        +  T  +  I+ +
Sbjct: 100 KHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAI 159

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNP--DSTSQILSLPQYYIC 127
           +   G  G ++G     I         F   E +K+    R+   D       + +  I 
Sbjct: 160 ITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLIS 219

Query: 128 GLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ---GGFMRGLTPT 184
           G + G+  +    P + V+  +QT+  S  N         ++K+  +    GF RGL  T
Sbjct: 220 GGSAGLAFNASIFPADTVKSVMQTEHISLTNA--------VKKIFGKFGLKGFYRGLGIT 271

Query: 185 MLREGHGCGTYFLVYEAMVA 204
           + R        F ++E + A
Sbjct: 272 LFRAVPANAAVFYIFETLSA 291

>Kwal_55.21335
          Length = 317

 Score =  103 bits (256), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 125/288 (43%), Gaps = 25/288 (8%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT--TAMEVIRKLLKNEG-PKG 77
           D    +KD+L G+  G A  ++  P DT KVRLQT       T+   I+   + EG  KG
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKG 100

Query: 78  FYKGTLTPLIGVG---ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGIT 134
           FY+G  +PL+G     A + + F   +   + + S +P        L Q  + G   G  
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSP--------LSQTVLSGAFAGAC 152

Query: 135 NSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL---RAQGGFMRGLTPTMLREGHG 191
            S++ +P+E ++  LQ     G           ++ +   +  GG  +G + T +RE  G
Sbjct: 153 TSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAG 212

Query: 192 CGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
              +F  YE++  + + +    TE   W+L   GA +G      ++P D IKS  QT +L
Sbjct: 213 GAVWFTTYESL-KSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHL 271

Query: 252 KSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
                   I    K +               T++RAAPAN   F T+E
Sbjct: 272 -------GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 2/88 (2%)

Query: 218 AWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXX 277
           A K  L+G+++G    ++ YPLD IK  +QT    +  +  S S +  T           
Sbjct: 45  ALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQ--PAHVFPTSWSCIKYTYQKEGFVKGFY 102

Query: 278 XXXXPTMLRAAPANGATFATFELAMRLL 305
                 ++ AA  N   F TF  A   L
Sbjct: 103 QGVASPLVGAALENAVLFVTFNRAQNFL 130

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 98.6 bits (244), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 124/295 (42%), Gaps = 23/295 (7%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEG-PK 76
           D    +KD+  G+  G    ++  PFDT KVRLQT      PTT    IR    +EG  K
Sbjct: 3   DLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTT-WSCIRSTYTDEGIWK 61

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNS 136
           GFY+G  +PL G     ++ F        F      D  +Q+  L +    G   G   S
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFL-----DEFTQLKPLTKTIYSGAFAGACAS 116

Query: 137 FLASPIEHVRIRLQTQTGSGP------NVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
           F+ +P+E V+ +LQ    S        +      +  + K +   G  +G   T +RE  
Sbjct: 117 FILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECL 176

Query: 191 GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDN 250
           G   +F  YE M     +      E   W+L + GA +G      V+P D +KSV QT++
Sbjct: 177 GGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEH 236

Query: 251 LKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           +       SI +  K +               T++RAAPAN   F T+E   ++ 
Sbjct: 237 V-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPK 76
           HP        + L++G + G+       P DT K   QT     + +  ++K+L+  G  
Sbjct: 196 HPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV--SIVNALKKVLRTHGIT 253

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
           GFY+G    LI      +  F   E +K+ F
Sbjct: 254 GFYRGLGITLIRAAPANATVFYTYETLKKMF 284

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  102 bits (253), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 125/289 (43%), Gaps = 15/289 (5%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVIRKLLKNEGPKGFYKGT 82
           I +   G+  G    +V  P D  K R+Q     S    +++ + K+L  EG +G Y G 
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
              LIGV    +++  VN+ M+     R+       LSLP   I G T G       +P+
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRATLAGRDGK-----LSLPCEIISGATAGACQVVFTNPL 639

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLVYE 200
           E V+IRLQ ++    +   +  ++ I  ++  G  G  RG    +LR+      YF  Y 
Sbjct: 640 EIVKIRLQVKSDYVADAA-RNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYA 698

Query: 201 AMVANEIN----KGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKY 256
            + +N  N       KR ++  W+L + G L+G     +  P DVIK+ +Q D  K    
Sbjct: 699 HIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESV 758

Query: 257 GNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
            N I   A+T+                +LR++P  G T A +E+   L 
Sbjct: 759 YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 42/99 (42%), Gaps = 14/99 (14%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS-----STPTTAMEVIRKLLKNEGPKGFYKGTL 83
           L++G   G+    +  PFD  K RLQ       S      +  R +LK EG K F+KG  
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGP 783

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHS-----RNPDSTSQ 117
             ++      S QFG   A    FH+     R  DST+ 
Sbjct: 784 ARVLR----SSPQFGFTLAAYEIFHNLFPAPRYDDSTTH 818

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 98.2 bits (243), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 127/291 (43%), Gaps = 28/291 (9%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEG-P 75
            D  +  KDLL G   G    LV  PFDT KVRLQT S    PTT    +    K EG  
Sbjct: 3   EDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTT-WSCVSHTYKQEGLW 61

Query: 76  KGFYKGTLTPLIGV---GACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGG 132
           +GFY+G  +P+ G     A + + F   +A+    +S  P        L +    G   G
Sbjct: 62  RGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGP--------LEKVVFAGAIAG 113

Query: 133 ITNSFLASPIEHVRIRLQTQ--TG-SGPNVEFKGP-LDCIRKLRAQGGFMRGLTPTMLRE 188
              S++ +P+E V+ +LQ    TG SGP      P L  I K    GG  +G + T +RE
Sbjct: 114 ACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRE 173

Query: 189 GHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQT 248
             G   +F  YE +    + +    TE   W+L   GA +G      ++P D +KS MQT
Sbjct: 174 SAGGAVWFTAYEVL-KGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQT 232

Query: 249 DNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           ++L        +    +T+               T+LRA PAN   F  +E
Sbjct: 233 EHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 75/186 (40%), Gaps = 21/186 (11%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-----STP--TTAMEVIRKLLKNEGPKGFY 79
           K + AG   G     V  P +  K +LQ S     S P  T  +  +R ++K  G  G +
Sbjct: 104 KVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLW 163

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           +G     I   A  ++ F   E +K +   R   + + +  L          G   +F A
Sbjct: 164 QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWEL-----LASGAGAGAAFHA 218

Query: 140 S--PIEHVRIRLQTQ-TGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYF 196
           S  P + V+  +QT+  G GP V        + K     GF RG+  T+LR        F
Sbjct: 219 SIFPADTVKSTMQTEHLGLGPAVR------TVLKKHGPTGFYRGVGITLLRALPANAVIF 272

Query: 197 LVYEAM 202
            VYE++
Sbjct: 273 YVYESL 278

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 99.4 bits (246), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 89/310 (28%), Positives = 134/310 (43%), Gaps = 32/310 (10%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVIRKL 69
           D++  P  +    I   ++G   GIA+  VG PFDT KVRLQTS   T     ++ + K 
Sbjct: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
              +G +GFY G   PL+G     S+  G      R    +      + L L    I G+
Sbjct: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNY-RMLLKKYVYYNEEKLPLSGCIISGV 166

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTML 186
             G + SF+A+P+E  + +LQ Q       ++ GP+D I+K+ +     G  +GLT T++
Sbjct: 167 MAGWSVSFIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

Query: 187 REGHGCGTYFLVYEAMVANEINKGFKR------TEVPAWKLCLFGALSGTT-LWMMVYPL 239
              +       V+       + + FK       T +  W     G  S +   W   YP 
Sbjct: 226 FRTN------FVFWWGSYELLTRWFKEHTNMSDTAINFWS----GGFSASFGFWTTAYPS 275

Query: 240 DVIKSVMQTDNLKSPKYGNSISS---VAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFA 296
           DVIK V+    L + KY  +  S    AK ++             P+ LR+ PAN A  A
Sbjct: 276 DVIKQVV----LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALA 331

Query: 297 TFELAMRLLG 306
            FE  +R  G
Sbjct: 332 AFEFVLRTSG 341

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 127/306 (41%), Gaps = 38/306 (12%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVIRKLLKNEGPKGF 78
           +   +AG   G+A+  VG PFDT KVRLQTS   + A       ++ + K LKN+G +G 
Sbjct: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSF 137
           Y G   PL G     S   G     +   H    P+     L L    I G+  G T SF
Sbjct: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK--LPLSGCIISGVMAGWTVSF 127

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-----------GFMRGLTPTML 186
           +A+P+E  + +LQ Q       ++ GP+D ++K+  QG              +GL  T++
Sbjct: 128 IAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186

Query: 187 REGH---GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK 243
              +     G+Y L+ +    N           PA      G  +    W   YP DV+K
Sbjct: 187 FRSNFVFWWGSYELITQWFQKNT------NLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240

Query: 244 SVMQTDNLKSPKYGNSISS---VAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
            V+  ++    KY  S  S       +Y             P+ LR+ PAN A  A FE 
Sbjct: 241 QVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEF 296

Query: 301 AMRLLG 306
            +R  G
Sbjct: 297 VLRTSG 302

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 73/186 (39%), Gaps = 19/186 (10%)

Query: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-----MEVIRKLLK 71
           +P+HD   +   +++G   G     +  P +  K +LQ      T      ++V++K+ K
Sbjct: 103 YPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFK 162

Query: 72  N--------EGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ 123
                     G +  YKG ++ LI     V   +G  E + ++F      S   I     
Sbjct: 163 QGMATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAI----N 217

Query: 124 YYICGLTGGITNSFLASPIEHVR-IRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLT 182
           ++  GL+        A P + V+ + L      G    ++  +  I + R   GF +G  
Sbjct: 218 FWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFL 277

Query: 183 PTMLRE 188
           P+ LR 
Sbjct: 278 PSFLRS 283

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 135/307 (43%), Gaps = 20/307 (6%)

Query: 12  DDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT------SSTPTTAMEV 65
           D+  +  K  N  V  +L+AG   G+ + L   P DT KVR+Q        + P   +  
Sbjct: 46  DNHMSSKKSTNPAV--NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRT 103

Query: 66  IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYY 125
              +   EG   FYKG    +IG+   ++++F   E    F+ +   D  + ++S    +
Sbjct: 104 GANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTF 159

Query: 126 ICGLTGGITNSFL-ASPIEHVRIRLQTQ--TGSGPNVEFKGPLDC---IRKLRAQGGFMR 179
           + G+  G+T + L  +P+E V+IRLQ Q   G+    +++  +     I K    G   R
Sbjct: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219

Query: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPL 239
           G++ T  R+    G  F VY  ++   + +      +P+W+  L G +SG        PL
Sbjct: 220 GVSLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278

Query: 240 DVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATF 298
           D IK+ +Q D + ++      I+++ + L              P ++R AP    TF  +
Sbjct: 279 DTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

Query: 299 ELAMRLL 305
           E   R L
Sbjct: 339 EFVRRHL 345

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVI-- 66
           +L++ L+ +    N    +  L G   G        P DT K RLQ   +       +  
Sbjct: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300

Query: 67  ----RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
               R+L++ EG +  YKG    ++ V    ++ F V E ++R   
Sbjct: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346

>Scas_714.18
          Length = 305

 Score = 94.0 bits (232), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 131/308 (42%), Gaps = 43/308 (13%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEGP-KGFYKG 81
           ++++LAG+  G     +  PFDT KVRLQT      P+T    I+   +NEG  +GFY+G
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPST-WSCIKYTYENEGILEGFYQG 71

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASP 141
             +PLIG     ++ F        F ++    S   I+ +   +      G   SF+ +P
Sbjct: 72  IESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGF-----AGSCASFVLTP 126

Query: 142 IEHVRIRLQTQT------------------------GSGPNVEFKGPLDCIRKLRAQGGF 177
           +E ++ +LQ                           G G +      +  I K +   G 
Sbjct: 127 VELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGL 186

Query: 178 MRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY 237
            +G + T +RE  G   +F  YE M   +  +  K      W+L + GA +G      V+
Sbjct: 187 WQGQSSTFIRESIGSVVWFATYELM--KQTLRDPKSEVNTTWQLLISGATAGLAFNGSVF 244

Query: 238 PLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           P D +KS+MQT++L       ++    +++               T+LRA P+N A F T
Sbjct: 245 PADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYT 297

Query: 298 FELAMRLL 305
           +E   ++L
Sbjct: 298 YEKLSKIL 305

>Scas_632.9
          Length = 292

 Score = 93.2 bits (230), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 132/297 (44%), Gaps = 28/297 (9%)

Query: 16  NHP--KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLL 70
           +HP  K      + D++ G+  G    ++  PFDT KVRLQT  +   PTT    I+   
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTT-WSCIKYTY 64

Query: 71  KNEGP-KGFYKGTLTPLIGVG-ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICG 128
            NEG  +GF++G  +PL G      +L    N+         N    S IL      + G
Sbjct: 65  HNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL------LSG 118

Query: 129 LTGGITNSFLASPIEHVRIRLQT---QTGSGPNVEFKGPL-DCIRKLRAQG--GFMRGLT 182
              G   SF+ +P+E ++ +LQ    QT     ++    +   +  LR +G  G  +G +
Sbjct: 119 AFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQS 178

Query: 183 PTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVI 242
            T +RE  G   +F  YE M    +    K TE   W+L + GA +G      ++P D +
Sbjct: 179 STFIRESLGGVAWFATYEVM-KQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTV 237

Query: 243 KSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           KS+MQT+++        I++V K L               T++RA PAN   F  +E
Sbjct: 238 KSMMQTEHI------TLINAVKKVL-TTYGITGFYRGLGITLIRAVPANATVFYMYE 287

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 127/307 (41%), Gaps = 41/307 (13%)

Query: 23  ARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEG-PKGF 78
           A   +D+L G+  G    ++  PFDT KVRLQT      P T    I    KNEG  KGF
Sbjct: 11  AAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDT-WSCITYTYKNEGIIKGF 69

Query: 79  YKGTLTPLIGVG-ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSF 137
           ++G  +PL G      +L    N+  K   H  N    + IL      I G   G   SF
Sbjct: 70  FQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL------ISGAFAGSCASF 123

Query: 138 LASPIEHVRIRLQT-------------QTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPT 184
           + +P+E ++ +LQ               T +  +      +  + K R   G  +G + T
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGT 183

Query: 185 MLREGHGCGTYFLVYEAMVANEINKGFKRTEVPA-------WKLCLFGALSGTTLWMMVY 237
            +RE  G   +F  YE M   +  K     E P+       W+L   GA +G      ++
Sbjct: 184 FIRESFGGVAWFATYELM--KKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIF 241

Query: 238 PLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           P D +KS+MQT++L        + +  K ++              T++RA PAN   F  
Sbjct: 242 PADTVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYV 294

Query: 298 FELAMRL 304
           +E   +L
Sbjct: 295 YETLSKL 301

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 91.7 bits (226), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 125/292 (42%), Gaps = 28/292 (9%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVI---------RKLLKNEGPKGF 78
           +L+AG   G+ + L   P DT KVR+Q      +A+E I         R +   EG    
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYR--RSALEGIKPPGFIKTGRNIYTEEGLLAL 70

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           YKG    +IG+   ++++F   E    F+ S   D  +  +S    ++ G+  G T + L
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYE----FYRSALADKQTGSVSTGNTFLAGVGAGTTEAVL 126

Query: 139 -ASPIEHVRIRLQTQ-----TGSGPNVEFKGPLDC---IRKLRAQGGFMRGLTPTMLREG 189
             +P+E V+IRLQ Q     T + P   ++  L     I K    G   RG++ T  R+ 
Sbjct: 127 VVNPMEVVKIRLQAQHLHPETAASP--RYRNALQACYLIVKEEGIGALYRGVSLTAARQA 184

Query: 190 HGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTD 249
              G  F VY  +    + +  K   +P+W+    G +SG        PLD IK+ +Q D
Sbjct: 185 TNQGANFTVYSKL-KEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 243

Query: 250 NLKSPKYGNS-ISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
              +   G S I ++ K L              P ++R AP    TF  +E 
Sbjct: 244 KSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 6/107 (5%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTA 62
           +L + L+ H K D     +    G   G        P DT K RLQ   +       +  
Sbjct: 196 KLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRI 255

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
           + + ++L+K EG +  YKG    ++ V    ++ F V E ++    +
Sbjct: 256 VTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLET 302

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 93.2 bits (230), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 128/284 (45%), Gaps = 15/284 (5%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVIRKLLKNEGPKGFYKGT 82
           I +   G+  G     V  P D  K R+Q    S     +++ + K+ + +G +G Y G 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
              LIGV    +++  VN+ M+++F ++     S+ +   Q  + G T G       +P+
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMNK-----SRTIKWYQEILSGATAGACQVVFTNPL 619

Query: 143 EHVRIRLQTQTGS-GPNVEFK-GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
           E V+IRLQ ++   G N   + G +  IR+L  +G + +G    +LR+      YF  Y 
Sbjct: 620 EIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLY-KGAAACLLRDVPFSAIYFPTYA 678

Query: 201 AMVAN----EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKY 256
            +  +    + N   KR ++  W+L L G ++G     +  P DVIK+ +Q D  K    
Sbjct: 679 HLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETT 738

Query: 257 GNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
              +   A+T+                +LR++P  G T A FE+
Sbjct: 739 YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-----STPTTAMEVIR 67
           D  +  K +  +  + LLAG   G+    +  PFD  K RLQ       +T T  +   R
Sbjct: 688 DPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAAR 747

Query: 68  KLLKNEGPKGFYKG 81
            +LK E  K F+KG
Sbjct: 748 TILKEESIKSFFKG 761

>Scas_691.4
          Length = 334

 Score = 91.3 bits (225), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 131/318 (41%), Gaps = 32/318 (10%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS-----TPTTAMEVIRKL 69
           + +P    +  + +L+AG   G+ + L   P DT KVR+Q +       P   +   R +
Sbjct: 3   QKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNI 62

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
             +EG    YKG    +IG+   ++++F   E    F+ +   D  ++ ++    ++ G+
Sbjct: 63  YSHEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRNALTDKETRTITTGNTFLAGV 118

Query: 130 TGGITNSFL-ASPIEHVRIRLQTQ------------TGSGPNVEFKGP--------LDCI 168
             GIT + L  +P+E V+IRLQ Q            + +G       P           I
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 169 RKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALS 228
            K    G   RG++ T  R+    G  F VY + + + + K   R  +P+W+    G +S
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVY-SYLKDYLQKYHNRESLPSWETSCIGLIS 237

Query: 229 GTTLWMMVYPLDVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRA 287
           G        PLD IK+ +Q D ++ S      I  +   L              P ++R 
Sbjct: 238 GAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRV 297

Query: 288 APANGATFATFELAMRLL 305
           AP    TF  +E   + L
Sbjct: 298 APGQAVTFTVYEFVRKHL 315

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 45  PFDTTKVRLQ-----TSSTPTTAMEVI-RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFG 98
           P DT K RLQ     +S++    + +I  +L+K EG +  YKG    ++ V    ++ F 
Sbjct: 247 PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFT 306

Query: 99  VNEAMKRFFHSRN 111
           V E +++   + N
Sbjct: 307 VYEFVRKHLETLN 319

>Kwal_26.8669
          Length = 296

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 33/292 (11%)

Query: 31  AGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVIRKLLKNEGPKGFYKGTLT 84
           AG   GI+++LV  P D  K R+Q   +          ++ I++++  EG    YKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
           P++      + +F  N+  ++ +      +  +Q LS+    + G + G   +F+  P E
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI----LSGASAGCCEAFVVVPFE 130

Query: 144 HVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF-LVY 199
            V+IRLQ  + S     +KGP+D +RK+ AQ G +    GL  T+ R G     YF +++
Sbjct: 131 LVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185

Query: 200 E--AMVANEINKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---KS 253
           +  A++    +K  + R ++ A      G++ GT   +M  P DV+KS +Q   +    +
Sbjct: 186 QVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239

Query: 254 PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
            KY  S  S+  T+Y             P +LR  P  G     F   M   
Sbjct: 240 RKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 13/179 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPL 86
            +L+G + G  +  V  PF+  K+RLQ  SS+    ++V+RK++  EG    Y G  + L
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 87  IGVGACVSLQFGVNEAMKRFFHSRN--PDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144
              G   +  FG+       F  R   P++ S+        I G  GG   S +++P + 
Sbjct: 171 WRHGVWNAGYFGI------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224

Query: 145 VRIRLQ-TQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVY 199
           V+ R+Q T   +G   ++      I  +  + GF    +G  P +LR G G G   +V+
Sbjct: 225 VKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query: 121 LPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG-- 176
           LP +Y    G   GI+   +  P++ V+ R+Q Q   G   ++KG +DCI+++ A+ G  
Sbjct: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66

Query: 177 -FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKL-----CLFGALSGT 230
              +G++  +L E     T F        +E  K +KR E    KL      L GA +G 
Sbjct: 67  RLYKGISSPVLMEAPKRATKF-----ACNDEFQKIYKR-EFGVEKLTQSLSILSGASAGC 120

Query: 231 TLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
               +V P +++K  +Q     S  Y   I  V K +
Sbjct: 121 CEAFVVVPFELVKIRLQD---VSSSYKGPIDVVRKII 154

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-------TAMEVIRKL 69
             K  + +   DL+AG+ GG    L+  PFD  K R+Q ++           +   I  +
Sbjct: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252

Query: 70  LKNEGPKGFYKGTLTPLIGVG 90
            K EG +  YKG +  ++ +G
Sbjct: 253 YKEEGFRALYKGFVPKVLRLG 273

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 127/292 (43%), Gaps = 26/292 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQT--------SSTPTTAMEVIRKLLKNEGPKGFY 79
           +L+AG   G+ + L   P DT KVR+Q            P   ++  R + + EG    Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL- 138
           KG    +IG+   ++++F   E    F+ +   +  S I+S    ++ G+  GIT + L 
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYE----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 139 ASPIEHVRIRLQTQ--TGSGPNV--EFKGPLDC---IRKLRAQGGFMRGLTPTMLREGHG 191
            +P+E V+IRLQ Q  T S PN   ++   +     I K        RG++ T  R+   
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 192 CGTYFLVYEAMVANEINKGFKRTEV-PAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTD- 249
            G  F VY  +   E  + + + +V P+W+    G +SG        PLD IK+ +Q D 
Sbjct: 189 QGANFTVYSKL--KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDK 246

Query: 250 --NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
             +L+       I ++   L              P ++R AP    TF  +E
Sbjct: 247 SISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 8/109 (7%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT----TAME 64
           +L + L+N+ + D     +    G   G        P DT K RLQ   + +    + M+
Sbjct: 198 KLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMK 257

Query: 65  VI----RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
            I     +LLK EG +  YKG    ++ V    ++ F V E ++    +
Sbjct: 258 KIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLEN 306

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 138/297 (46%), Gaps = 40/297 (13%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTA------------MEVIRKLLKN 72
           I   ++G   GI+++ V  P D  K R Q   +TPT A            ++ ++K++K 
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 73  EGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTG 131
           EG    Y+G  +P++      + +F  N+  ++ F +  N + T+Q +S+      G + 
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA----AGASA 128

Query: 132 GITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTPTMLRE 188
           G+T + +  P E ++IR+Q    S     + GP+DC++K ++ +G  G  +G+  TM R 
Sbjct: 129 GMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183

Query: 189 GHGCGTYF-LVYEAMVANEI--NKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
               G YF ++Y+   +  +   KG K R ++ A      GA+ GT   M+  P DV+KS
Sbjct: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKS 237

Query: 245 VMQT-DNLKSP--KYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATF 298
            +Q+ D + S   KY   + S+   +Y             P + R AP        F
Sbjct: 238 RIQSVDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%), Gaps = 23/160 (14%)

Query: 113 DSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ------TQTGSGPNVE-FKGPL 165
           DS ++ L     +I G   GI+   +  P++ V+ R Q      T    G  VE + G +
Sbjct: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63

Query: 166 DCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLV---YEAMVAN--EINKGFKRTEVP 217
           DC++K+  + GF    RG++  ML E     T F     Y+ +  N    N+  ++  + 
Sbjct: 64  DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA 123

Query: 218 AWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYG 257
           A      GA +G T   ++ P ++IK  MQ  ++KS   G
Sbjct: 124 A------GASAGMTEAAVIVPFELIKIRMQ--DVKSSYLG 155

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLL-------KNEGPKGFYK 80
           DL+AG  GG    ++  PFD  K R+Q+    ++A++     L       + EG +  YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
           G +  +  +    SL   V   M  FF  
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 88.6 bits (218), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 137/309 (44%), Gaps = 38/309 (12%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVIRKLLKNEGPKG 77
           D + V K++++G   G    +   P D  KVRLQ   T+  P    +V+++++K+     
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 78  F----YKGTLTPLIGVGACVSLQFGV------------NEAMKRFFHSRNPDSTSQILSL 121
           F    Y+G    L+G      L FG+            N  +KRF ++ N D   ++ SL
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNND--KEMTSL 121

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFM 178
             Y +     G+  S L +PI  ++ R+ + T    +  ++  +D I+KL R +G  GF 
Sbjct: 122 -MYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFW 179

Query: 179 RGLTPTMLREGHGCGTYFLVYEAM-----VANEINKGFKRTEVPAWKLCLFGALSGTTLW 233
           RGL P++     G   YF VY+ +      A  ++K  K + +    +     +   T  
Sbjct: 180 RGLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVT-- 236

Query: 234 MMVYPLDVIKSVMQT---DNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPA 290
             VYPL ++KS +Q+     + +PK  + +  +  T+Y               ++RA P+
Sbjct: 237 -AVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPS 295

Query: 291 NGATFATFE 299
              TF  +E
Sbjct: 296 TCITFCVYE 304

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 90.5 bits (223), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 75/280 (26%), Positives = 116/280 (41%), Gaps = 15/280 (5%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVIRKLLKNEGPKGFYKGTLTPL 86
           L   AG I   +V  P D  K R+Q     S    +++   K+L  EG +G Y G    L
Sbjct: 549 LGSVAGCIGATIV-YPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQL 607

Query: 87  IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVR 146
           IGV    +++  VN+ M+     +N       L L    I G + G       +P+E V+
Sbjct: 608 IGVAPEKAIKLTVNDYMRNKLKDKNGK-----LGLLSEIISGASAGACQVIFTNPLEIVK 662

Query: 147 IRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLVYEAMVA 204
           IRLQ +            L  ++ ++  G  G  +G    +LR+      YF  Y  +  
Sbjct: 663 IRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKR 722

Query: 205 N----EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSI 260
           +    + N   KR+ +  W+L   GAL+G     +  P DVIK+ +Q D  K       I
Sbjct: 723 DLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGI 782

Query: 261 SSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
              A+T+                +LR++P  G T A +EL
Sbjct: 783 IHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 90/205 (43%), Gaps = 21/205 (10%)

Query: 12  DDLENHPKHDNARV--IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---------TSSTPT 60
           D + N  K  N ++  + ++++G + G  QV+   P +  K+RLQ           +   
Sbjct: 622 DYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKL 681

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           TA+++I++L    G  G YKG    L+      ++ F     +KR   + +P+  ++   
Sbjct: 682 TALQIIKRL----GLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSR 737

Query: 121 LPQYYI--CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG-- 175
           L  + +   G   G+  ++L +P + ++ RLQ     G  + +KG +   R  LR +   
Sbjct: 738 LNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI-YKGIIHAARTILREESFK 796

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYE 200
            F +G    +LR     G     YE
Sbjct: 797 SFFKGGAARVLRSSPQFGFTLAAYE 821

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 125/281 (44%), Gaps = 17/281 (6%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKNEGPKGFYKGTLTPL 86
           L   AG I   +V  P D  K R+Q   +      +++ + K++  EG KG Y G    L
Sbjct: 536 LGSIAGCIGATVV-YPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQL 594

Query: 87  IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVR 146
           IGV    +++  VN+ M+    +R  D   ++   P+  I G + G       +P+E V+
Sbjct: 595 IGVAPEKAIKLTVNDFMR----NRLTDKNGKLSLFPEI-ISGASAGACQVIFTNPLEIVK 649

Query: 147 IRLQTQTGS-GPNVE--FKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMV 203
           IRLQ Q+   G N++   +     ++KL  +G +  G+   ++R+      YF  Y  + 
Sbjct: 650 IRLQVQSDYVGENIQQANETATQIVKKLGLRGLY-NGVAACLMRDVPFSAIYFPTYAHLK 708

Query: 204 AN----EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259
            +    + N   KR  +  W+L   GA++G     +  P DVIK+ +Q D  K     N 
Sbjct: 709 KDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNG 768

Query: 260 ISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           I    +T+                +LR++P  G T A +EL
Sbjct: 769 IFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 19/187 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSS---------TPTTAMEVIRKLLKNEGPKGF 78
           ++++G + G  QV+   P +  K+RLQ  S            TA ++++KL    G +G 
Sbjct: 627 EIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GLRGL 682

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI--CGLTGGITNS 136
           Y G    L+      ++ F     +K+     +P+  ++   L  + +   G   G+  +
Sbjct: 683 YNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAA 742

Query: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIR---KLRAQGGFMRGLTPTMLREGHGCG 193
           FL +P + ++ RLQ     G   ++ G    IR   K  +   F +G    +LR     G
Sbjct: 743 FLTTPFDVIKTRLQIDPRKGE-TKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFG 801

Query: 194 TYFLVYE 200
                YE
Sbjct: 802 FTLAAYE 808

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 86.3 bits (212), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 125/300 (41%), Gaps = 36/300 (12%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP----------------TTAMEVIRKL 69
           I    AG   G++++LV  P D  K R+Q   T                 T  M+ + K+
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
           +K EG    YKG  +P++      +++F  N+  + F+    P    ++      Y  G 
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIY-SGA 130

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTML 186
           + G   +F+ +P E V+IRLQ       N +FK P++ ++    +GG +    GL  T+ 
Sbjct: 131 SAGAVEAFVVAPFELVKIRLQDV-----NSQFKTPIEVVKNSVVKGGVLSLFNGLEATIW 185

Query: 187 RE----GHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVI 242
           R         G  F + + + A + +    R ++ A      GA+ GT   ++  P DV+
Sbjct: 186 RHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIA------GAIGGTVGCLLNTPFDVV 239

Query: 243 KSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAM 302
           KS +Q  +    KY  S+ SV   +Y             P ++R AP  G     F   M
Sbjct: 240 KSRIQRSSGPLRKYNWSLPSVL-LVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVM 298

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP----TTAMEVIRKLLKNEG 74
           K    +   DL+AG  GG    L+  PFD  K R+Q SS P      ++  +  + + EG
Sbjct: 209 KTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREEG 268

Query: 75  PKGFYKG 81
            K  YKG
Sbjct: 269 FKALYKG 275

>Kwal_47.17321
          Length = 881

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 119/289 (41%), Gaps = 15/289 (5%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVIRKLLKNEGPKGFYKGT 82
           I + L G+  G        P D  K R+Q     S    +++   K+   EG +G Y G 
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGL 560

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
              L+GV    +++  VN+ +++     N       L+LP   I G   G       +P+
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYVRKLLMDEN-----NRLTLPLEIISGAAAGACQVIFTNPL 615

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLVYE 200
           E V+IRLQ ++    ++  K  L  +  +++ G  G  +GL   ++R+      YF  Y 
Sbjct: 616 EIVKIRLQVRSEYADSLP-KSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYA 674

Query: 201 AMVANEIN----KGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKY 256
            +  +  N       KR  +  W+L   G L+G     +  P DVIK+ +Q D  K    
Sbjct: 675 HLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETR 734

Query: 257 GNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
              I   A+T+                +LR++P  G T A +E+   + 
Sbjct: 735 YTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 84.7 bits (208), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 129/285 (45%), Gaps = 27/285 (9%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STP--TTAMEVIRKLLKNEGPKGFYKG 81
              AG   G++++LV  P D  K R+Q      + P  T  ++ ++K++  EG    YKG
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFF-HSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140
             +P++      + +F  N+  ++ +  +   +  SQ LS+    + G + G   +F+  
Sbjct: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFVVV 129

Query: 141 PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF- 196
           P E V+IRLQ  + S     +KGP+D +RK+ A+ G +    GL  T+ R     G YF 
Sbjct: 130 PFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184

Query: 197 LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---KS 253
           ++++A     +     +T+     L +  ++  +   M+  P DV+KS +Q   +     
Sbjct: 185 IIFQARAL--LPAAHNKTQCITNDL-ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241

Query: 254 PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATF 298
            KY  S+ S+  T+Y             P +LR  P  G     F
Sbjct: 242 RKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 15/184 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-MEVIRKLLKNEGPKGFYKGTLTPL 86
            +LAG + G  +  V  PF+  K+RLQ +S+     ++V+RK++  EG    Y G  + L
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172

Query: 87  IGVGACVSLQFGVNEAMKRFFHSRN--PDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144
                     FG+       F +R   P + ++   +    I    G      L++P + 
Sbjct: 173 WRHALWNGGYFGI------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226

Query: 145 VRIRLQTQTGSGPNV--EFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVY 199
           V+ R+Q  T   P V  ++   L  +  +  + GF    +G  P +LR G G G   +V+
Sbjct: 227 VKSRIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

Query: 200 EAMV 203
             ++
Sbjct: 286 TGVL 289

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 81/201 (40%), Gaps = 18/201 (8%)

Query: 114 STSQILSLPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL 171
           S+S   SLP  Y    G   G++   +  P++ V+ R+Q Q   G    + G +DC++K+
Sbjct: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61

Query: 172 RAQGGFMR---GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKR---TEVPAWKLCLF- 224
            A  G  R   G++  +L E     T F        +E  K +K+    E  +  L +  
Sbjct: 62  VAGEGVGRLYKGISSPILMEAPKRATKF-----ACNDEFQKLYKQAFGVEKLSQPLSMLA 116

Query: 225 GALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTM 284
           GA +G     +V P +++K  +Q     S  Y   +  V K +               T+
Sbjct: 117 GASAGCVEAFVVVPFELVKIRLQD---ASSSYKGPVDVVRKIV-AREGVLAMYNGLESTL 172

Query: 285 LRAAPANGATFATFELAMRLL 305
            R A  NG  F     A  LL
Sbjct: 173 WRHALWNGGYFGIIFQARALL 193

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 20  HDNARVI-KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRK---------- 68
           H+  + I  DL++ + G     ++  PFD  K R+Q ++       V+RK          
Sbjct: 197 HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG---VVRKYNWSLPSLLT 253

Query: 69  LLKNEGPKGFYKGTLTPLIGVG 90
           + + EG +  YKG +  ++ +G
Sbjct: 254 IYREEGFRALYKGFVPKVLRLG 275

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 126/295 (42%), Gaps = 25/295 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVIRKLLKNEGPKGFYK 80
           +L+AG   G+ + L   P DT KVR+Q       +       ++   ++ +NEG   FYK
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140
           G    +IG+   ++++F   E    F+ +   D  +  +S    +I G+  GIT + +  
Sbjct: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVV 128

Query: 141 PIEHV-RIRLQTQ----TGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGC 192
               V +IRLQ Q        P  ++K  +     +  + GF    RG++ T  R+    
Sbjct: 129 NPMEVVKIRLQAQHLNPVEGAP--KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186

Query: 193 GTYFLVYEAMVANEINKGFKRTE-VPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
           G  F VY  +   E  +G+   E +P+W+  L G +SG        PLD IK+ +Q D  
Sbjct: 187 GANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244

Query: 252 KSPKYG-NSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
                G   I+ + K L              P ++R AP    TF  +E   + L
Sbjct: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

>Kwal_47.18216
          Length = 333

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 130/319 (40%), Gaps = 46/319 (14%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME-------VIRKLLKNEGPKGFYK 80
           +L+AG   G+ + L   P DT KVR+Q  S      +         R +   EG    YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL-A 139
           G    +IG+   ++++F   E    FF +   D  + ++S    ++ G+  GIT + +  
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 140 SPIEHVRIRLQTQ-----------TGS--------------GPNV----EFKGPLDC--- 167
           +P+E V+IRLQ Q            GS                NV    +++  +     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 168 IRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGAL 227
           I K        RG++ T  R+    G  F VY  +  + + +  +   +P+W+  L G +
Sbjct: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247

Query: 228 SGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS-ISSVAKTLYXXXXXXXXXXXXXPTMLR 286
           SG        PLD IK+ +Q D   S   G S I ++ + L              P ++R
Sbjct: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307

Query: 287 AAPANGATFATFELAMRLL 305
            AP    TF  +EL  + L
Sbjct: 308 VAPGQAVTFTVYELIRKKL 326

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 127/328 (38%), Gaps = 56/328 (17%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------------------------------- 54
           + +L+AG   G+ + L   P DT KVR+Q                               
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 55  ---TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRN 111
               +  P   +   R +   EG    YKG    +IG+   ++++F   E    F+ +  
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLL 127

Query: 112 PDSTSQILSLPQYYICGLTGGITNSFL-ASPIEHVRIRLQTQTGSGPNVEFKGPL----- 165
            D  + ++S    +I G+  G+T + L  +P+E V+IRLQ Q    PN +   P      
Sbjct: 128 ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQH-LNPNHDLAKPKYTNAV 186

Query: 166 ---DCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTE-VPAWKL 221
                I K        RG++ T  R+    G  F VY  +   E  + +  TE +P+W+ 
Sbjct: 187 QAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKL--REFLQEYHGTETLPSWET 244

Query: 222 CLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS----ISSVAKTLYXXXXXXXXX 277
              G +SG        PLD IK+ +Q D   S K G S    I+ +   L          
Sbjct: 245 SCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFK-GESGWKRIAHIGTQLLKEEGFRALY 303

Query: 278 XXXXPTMLRAAPANGATFATFELAMRLL 305
               P ++R AP    TF  +E   R L
Sbjct: 304 KGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>Scas_640.25
          Length = 306

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 125/298 (41%), Gaps = 34/298 (11%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----------MEVIRKLLKNEGPKG 77
             +AG   GI++++V  P D  K R+Q   +   A          ++ + +++K EGP  
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR--NPDSTSQILSLPQYYICGLTGGITN 135
            YKG  +P++      +++F  N+   + + S       T QI  L      G + GIT 
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL-----SGASAGITE 130

Query: 136 SFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTMLREGHGC 192
           + +  P E V+IRLQ       N +FKGP++ ++ +  Q    G   G+  T+ R     
Sbjct: 131 ALVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185

Query: 193 GTYF-LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
             YF ++++      + K   + E     LC  G + GT   M   P DV+KS +Q+D  
Sbjct: 186 AGYFGVIFQVRELLPVAK--SKQEKTRNDLCA-GFVGGTFGVMFNTPFDVVKSRIQSDGN 242

Query: 252 K----SPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           +      KY  +  SV K +Y             P +LR  P        F   M + 
Sbjct: 243 EIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVIRKLL 70
           K    +   DL AG  GG   V+   PFD  K R+Q+                  + K+ 
Sbjct: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262

Query: 71  KNEGPKGFYKGTLTPLIGVG 90
             EG +  YKG +  ++ +G
Sbjct: 263 HEEGFRALYKGFVPKVLRLG 282

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 119/286 (41%), Gaps = 24/286 (8%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVIRKLLKNEGPKGFYKG 81
           L+G   G    +   P D  K RLQ     T          M  +  ++++EGP+G YKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNP--DSTSQILSLPQYYICGLTGGITNSFLA 139
            +  ++G      + F V E  K+FFH   P  D  +Q  +        +T G  ++ L 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCA-------AITAGAASTTLT 194

Query: 140 SPIEHVRIRLQTQTGSGPN-VEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTY 195
           +PI  V+ RL  Q+  G +   +KG  D  RKL  Q GF     GL P++L   H    +
Sbjct: 195 NPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VAIH 253

Query: 196 FLVYEAMVA--NEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
           F +YE +    +  ++      +   +L +  ++S      + YP +++++ MQ  +   
Sbjct: 254 FPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP 313

Query: 254 PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
                 +  + K  Y               ++R  PA+  T  +FE
Sbjct: 314 DSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 128/293 (43%), Gaps = 25/293 (8%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTS--STPTT--AMEVIRKLLKNEGPKGFY 79
           +   +AG   G++++LV  P D  K  ++LQ S  S P      + ++++   EGP   Y
Sbjct: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           KG  +P++      + +F  N+  ++ +        ++ L+ P   + G + GI  SF+ 
Sbjct: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDL---FGAEKLTQPLSILSGASAGICESFVV 126

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF 196
            P E V+IRLQ  +      +F  P+  ++ +  + G +    GL  TM R G     YF
Sbjct: 127 VPFELVKIRLQDVSS-----KFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181

Query: 197 -LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---K 252
            ++++  V   + K   ++E     L L G + GT   ++  P DV+KS +Q   +    
Sbjct: 182 GIIFQ--VRALLPKASTKSEQTRNDL-LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGV 238

Query: 253 SPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
             KY  S  ++A T+Y             P +LR  P  G     F   M   
Sbjct: 239 PRKYNWSWPALA-TIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFF 290

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTP------TTAMEVIRKLLKNEGPKGFYK 80
           DLLAGT GG    L+  PFD  K R+Q T+  P        +   +  + K EG K  YK
Sbjct: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
           G +  ++ +G    +   V   +  FF +
Sbjct: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRT 292

>Scas_662.12
          Length = 308

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 132/311 (42%), Gaps = 41/311 (13%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME------VIRKLLKN- 72
           H+   + K++++G + G    L+  P D  KVRLQ  +T TT         +I +L+ N 
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 73  -----EGP-----KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRN---PDSTSQIL 119
                +GP     K  Y+G    L+G     SL F +  + K +    N    ++T+  L
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFL 121

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG--- 176
           +       GL  GI+ + L +P+  ++ R+ + T       +K      + L  + G   
Sbjct: 122 T------SGLISGISTTLLTNPLWVIKTRIMS-TSRHHKDSYKSIRHGFKSLLTKEGPKA 174

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEAMVAN---EINKGFKRTEVPAWKLCLFGALSGTTLW 233
              GL P++L    G   YF++Y+ +  +    +NK  K       K+ L  +LS     
Sbjct: 175 IWMGLLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSV 233

Query: 234 MMVYPLDVIKSVMQ-----TDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAA 288
           M VYP  ++KS +Q     T+N+  P+      ++ + +Y               +LRA 
Sbjct: 234 MSVYPFQLLKSNLQTFRSVTNNI--PQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAI 291

Query: 289 PANGATFATFE 299
           P+   TF  +E
Sbjct: 292 PSTCITFCIYE 302

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 9/98 (9%)

Query: 16  NHPKHDNARV-IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVI 66
           N  K DNA   +K +L  +   +  V+   PF   K  LQT  + T  +         +I
Sbjct: 208 NKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLI 267

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           RK+ ++ G KG YKG    L+       + F + E  K
Sbjct: 268 RKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFK 305

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 123/292 (42%), Gaps = 21/292 (7%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVIRKLLKNEGPKGFYKGT 82
           I +   G+  G     V  P D  K R+Q     S    +++   K+   EG +G Y G 
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGL 578

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYY--ICGLTGGITNSFLAS 140
              LIGV    +++  VN+ M+     R  D  +   +L  Y+  + G   G       +
Sbjct: 579 GPQLIGVAPEKAIKLTVNDYMR----GRLMDKHA---NLKWYFEILSGACAGACQVVFTN 631

Query: 141 PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLV 198
           P+E V+IRLQ ++    +V  K  +  +  ++  G  G  +G+   ++R+      YF  
Sbjct: 632 PLEVVKIRLQVRSEYAGDV-LKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPT 690

Query: 199 YEAMVANEINK-----GFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
           Y A +  ++ K       +R ++  W+L + G L+G     +  P DVIK+ +Q D  K 
Sbjct: 691 Y-AHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKG 749

Query: 254 PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
                 I   A+T+                +LR++P  G T A +E+   + 
Sbjct: 750 ETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 81/195 (41%), Gaps = 18/195 (9%)

Query: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--------TPTTAMEVIRKLL 70
           KH N +   ++L+G   G  QV+   P +  K+RLQ  S        +  TA+ VI++L 
Sbjct: 606 KHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL- 664

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQY--YICG 128
              G KG YKG    L+      ++ F     +K+     +P    Q   L  +   + G
Sbjct: 665 ---GIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAG 721

Query: 129 LTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIR---KLRAQGGFMRGLTPTM 185
              G+  ++L +P + ++ RLQ     G    ++G     R   K  +   F +G +  +
Sbjct: 722 GLAGMPAAYLTTPFDVIKTRLQIDPRKGE-TRYEGIFHAARTILKEESFKSFFKGGSARV 780

Query: 186 LREGHGCGTYFLVYE 200
           LR     G     YE
Sbjct: 781 LRSSPQFGFTLAAYE 795

>Scas_602.8
          Length = 885

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 121/290 (41%), Gaps = 23/290 (7%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT---TAMEVIRKLLKNEGPKGFYKGTLTPL 86
           L   AG I   LV  P D  K R+Q   + T    +++ + K+   EG +G Y G    L
Sbjct: 504 LGSVAGCIGATLV-YPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQL 562

Query: 87  IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVR 146
           IGV    +++  VN+ M++    +  +     L L    + G T G       +P+E V+
Sbjct: 563 IGVAPEKAIKLTVNDFMRKSLVDKKGN-----LQLGAEVLSGATAGACQVVFTNPLEIVK 617

Query: 147 IRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLVYEAMVA 204
           IRLQ ++     +  K  L   + ++     G  +G+   +LR+      YF  Y  +  
Sbjct: 618 IRLQVKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKK 677

Query: 205 N----EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS- 259
           N    + N   KR  +  W+L   GAL+G     +  P DVIK+ +Q +    P  G + 
Sbjct: 678 NVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIE----PGVGETR 733

Query: 260 ---ISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
              I    +T+                ++R++P  G T A +EL   +  
Sbjct: 734 YTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFN 783

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 90/218 (41%), Gaps = 39/218 (17%)

Query: 4   EFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM 63
           +F    L+D      K  N ++  ++L+G   G  QV+   P +  K+RLQ  S  T AM
Sbjct: 577 DFMRKSLVD------KKGNLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAM 630

Query: 64  ---------EVIRKLLKNEGPKGFYKGTLTPLIGVGACV-------SLQFGVNEAMKRFF 107
                    ++I++L       G YK       GVGAC+       ++ F     +K+  
Sbjct: 631 IPKSQLTAFQIIKEL----KLIGLYK-------GVGACLLRDVPFSAIYFPTYAHLKKNV 679

Query: 108 HSRNPDSTSQILSLPQYYI--CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPL 165
              +P+   +   L  + +   G   G+  +FL +P + ++ RLQ + G G    + G L
Sbjct: 680 FQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGE-TRYTGIL 738

Query: 166 DCIR---KLRAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
             +R   K  +   F +G    ++R     G     YE
Sbjct: 739 HAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYE 776

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 123/296 (41%), Gaps = 28/296 (9%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME---------VIRKLLKNEGPKGFYK 80
           ++G   G+   +V  P D  K RLQ     T   E          +  ++++EG +G YK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140
           G +  ++G      + F V E     F   N  + S   S   +    +T G  ++ + +
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYE-----FCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTN 187

Query: 141 PIEHVRIRLQTQTGSGPN-VEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGTYF 196
           PI  V+ RL  QT  G N   ++G  D  +K+  Q G      GL P++L   H    +F
Sbjct: 188 PIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLH-VAIHF 246

Query: 197 LVYEAMVAN----EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252
            VYE +  +    + ++    +++   +L L  ++S     ++ YP +++++ +Q   LK
Sbjct: 247 PVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQ---LK 303

Query: 253 S--PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
           S  P +   +  + K  Y               + R  PA+  T  +FE     L 
Sbjct: 304 SDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLN 359

>Scas_379.2
          Length = 301

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 120/312 (38%), Gaps = 23/312 (7%)

Query: 2   SEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT 61
           + E  T + ID  E  P  D+A +   LLAG   GI +  V  P D  K R+Q++S  +T
Sbjct: 3   TSEISTAEEID-YEALP--DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKST 59

Query: 62  A--MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
           +  +  + K+   EG    +KG  + ++G G   ++ F   E  K++        T Q L
Sbjct: 60  SNMLSQMAKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPL 119

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMR 179
                 + G    I    L +P + ++ R+Q  T    N         I K      F  
Sbjct: 120 KTA---LSGTVATIAADALMNPFDTLKQRMQLNT----NTTVWNVTKQIYKNEGFSAFYY 172

Query: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRT-EVPAWKLCLFGALSGTTLWMMVYP 238
               T+          F++YE+       K F  T +      CL G LSG T   +  P
Sbjct: 173 SYPTTLAMNIPFAAFNFMIYESAT-----KFFNPTNDYNPLVHCLSGGLSGATCAAITTP 227

Query: 239 LDVIKSVMQTD-----NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
           LD IK+V+Q       +L+  K  N+     K +Y             P +    PA   
Sbjct: 228 LDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAI 287

Query: 294 TFATFELAMRLL 305
            +  +E A   L
Sbjct: 288 AWTAYECAKHFL 299

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 125/300 (41%), Gaps = 32/300 (10%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVIRKLLKNEGPKG 77
           I   ++G A G++++LV  P D  K R+Q      T         ++ + +++K EG   
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS-RNPDSTSQILSLPQYYICGLTGGITNS 136
            YKG  +P++      + +F  N++ ++ F      D  +Q +S+    + G   G+T +
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI----LSGSLAGVTEA 124

Query: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCG 193
            +  P E V+IRLQ       N +F GP++ + K   + G +    GL  TM R     G
Sbjct: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179

Query: 194 TYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP-LDVIKSVMQT---- 248
            YF V   + A  + K    TE     L + G + G   +   +  L V+KS +Q+    
Sbjct: 180 GYFGVIFQIRA-LLPKAKTNTEKTTNDL-IAGTIGGYCRYSTEHTILSVVKSRIQSGATT 237

Query: 249 ---DNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
              D    PKY  +  S+ K +Y             P +LR  P  G     F   M   
Sbjct: 238 TLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 41/110 (37%), Gaps = 12/110 (10%)

Query: 11  IDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQP-FDTTKVRLQTSSTPTTAMEVIR-- 67
           I  L    K +  +   DL+AGT GG  +           K R+Q+ +T T A   +   
Sbjct: 188 IRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPK 247

Query: 68  ---------KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
                    K+   EG    YKG +  ++ +G    +   V   M  FF 
Sbjct: 248 YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQ 297

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 128/291 (43%), Gaps = 33/291 (11%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+E     +  + +++  K D+   I  L  G AG +++ +V  PF+  K+ LQ  S+ T
Sbjct: 1   MAEVLTVLEQPNSIKDFLKQDSN--IAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTT 57

Query: 61  T----AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAM-KRFFHSRNPDST 115
           +        IR++   EG KG ++G     I +    ++QF V EA  K+ FH    +  
Sbjct: 58  SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ 117

Query: 116 SQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFKGPLDCIRK---- 170
            Q+ +  + +   L GG   S +A+ P++ ++ RL  QT +  ++  +     I K    
Sbjct: 118 EQLTNTQRLFSGALCGGC--SVVATYPLDLIKTRLSIQTANLSSLN-RSKAKSISKPPGI 174

Query: 171 -------LRAQG---GFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWK 220
                   R +G   G  RG+ PT L         F VYE +    +N    +   P+WK
Sbjct: 175 WQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ---PSWK 231

Query: 221 LCLF----GALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
             L+    GA+SG     + YP D+++   Q   +   + G   +SV   L
Sbjct: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL 282

>Scas_709.9
          Length = 365

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 116/287 (40%), Gaps = 23/287 (8%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLL-------KNEGPKGFYKGT 82
           L+G   G    ++  P D TK RLQ     +      R +L        +EG +G YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           +  ++G      + F V E  K  +    P+S         +    +T G  ++ L +PI
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNS-----DFISHSCSAITAGAASTVLTNPI 183

Query: 143 EHVRIRLQTQTGSGPN-VEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGTYFLV 198
             V+ RL  QT  G +   ++G +D  +K+  Q G      GL P+M    H    +F V
Sbjct: 184 WVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAIHFPV 242

Query: 199 YEAMV----ANEINKGFKRTE--VPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252
           YE +      + I  G    E  +   +L +  + S     ++ YP +++++ MQ  + K
Sbjct: 243 YEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDK 302

Query: 253 SPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
                + +  + K  Y               +LR  PA+  T  +FE
Sbjct: 303 LLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

>Scas_589.10
          Length = 316

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 121/300 (40%), Gaps = 42/300 (14%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---------TSSTP-------TTAMEVIRKL 69
           I   ++G   G+++ ++  P D  K R Q         TSS         ++ +  + K+
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEA----MKRFFHSRNPDSTSQILSLPQYY 125
           LK EG K  YKG   PL+      +++F  NE     M + F  +   ST  +L+     
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLA----- 128

Query: 126 ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLT 182
             G   GIT S +  P E V+IRLQ         +++ P+ C R  +  QG  G   G  
Sbjct: 129 --GTFAGITESLIVVPFELVKIRLQDAQS-----DYRSPIRCTRTIIENQGLFGIYAGFE 181

Query: 183 PTMLREGHGCGTYF-LVYEAMVANEINKGFKRTEVPAWK-LCLFGALSGTTLWMMVYPLD 240
            T+ R      +YF L+++  V   I +    T+    +   L GA++G     +  P D
Sbjct: 182 STIWRNTIWNASYFGLIFQ--VKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFD 239

Query: 241 VIKSVMQTDNLKSPK--YGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATF 298
           V+K+ MQ     S    YG +  SV   +Y             P + R  P  G     F
Sbjct: 240 VVKTRMQGSKKTSSGMCYGWAWQSVF-LIYRTEGIKGIYKGILPIICRYGPGGGLLLVVF 298

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 91/191 (47%), Gaps = 11/191 (5%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTAMEVIRKLLKNEGPKGFYKGTLTPLI 87
           LLAGT  GI + L+  PF+  K+RLQ + S   + +   R +++N+G  G Y G  + + 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 88  GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRI 147
                 +  FG+   +K+F       ST++   +   ++ G   G  + FL+ P + V+ 
Sbjct: 186 RNTIWNASYFGLIFQVKKFIP--RAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKT 243

Query: 148 RLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGTYFLVYEAMVA 204
           R+Q    +   + +      +  + R +G  G  +G+ P + R G G G   +V+     
Sbjct: 244 RMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVF----- 298

Query: 205 NEINKGFKRTE 215
           N +N+ F+ ++
Sbjct: 299 NGVNELFRMSD 309

>Scas_716.29
          Length = 316

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 114/252 (45%), Gaps = 21/252 (8%)

Query: 11  IDDLENHPKH----DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSSTPTT 61
           IDD +++  H    ++ +V + L+AG+  G+    V  P DT K+RLQ     T   P+ 
Sbjct: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63

Query: 62  AMEVIRKLLKNEGP-KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
            +++++ ++ NEG  + F+KG +      G  + + +G  +     F++     TS +  
Sbjct: 64  LLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
             Q  + G   G+T+SF++ P + +R R         +    G  + I  +    GF RG
Sbjct: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGFFRG 177

Query: 181 LTPTMLREGHGCGTYFLVYEA--MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP 238
            T +M          F  YE+  +  +E +K    T    +      ++SG T  M+ YP
Sbjct: 178 CTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSAS---SISGVTSKMVTYP 234

Query: 239 LDVIKSVMQTDN 250
           LD I+  +Q  N
Sbjct: 235 LDTIRRRIQVRN 246

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 124/322 (38%), Gaps = 36/322 (11%)

Query: 11  IDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS------------- 57
           I +++     D A +   L+AG   GI +  +  P D  K R+Q  S             
Sbjct: 6   IQEIDYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGG 65

Query: 58  --------TPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
                      T ++ I ++   EG    ++G  + ++G G   ++ F   E  K     
Sbjct: 66  AGAASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLID 125

Query: 110 RNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIR 169
               +T Q L      + G+   +    L +P + ++ RLQ Q+ S  +  ++   + I 
Sbjct: 126 AKDFNTHQPLKTA---VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-IY 181

Query: 170 KLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEV-PAWKLCLFGALS 228
           K      F      T+          F++YE+       K F  T     W  CL G ++
Sbjct: 182 KNEGPMAFFYSYPTTLAMNIPFAALNFVIYESS-----TKFFNPTNAYNPWIHCLCGGIA 236

Query: 229 GTTLWMMVYPLDVIKSVMQ-----TDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPT 283
           G T   +  PLD IK+V+Q     T +++S K  N+    A+ ++             P 
Sbjct: 237 GATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPR 296

Query: 284 MLRAAPANGATFATFELAMRLL 305
           ++   PA   ++ ++E A  LL
Sbjct: 297 VISNIPATAISWTSYEFAKHLL 318

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 90/209 (43%), Gaps = 25/209 (11%)

Query: 4   EFPTPQLID--DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTP 59
           EF   QLID  D   H      + +K  ++G A  +A   +  PFDT K RLQ  + S+ 
Sbjct: 117 EFCKEQLIDAKDFNTH------QPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSD 170

Query: 60  TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
           ++   +   + KNEGP  F+    T L       +L F + E+  +FF+  N  +     
Sbjct: 171 SSMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYN----- 225

Query: 120 SLPQYY-ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVE-------FKGPLDCIRKL 171
             P  + +CG   G T + + +P++ ++  LQ +     +VE       FK     I + 
Sbjct: 226 --PWIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQS 283

Query: 172 RAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
               GF RGL P ++         +  YE
Sbjct: 284 YGWKGFWRGLQPRVISNIPATAISWTSYE 312

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 122/312 (39%), Gaps = 32/312 (10%)

Query: 8   PQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----M 63
           P  + D E  P H  A +   L+AG   GI +  V  P D  K R+Q+++  + +    +
Sbjct: 18  PMDLPDYEALPTH--APLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNML 75

Query: 64  EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ 123
             I  +  +EG    +KG  + ++G G   ++ FG  E  K+     +   T        
Sbjct: 76  SQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTA- 134

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
             I G      +  L +P + ++ R+Q  T +      K     I +      F      
Sbjct: 135 --ISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQ----IYQSEGLAAFYYSYPT 188

Query: 184 TMLREGHGCGTYFLVYEAMV-----ANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP 238
           T++         F++YE+       +NE N             CL G++SG+T   +  P
Sbjct: 189 TLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIH---------CLCGSISGSTCAAITTP 239

Query: 239 LDVIKSVM-----QTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
           LD IK+V+     QT +L+  +  ++ S  A  +Y             P ++   PA   
Sbjct: 240 LDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAI 299

Query: 294 TFATFELAMRLL 305
           ++  +E A   L
Sbjct: 300 SWTAYECAKHFL 311

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 125/286 (43%), Gaps = 29/286 (10%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           +++  P P  +  +    K+D+   +  L  G AG +++ +V  PF+  K+ LQ  ++ T
Sbjct: 4   LAQVLPQPSYVKSI---LKNDSN--VAFLAGGLAGAVSRTVV-SPFERVKILLQVQNSTT 57

Query: 61  TAME----VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDST 115
              +     +R++ + EG  G ++G     I +    ++QF V EA K+ FFH       
Sbjct: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR 117

Query: 116 SQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFK---------GPL 165
            Q+ +  + +   L GG   S LA+ P++ VR RL  QT +   +            G  
Sbjct: 118 EQLQNWQRLFSGALCGGC--SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVW 175

Query: 166 DCI-RKLRAQG---GFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKL 221
           D + R  + +G   G  RG+ PT L         F VYE      + +G   T    +KL
Sbjct: 176 DLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKL 234

Query: 222 CLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
            + GALSG     + YP D+++   Q   +   + G    SV   L
Sbjct: 235 SI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDAL 279

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 11/98 (11%)

Query: 21  DN--ARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------TTAMEVIRKLL 70
           DN  A   K  +   +GG+AQ  V  PFD  + R Q  +           + M+ +  + 
Sbjct: 225 DNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
           K EG +G+YKG    L  V    ++ + V E +    H
Sbjct: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 123/320 (38%), Gaps = 45/320 (14%)

Query: 8   PQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST--------- 58
           P+L  D E  P  +NA ++  L AG   GI +  +  P D  K R+Q  ST         
Sbjct: 4   PEL--DYEALP--ENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRL 59

Query: 59  PTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQI 118
           P+  +  I K+   EG    +KG  + ++G G   ++ F   E  K          T Q 
Sbjct: 60  PSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQP 119

Query: 119 LSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG-- 175
           L   +  + G    +    L +P + ++ RLQ                C +R  + +G  
Sbjct: 120 L---KTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMT-------KCAVRMYQREGIA 169

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYEAMV-----ANEINKGFKRTEVPAWKLCLFGALSGT 230
            F      T+          F++YE+       +N  N          W  CL G +SG 
Sbjct: 170 AFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNP---------WIHCLCGGISGA 220

Query: 231 TLWMMVYPLDVIKSVMQ---TDNLKSP--KYGNSISSVAKTLYXXXXXXXXXXXXXPTML 285
           T   +  PLD +K+V+Q    D+++S   K  ++    A  ++             P ++
Sbjct: 221 TCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRII 280

Query: 286 RAAPANGATFATFELAMRLL 305
              PA   ++ ++E A  LL
Sbjct: 281 SNMPATAISWTSYEFAKHLL 300

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 103/254 (40%), Gaps = 13/254 (5%)

Query: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGF 78
           K +       L+AG+  G+       P DT K++LQ +     A  V+  +LK EG +GF
Sbjct: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGF 67

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYIC--GLTGGITNS 136
           +KG +   I        QFG    +  F       + S     PQ Y C  G   G+T+S
Sbjct: 68  WKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNIS-----PQLYSCLVGSLAGMTSS 122

Query: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYF 196
             + P + +R R    +  G  ++ +  +  I       GF  G   +M+  G      F
Sbjct: 123 LASYPFDVLRTRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181

Query: 197 LVYEA--MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP 254
            VYE+  +   E +K   R +       L G +SG T  +  +PLD ++  +Q  N  SP
Sbjct: 182 GVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN--SP 239

Query: 255 KYGNSISSVAKTLY 268
                     K +Y
Sbjct: 240 NEERHDREFTKDIY 253

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 9/142 (6%)

Query: 103 MKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162
           M +  H R  +  S   SL    + G   G+      +P++ V+I+LQ      P+ +  
Sbjct: 1   MNKKDHLRKDEEVSTTNSL----VAGSLSGLFARTCIAPLDTVKIKLQVT----PHNKNA 52

Query: 163 GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLC 222
             L  I K     GF +G  P  +      G  F  Y   + + +  G      P    C
Sbjct: 53  NVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSY-TYIGSFLRGGLDLNISPQLYSC 111

Query: 223 LFGALSGTTLWMMVYPLDVIKS 244
           L G+L+G T  +  YP DV+++
Sbjct: 112 LVGSLAGMTSSLASYPFDVLRT 133

>Kwal_23.4731
          Length = 314

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 123/300 (41%), Gaps = 33/300 (11%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM---EVIRKLLKNEGP-----KGF 78
           ++++AG A G    +   P D  K+RLQ     T +    EVI+ ++++        +  
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHS------RNPDSTS----QILSLPQYYICG 128
           Y+G    LIG      L FG+    K   +       + P  +S    + +    Y    
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 129 LTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ---GGFMRGLTPTM 185
              G+  + L +PI  ++ R+ + T S  +  +K   D IRK+ A     GF RGL P++
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMS-TSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSL 193

Query: 186 LREGHGCGTYFLVYEAMVANEI-NKGFKRTEVPAWKLCLFGALSGTTLWMM-----VYPL 239
                G   YF +Y+++       +G    E    K+     ++ T++  M     VYP 
Sbjct: 194 FGVAQGA-IYFTIYDSLRHQYFARRGITEDE----KMGNLENIAITSVSKMLSVTAVYPF 248

Query: 240 DVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
            ++KS +Q+      +      ++ K+++               +LRA P+   TF  +E
Sbjct: 249 QLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 125/312 (40%), Gaps = 32/312 (10%)

Query: 11  IDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT----SST-----PTT 61
           + D E  P  D+A +   L+AG   GIA+  V  P D  K RLQ     S+T     P+T
Sbjct: 6   VIDYEALP--DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPST 63

Query: 62  AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSL 121
            +  +  +   EG    +KG  + L+G G   ++ F   E +K F       STS+    
Sbjct: 64  MLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFL-IDEATSTSKYHFF 122

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGL 181
              +  G T  I    L +P + ++ R+Q  T    N+      D  +++ ++ GF    
Sbjct: 123 KTAF-SGATATIAADALMNPFDVIKQRIQLNT----NISV---WDTAKRIYSKEGFQAFY 174

Query: 182 T--PTMLREGHGCGTYFLVYEAMVANEINKGFKRTEV-PAWKLCLFGALSGTTLWMMVYP 238
           +  PT L         F  +   + +   + F  + V   +  CL G +SG     +  P
Sbjct: 175 SSYPTTL----AINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLTTP 230

Query: 239 LDVIKSVMQTD-----NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
           LD IK+ +Q       +++  K  ++     + +Y             P +L   PA   
Sbjct: 231 LDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAI 290

Query: 294 TFATFELAMRLL 305
           ++  +E A   L
Sbjct: 291 SWTAYEFAKHFL 302

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 104/231 (45%), Gaps = 19/231 (8%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVIRKLLKNEGPKGFYKGTLTPLIGVG 90
           G A GI  V+   P D TKVRLQ +  P  T ++++R +LKNEG  G Y G    L+   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 91  ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ 150
              + +FG+ +A+K     R+  +    L L    + G  GG+  +F     + + IR+Q
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWYL-LGASMVSGALGGLAGNF----ADLINIRMQ 127

Query: 151 TQTG--SGPNVEFKGPLDCIRKL-RAQGG---FMRGLTPTMLREGHGCGTYFLVYEA--- 201
             +         +K  +D + K+ +A+G    F+ G  P M+R      +  + Y+    
Sbjct: 128 NDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKN 187

Query: 202 MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252
            +  + N   K+         L G ++ T    +  P DVIK+++   + K
Sbjct: 188 FLVTKYNMDPKKNSTHLTSSLLAGFVATT----VCSPADVIKTIVMNAHKK 234

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 82/206 (39%), Gaps = 45/206 (21%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV---------------------------RLQTSSTPTT 61
           L+AGT  GI + L   PF+  K                            ++ T STP  
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 62  AME----VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQ 117
            +E     ++ + +  GP  F +GT   +    A  S+QF    A KR   +RN  ++S 
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASS- 197

Query: 118 ILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG- 176
                   I GL    T   +  PI+ V+ R+ +Q       E+K  L+C+ ++  Q G 
Sbjct: 198 -------VITGLATSFTLVAMTQPIDVVKTRMMSQNA---KTEYKNTLNCMYRIFVQEGM 247

Query: 177 --FMRGLTPTMLREGHGCGTYFLVYE 200
             F +G     ++ G   G  F VYE
Sbjct: 248 ATFWKGSIFRFMKVGISGGLTFTVYE 273

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 76/209 (36%), Gaps = 36/209 (17%)

Query: 126 ICGLTGGITNSFLASPIEHVRIRL-------------------------QTQTGSGPNVE 160
           I G   GI  S    P E+++  L                         +  T S P   
Sbjct: 80  IAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVAR 139

Query: 161 FKGPLDCIRKL---RAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVP 217
            +  L  ++ +   R    F++G T T+ R+       F  Y A       +  K + V 
Sbjct: 140 IEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV- 198

Query: 218 AWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXX 277
                + G  +  TL  M  P+DV+K+ M + N K+ +Y N+++ + + ++         
Sbjct: 199 -----ITGLATSFTLVAMTQPIDVVKTRMMSQNAKT-EYKNTLNCMYR-IFVQEGMATFW 251

Query: 278 XXXXPTMLRAAPANGATFATFELAMRLLG 306
                  ++   + G TF  +E    LLG
Sbjct: 252 KGSIFRFMKVGISGGLTFTVYEQVSLLLG 280

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/327 (25%), Positives = 136/327 (41%), Gaps = 35/327 (10%)

Query: 1   MSEE-FPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           MSE   P  +  + L+N  K D    +  L  G AG I++ +V  PF+  K+ LQ  S+ 
Sbjct: 1   MSEVILPAIEEENQLKNFLKQDTN--VAFLAGGIAGAISRTVV-SPFERVKILLQVQSST 57

Query: 60  TTA----MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDS 114
           T       + I ++ K E  KG ++G     I V    ++QF V E  K+  FH      
Sbjct: 58  TAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGK 117

Query: 115 TSQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFKGPLDC-----I 168
             Q+ +  + +   L GG   S +A+ P++ VR RL  QT +   +      D      +
Sbjct: 118 GEQLNNWQRLFSGALCGGC--SVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV 175

Query: 169 RKLRA-----QGGFM---RGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEV 216
            KL +     +GG M   RG+ PT L         F VYE     M ++E      R  +
Sbjct: 176 WKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL 235

Query: 217 PAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYG---NSISSVAKTLYXXXXX 273
             +KL + GA+SG     + YP D+++   Q   +   + G   NS+     T+      
Sbjct: 236 --YKLSM-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292

Query: 274 XXXXXXXXPTMLRAAPANGATFATFEL 300
                     + +  P+   ++  +EL
Sbjct: 293 KGYYKGLTANLFKVVPSTAVSWLVYEL 319

>Kwal_55.20868
          Length = 380

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 121/304 (39%), Gaps = 33/304 (10%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAME----VIRKLLKNEGPKGF 78
           I  L    AG +A V V  P D  K RLQ     S P+   +     +  ++++EG +G 
Sbjct: 77  ITALSGAMAGFLAGVTVC-PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGL 135

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           YKG +  ++G      + F V E  K+ +    P           +    LT G  ++ L
Sbjct: 136 YKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPS-----FDFISHSASALTAGTVSTIL 190

Query: 139 ASPIEHVRIRLQTQTGSGPN-VEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
            +P+  V+ RL  QT    N   +    D   K+    G   F  GL P++L   H    
Sbjct: 191 TNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH-VAI 249

Query: 195 YFLVYEAM-VANEINKGFKRTE---VPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQ--- 247
           +F +YE + V         RTE   +   +L +  + S      + YP +++++ MQ   
Sbjct: 250 HFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKA 309

Query: 248 --TDNL----KSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELA 301
             TD L    K+ ++G  +  + K  Y               + R  PA+  T  +FE  
Sbjct: 310 YPTDPLAALQKTSRHG--LIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYF 367

Query: 302 MRLL 305
            + L
Sbjct: 368 RKYL 371

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 207 INKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
           +N+ F  TE+ A    + G L+G T    V PLDV K+ +Q   L S
Sbjct: 68  VNRSFDDTEITALSGAMAGFLAGVT----VCPLDVAKTRLQAQGLHS 110

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 16/79 (20%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM----------- 63
           E+H    N  + + ++A +A  +    +  P +  + R+Q  + PT  +           
Sbjct: 271 EDH----NLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGL 326

Query: 64  -EVIRKLLKNEGPKGFYKG 81
             +I+   K+EG +GFY G
Sbjct: 327 IRLIKHTYKSEGLRGFYSG 345

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 104/258 (40%), Gaps = 23/258 (8%)

Query: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------TTAMEVIRKLL 70
           K  N    K LLAG   G+    +  P DT K+RLQ   TP        +  MEV R ++
Sbjct: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMI 67

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130
           KNEG + F+KG +   +      S QF       R+      ++    L      + G  
Sbjct: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------VVGAF 121

Query: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
            GIT+S ++ P + +R RL        ++     +  I KL    GF +G   +M     
Sbjct: 122 AGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180

Query: 191 GCGTYFLVYEAMVANEINKGFKRTEV-PAWKLCLF----GALSGTTLWMMVYPLDVIKSV 245
                F  YE  +    ++  K T     W+L       G + G    ++ +PL+ I+  
Sbjct: 181 TASIMFGTYET-IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239

Query: 246 MQTDNLKSPKYGNSISSV 263
           MQ  N K  +  +  SSV
Sbjct: 240 MQFMNSKHLEKFSRHSSV 257

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 118/261 (45%), Gaps = 28/261 (10%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKLLKNEGPKGFYKGTLT 84
            +AG  GG     V  P +  K+ LQ  S+ T      +  ++++ K EG KG ++G   
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGI 79

Query: 85  PLIGVGACVSLQFGVNEAMK-RFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
             + +    ++Q+ V E  K R FH     S  + L   +  + G  GG  +  +  P++
Sbjct: 80  NCLRIFPYSAVQYAVYEFCKTRVFHV--GQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 144 HVRIRLQTQTGSGPNVEFK---------GPLDCIRKL-RAQGG---FMRGLTPTMLREGH 190
            VR RL  QT +   +            G ++ +R++ R +GG   + RG+ PT L    
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

Query: 191 GCGTYFLVYE---AMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQ 247
                F +YE   A++ ++ + G     V A KL + GA+SG     +VYP D+++   Q
Sbjct: 198 FVALNFALYERLKALIPHDYDAG----SVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQ 252

Query: 248 TDNLKSPKYGNSISSVAKTLY 268
              +   + G   +SVA  L+
Sbjct: 253 VLTMGQSELGFRYASVADALW 273

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 27/187 (14%)

Query: 41  LVGQPFDTTKVRLQTSST---------------PTTAMEVIRKLLKNEGP-KGFYKGTLT 84
           LV  P D  + RL   +                P   +E++R++ + EG  +G+Y+G   
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 85  PLIGVGACVSLQFGVNEAMKRFF-HSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
             +GV   V+L F + E +K    H  +  S    ++  +  I  ++GGI  + +  P +
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAGS----VAAAKLAIGAVSGGIAQT-VVYPFD 245

Query: 144 HVRIRLQTQTGSGPNVEFK-----GPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLV 198
            +R R Q  T     + F+       L  I +     G+ +GLT  +++        + V
Sbjct: 246 LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305

Query: 199 YEAMVAN 205
           YE +  N
Sbjct: 306 YELISEN 312

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVIRKLLKNEGPKGF 78
           K  +   +GGIAQ +V  PFD  + R Q  +   + +        + +  + + EG +G+
Sbjct: 226 KLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
           YKG    L+ V   +++Q+ V E +    H
Sbjct: 285 YKGLTANLVKVVPAMAVQWFVYELISENMH 314

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 131/298 (43%), Gaps = 35/298 (11%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVIRKLLKN-----EGPKGF 78
           K++++G   G    +V  P D  K+RLQ ++    P++    +++++K+     +  K  
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHS-------RNPDSTSQILSLPQYYICGLTG 131
           Y+G    +IG      L FG+    K   +S       +N     + ++   Y +     
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGAS 133

Query: 132 GITNSFLASPIEHVRIR-LQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLR 187
           G+  + L +P+  ++ R + T++  G    +   L+ I ++  + G   F RGL P++  
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQG----YTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 188 EGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMM-----VYPLDVI 242
              G   YF +Y+ +    ++    R ++   +L     +   +L  M     VYPL ++
Sbjct: 190 VTQGA-LYFAIYDTLKLKYLH---DRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 243 KSVMQTDNLKSPKYGNS-ISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           K+ +QT   ++    NS ++S+ ++++               ++RA P+   TF  +E
Sbjct: 246 KTNLQT--FRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 4/66 (6%)

Query: 45  PFDTTKVRLQTSSTP----TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVN 100
           P    K  LQT  T     +    +IR +    G  GFYKG    L+       + FGV 
Sbjct: 241 PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 101 EAMKRF 106
           E  K  
Sbjct: 301 EHFKHI 306

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 110/297 (37%), Gaps = 41/297 (13%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLK---NEGPKGFYKGTLT 84
            LLAG   GI +  V  P D  K R+Q+SS+      +I+++ K    EG    +KG  +
Sbjct: 19  QLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 85  PLIGVGACVSLQFGVNEAMK------RFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
            ++G G   ++ F   E  K      +  H+  P  T+         I G+        L
Sbjct: 79  VILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTA---------ISGMAATTVADAL 129

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLV 198
            +P + ++ R+Q  T        K     I        F      T++         F +
Sbjct: 130 MNPFDVIKQRMQLNTRESVWHVTKN----IYHKEGFAAFYYSYPTTLVMNIPFAAFNFAI 185

Query: 199 YEAMV-----ANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
           YE+       +NE N             C+ G LSG T   +  PLD IK+V+Q    ++
Sbjct: 186 YESATKFMNPSNEYNPFIH---------CISGGLSGATCAAITTPLDCIKTVLQVRGSET 236

Query: 254 P-----KYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
                 K  N+    A  +Y             P ++   PA   ++ ++E A   L
Sbjct: 237 VSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 85/213 (39%), Gaps = 31/213 (14%)

Query: 4   EFPTPQLID--DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT 61
           EF   +LID  D+  H      + IK  ++G A       +  PFD  K R+Q + T  +
Sbjct: 95  EFSKSKLIDPQDMHTH------QPIKTAISGMAATTVADALMNPFDVIKQRMQLN-TRES 147

Query: 62  AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSL 121
              V + +   EG   FY    T L+      +  F + E+  +F    NP +       
Sbjct: 148 VWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFM---NPSNEYNPFI- 203

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVE-------FKGPLDCIRKLRAQ 174
             + I G   G T + + +P++ ++  LQ +     + E       F+     I K+   
Sbjct: 204 --HCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGW 261

Query: 175 GGFMRGLTPTMLRE---------GHGCGTYFLV 198
            GF+RGL P ++            + C  +FLV
Sbjct: 262 KGFLRGLKPRVIANMPATAISWTSYECAKHFLV 294

>Kwal_26.7967
          Length = 297

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 122/295 (41%), Gaps = 22/295 (7%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKLLKNEGPKGFYKG 81
           +   LAG+  G  +  +  PF+  K RLQ     +TA    + +I +  K +G    Y G
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVG 69

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-S 140
               ++G  A   ++F   +A+K        D T+  LS P+  + GL  G+  S +A +
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIKNILR----DPTTGELSGPRGIVAGLGAGLLESVVAVT 125

Query: 141 PIEHVRIRL-QTQTGSGPNVEF--KGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGT 194
           P E ++  L   +  + P      +G L     L    GF    RG+ P  +R+      
Sbjct: 126 PFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAV 185

Query: 195 YFLVY---EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
               Y   + M+ +  N   K   + +    + GA SG        P+D +K+ MQ+  L
Sbjct: 186 RLGCYNKIKTMIQDYTNSA-KDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQS--L 242

Query: 252 KSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
            S KY ++I+  A T++             P + R   + G  F  +E  + +LG
Sbjct: 243 DSSKYSSTINCFA-TVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLG 296

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVIR 67
           +I D  N  K          + G   GI  V    P DT K R+Q+  SS  ++ +    
Sbjct: 196 MIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKYSSTINCFA 255

Query: 68  KLLKNEGPKGFYKGTLTPLIG 88
            + + EG K F+KG  TP +G
Sbjct: 256 TVFREEGLKTFWKGA-TPRLG 275

>Scas_582.7
          Length = 329

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 111/305 (36%), Gaps = 24/305 (7%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------TSSTPTTAMEVI 66
           D E  P H  A +   LLAG   GI +     P D  K R+Q      T  T T+ ++ I
Sbjct: 26  DYEALPAH--APLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQI 83

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
            K+   EG    +KG  + ++G G   ++ F   E  K       PDS  +     +  +
Sbjct: 84  SKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKAHL---IPDSQRETHQPIKVAV 140

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTML 186
            G T  + + F  +P + ++ R+Q        V        I  L     F      T+ 
Sbjct: 141 SGATATVASDFFMNPFDTIKQRMQISDLKKEKV--YNVAKKIYNLEGLSAFYYSYPTTIA 198

Query: 187 REGHGCGTYFLVYEAMVANEINKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSV 245
                    F++YE+      +K F           CL G +SG     +  PLD IK+V
Sbjct: 199 MNIPFAAFNFMIYESA-----SKFFNPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTV 253

Query: 246 MQTD-----NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           +Q       +L+  K  N+       +              P +L   PA   ++  +E 
Sbjct: 254 IQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYEC 313

Query: 301 AMRLL 305
           A   L
Sbjct: 314 AKHFL 318

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 43/103 (41%), Gaps = 11/103 (10%)

Query: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRK-------- 68
           +P H    +I  L  G +G IA   V  P D  K  +Q   +   ++EV++K        
Sbjct: 219 NPLHHYNPLIHCLCGGISGAIAAA-VTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKAT 277

Query: 69  --LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
             +L   G KGF++G    ++      ++ +   E  K F  S
Sbjct: 278 SAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFLFS 320

>Kwal_33.14050
          Length = 314

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 89/212 (41%), Gaps = 24/212 (11%)

Query: 10  LID--DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-EVI 66
           LID  D + H      + +K   +G A  +A  L+  PFDT K R+Q  +     M  V 
Sbjct: 109 LIDPQDFQTH------QPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVA 162

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
            ++ +NEG   F+    T +       +  F + E+  +FF   NP++T   L    + +
Sbjct: 163 SRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF---NPENTYNPLI---HCL 216

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVE--------FKGPLDCIRKLRAQGGFM 178
           CG   G T + + +P++ ++  LQ + GS   V+        F      I K+    GF 
Sbjct: 217 CGGISGATCAAITTPLDCIKTVLQVR-GSESVVDPLFRQADTFSRAASAISKVYGWSGFW 275

Query: 179 RGLTPTMLREGHGCGTYFLVYEAMVANEINKG 210
           RGL P ++         +  YE       N G
Sbjct: 276 RGLKPRIISNMPATAISWTAYECAKHTLFNYG 307

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 119/313 (38%), Gaps = 35/313 (11%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST-----------PTT 61
           D E+ P   NA +   L AG   GI +  +  P D  K R+Q  S            P+ 
Sbjct: 6   DYESLPT--NAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSN 63

Query: 62  AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSL 121
            ++ I ++   EG    +KG  + ++G G   ++ F   E  K +        T Q L  
Sbjct: 64  IVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKT 123

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GFMR 179
                 G+   +    L +P + ++ R+Q +T S   +         R  R +G   F  
Sbjct: 124 AA---SGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVAS----RIYRNEGLAAFFY 176

Query: 180 GLTPTMLREGHGCGTYFLVYEAMVANEINKGF--KRTEVPAWKLCLFGALSGTTLWMMVY 237
               T+          F +YE+       K F  + T  P    CL G +SG T   +  
Sbjct: 177 SYPTTIAMNIPFAAFNFAIYESA-----TKFFNPENTYNPLIH-CLCGGISGATCAAITT 230

Query: 238 PLDVIKSVMQ---TDNLKSP--KYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANG 292
           PLD IK+V+Q   ++++  P  +  ++ S  A  +              P ++   PA  
Sbjct: 231 PLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATA 290

Query: 293 ATFATFELAMRLL 305
            ++  +E A   L
Sbjct: 291 ISWTAYECAKHTL 303

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 115/303 (37%), Gaps = 24/303 (7%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STPTTAMEVIRK 68
           D E  P H  A +   LLAG   GI +  +  P D  K R+Q +    +  T  +  I K
Sbjct: 13  DYEALPSH--APLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISK 70

Query: 69  LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICG 128
           +   EG    +KG  + ++G G   ++ FG  E  K    S     T Q +      + G
Sbjct: 71  ISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTA---LSG 127

Query: 129 LTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLRE 188
               I    L +P + V+ RLQ  T    N+        I +      F      T+   
Sbjct: 128 TIATIAADALMNPFDTVKQRLQLDT----NLRVWNVTKQIYQNEGFAAFYYSYPTTLAMN 183

Query: 189 GHGCGTYFLVYEAMVANEINKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQ 247
                  F++YE+      +K F  +        CL G +SG T   +  PLD IK+V+Q
Sbjct: 184 IPFAAFNFMIYESA-----SKFFNPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQ 238

Query: 248 -----TDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAM 302
                T +++  K  N+    ++ +              P ++   PA   ++  +E A 
Sbjct: 239 VRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAK 298

Query: 303 RLL 305
             L
Sbjct: 299 HFL 301

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 129/298 (43%), Gaps = 31/298 (10%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS---TPTTAMEVIRKLL-KNEGP 75
           H+   + +++++G   G    +   P D  K+RLQ S+     TT   +IR +  + +  
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF--HSRNPDST---SQILSLPQYYICGLT 130
           +  Y+G    L+G     +L FG     K     H  N  +T    + L    Y +   +
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLR 187
            GI  + L +PI  ++ R+   + +GP   +K   D + KL    G   F RG+ P++L 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAGP---YKSTFDGVYKLYQTEGVLAFWRGVVPSLLG 179

Query: 188 EGHGCGTYFLVYEAM----VANEINKGFKRTEVPAW--KLCLFGALSGTTLWMMVYPLDV 241
              G   YF +Y+ +    + +  +K  +R  V       C+   +S T+    VYP  +
Sbjct: 180 VSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTS----VYPFQL 234

Query: 242 IKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           +KS +Q  +  +P   + I+ + +T+Y               +LRA PA   TF  +E
Sbjct: 235 LKSKLQ--DFGAP---SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           PF   K +LQ    P+   ++++ +   EG +GFY+G    L+       + F V E +K
Sbjct: 231 PFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>Kwal_14.2210
          Length = 315

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 107/254 (42%), Gaps = 25/254 (9%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKLLKNEGPKGFYKGTLTPLI 87
           G AG +++ +V  PF+  K+ LQ  S+           ++++   EG  G  +G     I
Sbjct: 25  GIAGAVSRTVV-SPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCI 83

Query: 88  GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS-PIEHVR 146
            +    ++QF V E  K+ +  +NPD+   +L+  +     L GG   S LA+ P++ VR
Sbjct: 84  RIFPYSAVQFLVYEFCKKQWFQQNPDTV--VLNWHRLVSGALCGGC--SVLATYPLDLVR 139

Query: 147 IRLQTQTGSGPNVEFK---------GPLDCIRKLRAQG----GFMRGLTPTMLREGHGCG 193
            RL  QT +   +            G  + +RK   Q     G  RG+ PT +       
Sbjct: 140 TRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVA 199

Query: 194 TYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
             F VYE +    I   F       +KL + GA+SG     + YP D+++   Q   +  
Sbjct: 200 LNFAVYEQL-REYIPASFDPASASLYKLSI-GAISGGVAQTITYPFDLLRRRFQVLAMGQ 257

Query: 254 PKYGNSISSVAKTL 267
            + G    SV   L
Sbjct: 258 SELGFHYKSVPDAL 271

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 22  NARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVIRKLLKNE 73
           +A + K  +   +GG+AQ +   PFD  + R Q  +   + +        + +  + + E
Sbjct: 220 SASLYKLSIGAISGGVAQTIT-YPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTE 278

Query: 74  GPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106
           G KG+YKG    L  V    ++ + V E ++ +
Sbjct: 279 GFKGYYKGLTANLFKVVPSTAVSWVVYETVRDY 311

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 116/297 (39%), Gaps = 30/297 (10%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME---------VIRKLLKNEGPKGFYK 80
           ++G   G    ++  PFD  K RLQ         +             + K+EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140
           G    ++G    + + F V +  +++     P   S  LS        +T G  ++   +
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPH--SPFLSNAS---SAITAGAISTVATN 157

Query: 141 PIEHVRIRLQTQTGSGP-NVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGTYF 196
           PI  V+ RL  QTG G  +  +KG +D  RK+  Q G      GL P +L   +     F
Sbjct: 158 PIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN-VAIQF 216

Query: 197 LVYEAMVANEINKGFKR-----TEVPA---WKLCLFGALSGTTLWMMVYPLDVIKSVMQT 248
            +YE +   +I  G+       T+V +    KL L   LS      + YP +++++ MQ 
Sbjct: 217 PLYENL---KIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL 273

Query: 249 DNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
            +         +  + K  Y               ++R  PA   T  +FE + + L
Sbjct: 274 KSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 97/234 (41%), Gaps = 21/234 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME----VIRKLLKNEGPKGFYKGTL 83
            ++AG+  G+   +   P DT K+R Q         +     +R ++K EG +  +KG +
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
                     ++QFG        + ++ P  + Q     Q    G   G+T+S ++ P++
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQ----GQTLTVGALAGMTSSVVSYPLD 136

Query: 144 HVRIRL-QTQTGSGPNVEFKGPLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTYFLVYE 200
            +R RL   +T    +V      +C +    +G  GF  G++  M          FL YE
Sbjct: 137 LLRTRLIANRTSHRTSV----AEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYE 192

Query: 201 A--MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252
              +V     K F    V A    + G +S T    MV+P+D ++  MQ  N K
Sbjct: 193 TVNIVCENHEKEFWSRPVSASSGIIAGFVSKT----MVFPIDTLRRRMQVMNSK 242

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 73/190 (38%), Gaps = 20/190 (10%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAMEVIRKLLKNEGPKGFYKGTLT 84
           + L  G   G+   +V  P D  + RL  + T   T+  E  R++  NEG +GF+ G  T
Sbjct: 116 QTLTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGIST 175

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144
            +  V    ++ F   E +     +   +  S+ +S       G+  G  +  +  PI+ 
Sbjct: 176 AMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSAS----SGIIAGFVSKTMVFPIDT 231

Query: 145 VRIRLQTQTGSG-------PNV----EFKGPLDCIRKLRAQGG---FMRGLTPTMLREGH 190
           +R R+Q             P V     +K     I K+  Q G     RGLT  + +   
Sbjct: 232 LRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVP 291

Query: 191 GCGTYFLVYE 200
                  VYE
Sbjct: 292 TTAISLFVYE 301

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 119/302 (39%), Gaps = 36/302 (11%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME-----VIRKLLKNEGPKG---- 77
           K++++G + G    LV  P D  KVRLQ S+T           VI++++++    G    
Sbjct: 11  KEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVT 70

Query: 78  --FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR--NPDST-------SQILSLPQYYI 126
              Y+G    L G      + FG+    K   +     P  T          ++   Y  
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLS 130

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTP 183
            G + G+  + L +PI  ++ R+ + T  G    +    + +++ LR  G  G  +GL P
Sbjct: 131 AGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVP 189

Query: 184 TMLREGHGCGTYFLVYEAMVANEINK------GFKRTEVPAWKLCLFGALSGTTLWMMVY 237
            +     G   YF VY+ +   ++ +          T +   ++   G +   TL   VY
Sbjct: 190 ALFGVSQGA-LYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL---VY 245

Query: 238 PLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           P  ++KS +Q+      K+   +  + K +                ++RA P+   TF  
Sbjct: 246 PFQLLKSNLQSFRANEQKF--RLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCV 303

Query: 298 FE 299
           +E
Sbjct: 304 YE 305

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL---RAQGG- 176
           L +  I GL+ G   + +  P++ +++RLQ    S     + GP   I+++    A  G 
Sbjct: 9   LQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEIIRSSANSGR 67

Query: 177 -----FMRGLTPTMLREGHGCGTYFLVY 199
                  RGL+  +       G YF +Y
Sbjct: 68  SVTNELYRGLSINLFGNAIAWGVYFGLY 95

>Scas_717.20
          Length = 356

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 124/327 (37%), Gaps = 57/327 (17%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVIRKLLKNEGPKGFYK 80
           L  G +G  A+ L+  P D  K+  QTS+   T          E  + +  N+G +GF++
Sbjct: 37  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQ 95

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           G    L+ +    +++F   E ++     S+  +S  + L      + G   G+ + F  
Sbjct: 96  GHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRL------MSGSLAGLCSVFTT 149

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK------LRAQG----------GFMRGLTP 183
            P++ +R+RL   T     +   G +  I K      L A+G           F RG TP
Sbjct: 150 YPLDLIRVRLAYVT-EHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 184 TMLREGHGCGTYFLVYEAM------------------VANEINKGFKRTEVP--AWKLCL 223
           T+L      G  F  ++ +                   + +  + FK   +P   W   L
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELL 268

Query: 224 FGALSGTTLWMMVYPLDVIKSVMQTDNLK-SPKYGN---SISSVAKTLYXXXXXXXXXXX 279
            G L+G       YP ++I+  +Q   L  S  Y +   SIS +AK +Y           
Sbjct: 269 SGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVG 328

Query: 280 XXPTMLRAAPANGATFATFELAMRLLG 306
                ++  P    +F  +E     LG
Sbjct: 329 LSIGYIKVTPMVACSFFVYERMKWHLG 355

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 15  ENHPKHDNA--RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------- 63
           E H KH     R   +LL+G   G+A      PF+  + RLQ S+   + M         
Sbjct: 251 ERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSIS 310

Query: 64  EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           E+ + + K  G +GF+ G     I V   V+  F V E MK
Sbjct: 311 EIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 123/314 (39%), Gaps = 38/314 (12%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------ 62
           QL+DD +          +   LAG   GI       P D  K RLQ     +        
Sbjct: 79  QLLDDTQ-------VTAVSGALAGFVSGIMVC----PLDVAKTRLQAQGAGSGERYYRGI 127

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           +  +  +L++EG  G YKG    ++G      L F V E  K+ + S  P          
Sbjct: 128 VGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPG------GFV 181

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTG-SGPNVEFKGPLDCIRKL-RAQG--GFM 178
            +    LT G  ++ L +PI  V+ RL  Q+  S  +  ++  LD  RK+ R++G   F 
Sbjct: 182 SHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFY 241

Query: 179 RGLTPTMLREGHGCGTYFLVYEAM-------VANEINKGFKRTEVPAWKLCLFGALSGTT 231
            GL P++    H    +F VYE +             +     ++   +L +   LS   
Sbjct: 242 SGLVPSLFGLFH-VAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVV 300

Query: 232 LWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPAN 291
             ++ YP +++++ MQ  +   P    S+ ++   +                ++R  PA+
Sbjct: 301 ASVITYPHEILRTRMQVRHSGVPP---SLLNLLGRIRASEGYVGFYSGFATNLVRTVPAS 357

Query: 292 GATFATFELAMRLL 305
             T  +FE   + L
Sbjct: 358 VITLVSFEYFRKYL 371

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 19/179 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGF 78
           +L +G A G   +L     D  + RL   S  +           ++V +K LK++G  G 
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           Y+G L  ++G+     L FG+ +++K    + + + +     L  + +   TG  T S+ 
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVT--TGASTCSY- 246

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ---GGFMRGLTPTMLREGHGCGT 194
             P++ VR R+     SG  V++ G  DC+RK+ A    G   +G    +LR   G G 
Sbjct: 247 --PLDTVRRRMMMT--SGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 92/211 (43%), Gaps = 11/211 (5%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           ++  ++    EG   F++G    +I      +L F   + +K  F  +  +  ++  +  
Sbjct: 71  LDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFA-G 129

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRK-LRAQG--G 176
                G  G ++  F+ S +++ R RL   + S   G   +F G +D  +K L++ G  G
Sbjct: 130 NLASGGAAGALSLLFVYS-LDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAG 188

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMV 236
             RG  P+++      G YF +Y+++    +    + + + ++   L G +  T      
Sbjct: 189 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASF---LLGWVVTTGASTCS 245

Query: 237 YPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
           YPLD ++  M   + ++ KY  +   + K +
Sbjct: 246 YPLDTVRRRMMMTSGQAVKYDGAFDCLRKIV 276

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 12/163 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVIRKLLKNEGPKGFYKGTLTPLIGVG 90
           G A GI   +V  P D  KVRLQ +  P  T   ++  +L NEG  G Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 91  ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ 150
              +++FG  + +K     R    T+    LP     G  GG+  +F     + V IR+Q
Sbjct: 80  TYTTVRFGAYDLLKENVIPRE-QLTNMAYLLPCSMFSGAIGGLAGNF----ADVVNIRMQ 134

Query: 151 TQTG--SGPNVEFKGPLDCIRKL-RAQGG---FMRGLTPTMLR 187
             +   +     +K  +D + K+ R +GG      G  P M+R
Sbjct: 135 NDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVR 177

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 1/86 (1%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS-TPTTAMEVIRKLLKNEGPKGFY 79
           D ++    L A    G+    V  P D  K R+   S     A++++   ++ EGP   +
Sbjct: 203 DASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMF 262

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKR 105
           +G L     +G    L F   E +K+
Sbjct: 263 RGWLPSFTRLGPFTMLIFFAIEQLKK 288

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 115/293 (39%), Gaps = 20/293 (6%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKLLKNEGPKGFYKG 81
           +   LAG+  G A+  +  PF+  K RLQ     + A    + +I K  K +G    Y G
Sbjct: 13  LHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVG 72

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-S 140
               +IG  A   ++F   + +K        DS +  LS  +  I GL  G+  S  A +
Sbjct: 73  CPAFIIGNTAKAGIRFLGFDTIKDMLR----DSETGELSGTRGVIAGLGAGLLESVAAVT 128

Query: 141 PIEHVRIRLQTQTGSGPNVEFKGPLDCIRK----LRAQG--GFMRGLTPTMLREGHGCGT 194
           P E ++  L     S            +R     +R +G  G  RG+ P  +R+      
Sbjct: 129 PFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAV 188

Query: 195 YFLVYEAM--VANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK 252
               Y  +  +  +     K   + +    L GA SG        PLD +K+ MQ+  L 
Sbjct: 189 RLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS--LD 246

Query: 253 SPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           S KY ++++  A T++             P + R   + G  F  +E  + +L
Sbjct: 247 STKYSSTMNCFA-TIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVML 298

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVIR 67
           LI D  + PK          L G   GI  V    P DT K R+Q+  S+  ++ M    
Sbjct: 199 LIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFA 258

Query: 68  KLLKNEGPKGFYKGTLTPLIG 88
            + K EG K F+KG  TP +G
Sbjct: 259 TIFKEEGLKTFWKGA-TPRLG 278

>Kwal_27.12081
          Length = 369

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 123/305 (40%), Gaps = 46/305 (15%)

Query: 41  LVGQPFDTTKVRLQTSSTPTTAME----------------------VIRKLLKNEGPKGF 78
           +V  PFD  K RLQ+    +T                         +I  L K EG +  
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           +KG    L+GV    S+ F      K+ + SR  ++  +   +  + I   T G   S  
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIY-SRAFNNGEEAPWI--HLISAATAGWATSTA 184

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTY 195
            +PI  ++ RLQ    +G   ++K   DC++ +  + GF    +GL+ + L    G    
Sbjct: 185 TNPIWLIKTRLQLDK-AGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI-LQ 242

Query: 196 FLVYEAMVA----------NEINKGFKRTEVPAWKLCLFGALSGTTLWM---MVYPLDVI 242
           +L+YE M              I++G K T     + C     +G   ++   + YP +V+
Sbjct: 243 WLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVV 302

Query: 243 KSVMQTDNLKSP--KYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFEL 300
           ++ ++   L++   KY   I S  + +              P +LR  P +   F T+EL
Sbjct: 303 RTRLRQAPLENDKLKYTGLIQSF-RVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWEL 361

Query: 301 AMRLL 305
            ++LL
Sbjct: 362 VIKLL 366

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 95/224 (42%), Gaps = 22/224 (9%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVIRKLLKNEGPKGFYKGTLTPLIGVG 90
           G  GGI   +   P D  KVRLQT+  P  T + +  ++L+NEG  G Y G    ++   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 91  ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ 150
              + +FGV + +K  +  +     S +  LP    C +  G     + +P + V IR+Q
Sbjct: 75  TYTTARFGVYDFVKERYIPKE-YLNSMLYLLP----CSMFSGAVGGLIGNPADVVNIRMQ 129

Query: 151 TQTGSGPNVE--FKGPLDCIRKLRAQGGFMR---GLTPTMLR----EGHGCGTYFLVYEA 201
             +     +   +K   D + K+ +  G  +   G  P ++R          TY +    
Sbjct: 130 NDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNY 189

Query: 202 MVANE-INKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
           +V N  ++K  K T   +    L   L  TT+     P DVIK+
Sbjct: 190 LVQNVGLDKDNKSTHFAS---SLLAGLVATTV---CSPADVIKT 227

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT--TAMEVIRKLL 70
           D +N   H  + ++  L+A T        V  P D  K R+  +   +  +A+ ++   +
Sbjct: 197 DKDNKSTHFASSLLAGLVATT--------VCSPADVIKTRVMNAHKHSHDSAVRILLDAV 248

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
           K EGP   ++G L   + +G    L F   E +++
Sbjct: 249 KQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 125/327 (38%), Gaps = 57/327 (17%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVIRKLLKNEGPKGFYK 80
           L  G +G  A+ L+  P D  K+  QTS+   +          E  + +  N+G +GF++
Sbjct: 23  LAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFH-SRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           G    L+ +    +++F   E ++     SR  +S  + L+       G   G+ + F+ 
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLA------SGSLAGLCSVFIT 135

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG----------------FMRGLTP 183
            P++  R+RL   T     V+ +  +  I    A  G                F RG  P
Sbjct: 136 YPLDLTRVRLAYVT-EHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVP 194

Query: 184 TMLREGHGCGTYF----LVYEAMVAN----------------EINKGFKRTEVPAWKLCL 223
           T+L      G  F    L+++ M ++                E  K  ++T +  W   +
Sbjct: 195 TVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELV 254

Query: 224 FGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGN----SISSVAKTLYXXXXXXXXXXX 279
            G LSG       YPL++I+  +Q   L   K  +    SISS+A+ +Y           
Sbjct: 255 AGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVG 314

Query: 280 XXPTMLRAAPANGATFATFELAMRLLG 306
                ++  P    +F  +E     LG
Sbjct: 315 LSIGYIKVTPMVACSFFVYERMKWHLG 341

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 9/90 (10%)

Query: 24  RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM---------EVIRKLLKNEG 74
           R   +L+AG   GI       P +  + RLQ S+     M          + R + + +G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
            +GF+ G     I V   V+  F V E MK
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>Kwal_0.232
          Length = 274

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 87/237 (36%), Gaps = 14/237 (5%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYK 80
           D +  I  LLAG A G +  L   P DT K RLQ +               N G  G Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG----------GFFANGGYLGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF---FHSRNPDSTSQILSLPQYYICGLTGGITNSF 137
           G  + ++      SL F   + MK +     +    S+ Q+     +      G I    
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFL 197
           +  P E ++ R QT          K  L        +    RG + T++RE       F 
Sbjct: 112 VRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFP 171

Query: 198 VYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP 254
           +YE +       G  R +V  W+    G ++G        PLDV+K+ +   +   P
Sbjct: 172 LYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP 227

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  S T    + + R++   EG K F+ G     + + A  
Sbjct: 201 AGGIAAATT-TPLDVLKTRLMLSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGG 259

Query: 94  SLQFGVNEAM 103
           ++  GV E +
Sbjct: 260 AIFLGVYETV 269

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 83/173 (47%), Gaps = 4/173 (2%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQT-SSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI 87
           L A  + G+   ++  P    K R+ + +++  T+M+V+R L+KN+G +G +KG +  L+
Sbjct: 114 LSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPALV 173

Query: 88  GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRI 147
           GV    +L F   + +K     +N DS  +I +L    +  ++  ++ S +  P + ++ 
Sbjct: 174 GVSQG-ALHFTCYDTLKHKLVLKNRDS-DEITNLETIAVTSVSKMLSTSAVY-PFQLLKS 230

Query: 148 RLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
            LQ+   S  + +       I       GF +GL+  +LR        F +YE
Sbjct: 231 NLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/279 (20%), Positives = 113/279 (40%), Gaps = 11/279 (3%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVIRKLLKNEGP--KGFYKG 81
           K++++G   G    L+  P D  KVRLQ   TS+T      +  +++ ++    +  Y+G
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPD-STSQILSLPQYYICGLTGGITNSFLAS 140
               L+G      L F      K +  + N      + LS   Y     + G+  + L +
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTN 129

Query: 141 PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
           P+  ++ R+ ++  S      K   D I+    Q G  +GL P ++    G   +F  Y+
Sbjct: 130 PLWVIKTRMMSKANSDL-TSMKVLRDLIKNDGVQ-GLWKGLVPALVGVSQG-ALHFTCYD 186

Query: 201 AMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSI 260
            +    + K     E+   +     ++S       VYP  ++KS +Q+   ++ +    +
Sbjct: 187 TLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS--FQASENDFKL 244

Query: 261 SSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
             ++K +Y               +LR+ P+   TF  +E
Sbjct: 245 LPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCI--RKLRAQGGFM 178
           L +  I GLT G   + +  P++  ++RLQ    S     ++     I    L       
Sbjct: 8   LQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELY 67

Query: 179 RGLTPTMLREGHGCGTYFLVYEAMVANEINKGFK---RTEVPAWKLCLFGALSGTTLWMM 235
           RGLT  ++      G YF  Y       IN   +     ++ +W      A SG    ++
Sbjct: 68  RGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVL 127

Query: 236 VYPLDVIKSVMQT 248
             PL VIK+ M +
Sbjct: 128 TNPLWVIKTRMMS 140

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 17/190 (8%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKN-EGPKGFY 79
           +  R    L+ G +GG+   ++ QPFD  K RLQ   T T     + K LK+ E P   +
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST-----LWKTLKSIETPSQLW 57

Query: 80  KGTLTPLI--GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQY--YICGLTGGITN 135
           +G L   I   VG+ + L   +N   +     +N  ST     LPQ   Y    +G +T 
Sbjct: 58  RGALPSCIRTSVGSAMYLTM-LNSIRQAISKGKNTGSTGSSY-LPQLNMYENMFSGAVTR 115

Query: 136 S---FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGC 192
           +    +  PI  +++R ++      ++ +      I +     GF RG   T LR+    
Sbjct: 116 ALTGLITMPITVIKVRYESTLYQYTSLRY--ATSHIFRTEGLRGFFRGFGATALRDAPYA 173

Query: 193 GTYFLVYEAM 202
           G Y L Y+ M
Sbjct: 174 GLYMLFYDRM 183

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 120/316 (37%), Gaps = 43/316 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSST------------PTTAMEVIRK---- 68
            +AG   G+       PFD  KV    R   SST            P   +  I+     
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 69  ----LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS-RNPDSTSQILSLPQ 123
               L +  G + FY G    ++ V    +++FG  E  KR      N   TS++  L  
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP---LDCIRKLRAQGG---F 177
           Y I G  GG+   F   PI+ ++ R+Q    +  N   K     L   +++  QGG   F
Sbjct: 323 Y-IAGGLGGVAAQFSVYPIDTLKYRIQC---APLNTNLKKSSILLQTAKEMYQQGGIRLF 378

Query: 178 MRGLTPTML----REGHGCGTYFLVYEAMVANEINK-GFKRTEVPAWKLCLF--GALSGT 230
            RG+   ++          GT+  + +  +  E  K G    EV    L +   GA SGT
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGT 438

Query: 231 TLWMMVYPLDVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAP 289
               +VYP++++++ +Q       P   N  S V K                P + +  P
Sbjct: 439 VGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCP 498

Query: 290 ANGATFATFELAMRLL 305
           A   ++  +E   RL+
Sbjct: 499 AVSISYLCYENLKRLM 514

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 22/207 (10%)

Query: 14  LENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT------AMEVIR 67
           LEN         +   +AG  GG+A      P DT K R+Q +   T        ++  +
Sbjct: 308 LENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAK 367

Query: 68  KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDST---------SQI 118
           ++ +  G + FY+G    ++G+    +L  G   A+K+++  +    T         S +
Sbjct: 368 EMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNL 427

Query: 119 LSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG-- 175
           + LP     G   G   + L  PI  +R RLQ Q        + G  D ++K ++ +G  
Sbjct: 428 IVLP----MGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQ 483

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYEAM 202
           G  +GL P + +        +L YE +
Sbjct: 484 GLFKGLVPNLAKVCPAVSISYLCYENL 510

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 120/295 (40%), Gaps = 24/295 (8%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVIRKLLKNEGPKGFYKGT 82
           K  +AG   G  +  V  PF+  K RLQ     S      + +I    K +G    Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-SP 141
              ++G  A   ++F   + +K     R+P +    LS P+  I GL  G+  S +A +P
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLL--RDPKTGE--LSGPRGVIAGLGAGLLESVVAVTP 126

Query: 142 IEHVRIRL----QTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGT 194
            E ++  L    Q+ T    N   KG L     L R QG  G  RG+ P  +R+      
Sbjct: 127 FEAIKTALIDDKQSATPKYHN-NGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAV 185

Query: 195 YFLVY---EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
               Y   + MV +  N   K   + +    + GA SG        P+D +K+ MQ+  L
Sbjct: 186 RLGCYNKIKVMVQDYTNAP-KDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQS--L 242

Query: 252 KSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
            S +Y ++I+    T++             P + R   + G  F  +E  + +LG
Sbjct: 243 DSKRYSSTINCFT-TIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVLG 296

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 86/206 (41%), Gaps = 17/206 (8%)

Query: 11  IDDLENHPKHDNARVIKDLLAGTAGGIAQVLVG-QPFDTTKVRL---QTSSTP---TTAM 63
           I +L   PK       + ++AG   G+ + +V   PF+  K  L   + S+TP       
Sbjct: 91  IKNLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGK 150

Query: 64  EVIRK---LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
            ++R    L++ +G  G Y+G L   +   A  +++ G    +K            + LS
Sbjct: 151 GMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLS 210

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---F 177
               ++ G   GI   +   PI+ V+ R+Q    S  +  +   ++C   +  + G   F
Sbjct: 211 SGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ----SLDSKRYSSTINCFTTIFKEEGLKAF 266

Query: 178 MRGLTPTMLREGHGCGTYFLVYEAMV 203
            +G TP + R     G  F VYE ++
Sbjct: 267 WKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVIR 67
           ++ D  N PK          + G   GI  V    P DT K R+Q+  S   ++ +    
Sbjct: 196 MVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSSTINCFT 255

Query: 68  KLLKNEGPKGFYKGTLTPLIG 88
            + K EG K F+KG  TP +G
Sbjct: 256 TIFKEEGLKAFWKGA-TPRLG 275

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 121/289 (41%), Gaps = 56/289 (19%)

Query: 25  VIKDLLAG-TAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEG 74
           ++K  LAG  AG  A+ LV  P D  K+  QTS+ P  A         +   + ++ ++G
Sbjct: 19  IVKSGLAGGIAGSCAKTLVA-PLDRIKILFQTSN-PQFAQFAGSMGGLVRASKYIMAHDG 76

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF--HSRNPDSTSQILSLPQYYICGLTGG 132
           P+GF++G    L+ +    +++F   E ++       R+     ++LS       G   G
Sbjct: 77  PRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLS-------GSLAG 129

Query: 133 ITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ---------------GGF 177
           + + F+  P++ VR+RL   T    + + +  + CI   R                   F
Sbjct: 130 LCSVFVTYPLDLVRVRLAYVT-ERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNF 188

Query: 178 MRGLTPTMLREGHGCGTYFLVYE--------------AMVANEINKGFKRTEVP--AWKL 221
            RG TPT++      G  F  ++              ++++   +  + RT VP   W  
Sbjct: 189 YRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRT-VPLKTWAQ 247

Query: 222 CLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP--KYGNSISSVAKTLY 268
            + G L+G       YP ++I+  +Q   +  P  ++   I+ +AK +Y
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIY 296

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 79/211 (37%), Gaps = 40/211 (18%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-MEVIRKLLKNEGP---------- 75
           + LL+G+  G+  V V  P D  +VRL   +    A +  I   + NE P          
Sbjct: 120 RRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIP 179

Query: 76  ------KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNP----------------D 113
                   FY+G    +IG+     + F  ++  +  F  R+P                D
Sbjct: 180 QWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIF--RHPMLEPYSVLSPGGSSAYD 237

Query: 114 STSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGP-NVEFKGPLDCIRKLR 172
            T  + +  Q    GL  G+ +   A P E +R RLQ    + P    F G  +  + + 
Sbjct: 238 RTVPLKTWAQLVAGGL-AGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIY 296

Query: 173 AQG---GFMRGLTPTMLREGHGCGTYFLVYE 200
            +G   GF  GL+   ++        F +YE
Sbjct: 297 TEGGWRGFFVGLSIGYIKVTPMVACSFFIYE 327

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 91/209 (43%), Gaps = 30/209 (14%)

Query: 19  KHDNARVIKDL------LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT------AMEVI 66
           K +  R  KDL      +AG   G+A      P DT K R+Q +   T         +  
Sbjct: 335 KLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTA 394

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
           + + +  G + FY+G    ++G+    +L  G   A+K+++ ++     ++ L+LPQ  +
Sbjct: 395 KDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQ----AKTLNLPQDQV 450

Query: 127 C---------GLTGGITNSFLASPIEHVRIRLQTQ-TGSGPNVEFKGPLDCIRK-LRAQG 175
                     G   G   + +  PI  +R RLQ Q T + P V + G  D + K L  +G
Sbjct: 451 TLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYV-YNGFKDVLLKTLEREG 509

Query: 176 --GFMRGLTPTMLREGHGCGTYFLVYEAM 202
             G  +GL PT+ +        +L YE +
Sbjct: 510 YQGLFKGLVPTLAKVCPAVSISYLCYENL 538

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 119/321 (37%), Gaps = 50/321 (15%)

Query: 25  VIKDLLAG----TAGGIAQVL---VGQPFDTTKVRLQTSSTPTTAM-------------- 63
           +I D + G     AGGI+ V+      PFD  KV L   +  ++ +              
Sbjct: 220 LINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNA 279

Query: 64  ----------EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPD 113
                     + ++ L +  G K FY G    +I V    S++FG  E  K+        
Sbjct: 280 DINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGC 339

Query: 114 STSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ----TQTGSGPNVEFKGPLDCIR 169
             ++ LS    YI G   G+   F   PI+ ++ R+Q         G N+ F+   D  R
Sbjct: 340 RDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFR 399

Query: 170 KLRAQGG---FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCL--- 223
               +GG   F RG+T  ++            + A+    I K  K   +P  ++ L   
Sbjct: 400 ----EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNL 455

Query: 224 ----FGALSGTTLWMMVYPLDVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXX 278
                GA SGT    +VYP++++++ +Q       P   N    V               
Sbjct: 456 VVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFK 515

Query: 279 XXXPTMLRAAPANGATFATFE 299
              PT+ +  PA   ++  +E
Sbjct: 516 GLVPTLAKVCPAVSISYLCYE 536

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------EVIRKLLKNEGPKGFYKGTLTP 85
           G   G     V  P +  + RLQ   T           +V+ K L+ EG +G +KG +  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 86  LIGVGACVSLQFGVNEAMKRFFH 108
           L  V   VS+ +   E +K+F +
Sbjct: 521 LAKVCPAVSISYLCYENLKKFMN 543

>Scas_578.3*
          Length = 524

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 82/191 (42%), Gaps = 23/191 (12%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVIRKLLKNEGPKGFYKGTLTP 85
           G AG +AQ+ +  P DT K R+Q +            +   +++ K  G + FY+G L  
Sbjct: 334 GIAGVMAQISI-YPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLG 392

Query: 86  LIGVGACVSLQFGVNEAMKRFFHSRN------PDST---SQILSLPQYYICGLTGGITNS 136
            +G+    +L  G   A+K+++  R       P+     S +L LP     G  G     
Sbjct: 393 ALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATA-- 450

Query: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG--GFMRGLTPTMLREGHGCG 193
               PI  +R RLQ Q        + G  D  ++ L+ +G  GF +GL PT+++      
Sbjct: 451 --VYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVS 508

Query: 194 TYFLVYEAMVA 204
             +L YE   A
Sbjct: 509 IGYLCYEKFKA 519

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 82/199 (41%), Gaps = 16/199 (8%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           ++ IR L +  G + FY G    +  +    S++FG  E  KR   + + D     LS  
Sbjct: 268 IKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKL 327

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP---LDCIRKLRAQGG--- 176
           Q Y+ G   G+       PI+ ++ R+Q     G     KG    +   +++  +GG   
Sbjct: 328 QTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEG---NLKGNALLISTAKEMYKEGGIRV 384

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCL-------FGALSG 229
           F RG+    L            + A+    I +  K+  +P   + L        GA SG
Sbjct: 385 FYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSG 444

Query: 230 TTLWMMVYPLDVIKSVMQT 248
           T     VYP++++++ +Q 
Sbjct: 445 TVGATAVYPINLLRTRLQA 463

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 10/81 (12%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAM---EVIRKLLKNEGPKGFYKGTL 83
            +GT G  A      P +  + RLQ   T   P T     +V  + LK EG  GFYKG +
Sbjct: 442 FSGTVGATAVY----PINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLV 497

Query: 84  TPLIGVGACVSLQFGVNEAMK 104
             L+ V   VS+ +   E  K
Sbjct: 498 PTLVKVCPAVSIGYLCYEKFK 518

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 68/169 (40%), Gaps = 26/169 (15%)

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTG--------------SGPNV-EFKGP-LDC 167
           Y+I G   G+ +    +P++ +++ L  +T                G N+ + + P +  
Sbjct: 211 YFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 168 IRKLRAQGGFMRGLTPTMLREGHGC-------GTYFLVYEAMVANEINKGFKRTEVPAWK 220
           IR L  QGG         L     C       GT+ L    M     +K     ++   +
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLV--NDLSKLQ 328

Query: 221 LCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS-ISSVAKTLY 268
             + G ++G    + +YP+D +K  +Q   L+    GN+ + S AK +Y
Sbjct: 329 TYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMY 377

>Scas_489.4
          Length = 297

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 119/296 (40%), Gaps = 24/296 (8%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVIRKLLKNEGPKGFYKG 81
           +   +AG   G  +  +  PF+  K RLQ    TS+     + +I    K +G    Y G
Sbjct: 11  LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVG 70

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-S 140
               ++G  A   ++F   + +K        D  +  LS P+  + GL  G+  S +A +
Sbjct: 71  CPAFIVGNTAKAGIRFLGFDTIKNMLR----DPVTGELSGPRGVVAGLGAGLLESVVAVT 126

Query: 141 PIEHVRIRL-QTQTGSGPNVEFKGPLDCIRK----LRAQG--GFMRGLTPTMLREGHGCG 193
           P E ++  L   +    P  +  G    +R     +R QG  G  RG+ P  +R+     
Sbjct: 127 PFEAIKTALIDDKQALKPKYQNNGR-GMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQA 185

Query: 194 TYFLVY---EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDN 250
                Y   + MV +  N    R  + +    + GA SG        P+D +K+ MQ+  
Sbjct: 186 VRLGCYNKIKTMVQDYTNAPKDR-PLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS-- 242

Query: 251 LKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
           L + KY ++++  AK ++             P + R   + G  F  +E  +  LG
Sbjct: 243 LDATKYTSTVNCFAK-IFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFLG 297

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 84/210 (40%), Gaps = 22/210 (10%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT------A 62
           QL+  LE              +AG  GG+       P DT K R+Q +   T        
Sbjct: 299 QLMAHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELL 358

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDST------- 115
           +   R++ ++ G K FY+G    ++G+    +L  G   A+K+++ +R    T       
Sbjct: 359 ISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQV 418

Query: 116 --SQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LR 172
             S  + LP     G   G   + +  PI  +R RLQ Q        + G  D + K ++
Sbjct: 419 TISNFIVLPM----GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQ 474

Query: 173 AQG--GFMRGLTPTMLREGHGCGTYFLVYE 200
            +G  G  +GL P + +        +L YE
Sbjct: 475 REGYQGLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 103/257 (40%), Gaps = 42/257 (16%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSST------------PTTAMEVIRK---- 68
            +AG   G+       PFD  KV    R   SST            P   +  I+     
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 69  ----LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF-HSRNPDSTSQILSLPQ 123
               L +  G + FY G    +I V    +++FG  E  K+   H      TS+ LS   
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSE-LSKFS 317

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP---LDCIRKLRAQGG---F 177
            YI G  GG+   F   PI+ ++ R+Q    +  +   KG    +   R++   GG   F
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQC---APLDTALKGNELLISTARQMYRDGGLKLF 374

Query: 178 MRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCL-------FGALSGT 230
            RG+T  ++            + A+    I +  K T VP  ++ +        GA SGT
Sbjct: 375 YRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGT 434

Query: 231 TLWMMVYPLDVIKSVMQ 247
               +VYP++++++ +Q
Sbjct: 435 VGATVVYPINLLRTRLQ 451

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 19/179 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGF 78
           +L +G A G   +L     D  + RL   +  +            +V +K LK++G  G 
Sbjct: 119 NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGL 178

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           Y+G +  ++G+     L FG+ +++K    + + D +     L  + +   TG  T S+ 
Sbjct: 179 YRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVT--TGASTCSY- 235

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ---GGFMRGLTPTMLREGHGCGT 194
             P++ VR R+     SG  V++ G +DC++K+ A    G   +G    +LR   G G 
Sbjct: 236 --PLDTVRRRMMMT--SGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 109/282 (38%), Gaps = 48/282 (17%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS----------TPTTAME 64
            +  + +    I  L+ G +  IA+     P +  K+ +Q               +  ++
Sbjct: 3   SDAKQQETNFAINFLMGGVSAAIAKT-AASPIERVKILIQNQDEMIKQGTLDKKYSGIVD 61

Query: 65  VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQY 124
             ++  K EG   F++G    +I      +L F   + +K  F  +  +   +  +    
Sbjct: 62  CFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFA-GNL 120

Query: 125 YICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRK-LRAQG--GFM 178
              G  G ++  F+ S ++  R RL     S   G   +F G  D  +K L++ G  G  
Sbjct: 121 ASGGAAGALSLLFVYS-LDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLY 179

Query: 179 RGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTL------ 232
           RG  P+++      G YF +++++                  L L G+L G+ L      
Sbjct: 180 RGFMPSVVGIVVYRGLYFGMFDSLKP----------------LVLTGSLDGSFLASFLLG 223

Query: 233 WMMV-------YPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
           W++        YPLD ++  M   + ++ KY  +I  + K +
Sbjct: 224 WVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIV 265

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 125/331 (37%), Gaps = 68/331 (20%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-------------STPTT----- 61
           H N   I  L    AG +A V+V  P D  K RLQ               S  TT     
Sbjct: 99  HFNDTEITALSGALAGFLAGVIV-CPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKY 157

Query: 62  ---AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK----RFFHSRNPDS 114
                  +  ++++E  +G YKG +  ++G      + F V E  K    R+F++     
Sbjct: 158 YSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNN----- 212

Query: 115 TSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVE----FKGPLDC--- 167
            S+ LS   + +  LT G  ++ L +PI  V+ RL  Q  SG N++    +K  LD    
Sbjct: 213 -SEFLS---HSMSALTAGAISTTLTNPIWVVKTRLMLQ--SGKNIKGMTHYKNTLDAFIK 266

Query: 168 IRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMV-------------------ANEIN 208
           I K+     F  GL P++    H    +F VYE +                     N   
Sbjct: 267 IYKVEGIKSFYSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNP 325

Query: 209 KGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLY 268
           +    T     +L +    S      + YP +++++ +Q  +   P    SI S+ +T Y
Sbjct: 326 QTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTY 381

Query: 269 XXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
                          M R  PA+  T  +FE
Sbjct: 382 AKEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 81/202 (40%), Gaps = 37/202 (18%)

Query: 16  NHPKH-DNARVIKDLLAG-TAGGIAQVLVGQPFDTTKVRLQTSSTPT--------TAMEV 65
           ++P++ +N+  +   ++  TAG I+  L   P    K RL   S             ++ 
Sbjct: 205 SYPRYFNNSEFLSHSMSALTAGAISTTLT-NPIWVVKTRLMLQSGKNIKGMTHYKNTLDA 263

Query: 66  IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH----------------S 109
             K+ K EG K FY G +  L G+   V++ F V E +K+  H                +
Sbjct: 264 FIKIYKVEGIKSFYSGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGN 322

Query: 110 RNPDST-SQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCI 168
            NP +T S    L +  +      +  S L  P E +R RLQ ++   P+++       I
Sbjct: 323 SNPQTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIK-----SII 377

Query: 169 RKLRAQG---GFMRGLTPTMLR 187
           R   A+    GF  G    M R
Sbjct: 378 RTTYAKEGIRGFYSGFLTNMFR 399

>Scas_718.24
          Length = 337

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 81/175 (46%), Gaps = 20/175 (11%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGFYKGT 82
           G AGG++ + V    D  + RL   S  +           ++V +K LK++G  G Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           L  ++G+     L FG+ +++K    + + + +     L  + +   TG  T S+   P+
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVT--TGASTCSY---PL 267

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
           + VR ++     SG  V++KG  DC +K+ A  G     +G    +LR   G G 
Sbjct: 268 DTVRRKMMMT--SGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 27/149 (18%)

Query: 129 LTGGITNSFL---ASPIEHVRIRLQTQT----GSGPNVEFKGPLDCIRKLRAQGG---FM 178
           L GG++ +     ASPIE V++ +Q Q         + ++KG +DC R+   Q G   F 
Sbjct: 47  LMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFW 106

Query: 179 RGLTPTMLREGHGCGTYF----LVYEAMVANEINKGFKRTE-VPAW---KLCLFGALSGT 230
           RG T  ++R       YF    L +      ++  GFK+ +    W    L   GA  G 
Sbjct: 107 RGNTANVIR-------YFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGL 159

Query: 231 TLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259
           +L + VY LD  ++ +  D+ KS K G S
Sbjct: 160 SL-LFVYSLDFARTRLAADS-KSSKKGGS 186

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 85/193 (44%), Gaps = 21/193 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGFYKGT 82
           G AGG++ + V    D  + RL   S              ++V +K L ++G  G Y+G 
Sbjct: 122 GAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           L  ++G+     L FG+ +++K    + N +S+     L  + +   TG  T S+   P+
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVT--TGASTASY---PL 235

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGTYFLVY 199
           + VR R+     SG  V++ G  D  RK+ A  G     +G    +LR   G G   L Y
Sbjct: 236 DTVRRRMMMT--SGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISL-Y 292

Query: 200 EAMVANEINKGFK 212
           + +      K FK
Sbjct: 293 DQLQLVLFGKKFK 305

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 88/215 (40%), Gaps = 18/215 (8%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           ++  ++   +EG   F++G    +I      +L F   + +K  F  R            
Sbjct: 57  VDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAG 116

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKLRAQ---GG 176
                G  GG++  F+ S +++ R RL   + S   G   +F G +D  +K  A     G
Sbjct: 117 NLASGGAAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAG 175

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEAM----VANEINKGFKRTEVPAWKLCLFGALSGTTL 232
             RG  P+++      G YF +Y+++    +   +   F  + +  W +   GA + +  
Sbjct: 176 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTT-GASTAS-- 232

Query: 233 WMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
               YPLD ++  M   + ++ KY  +  +  K +
Sbjct: 233 ----YPLDTVRRRMMMTSGQAVKYDGAFDAFRKIV 263

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 111/267 (41%), Gaps = 47/267 (17%)

Query: 25  VIKDLLAG----TAGGIAQVL---VGQPFDTTKV----RLQTSSTPTTAME--------- 64
           +I D + G     AGGI+ V+      PFD  KV    R   SST   + E         
Sbjct: 193 LINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHA 252

Query: 65  -----------VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPD 113
                       I  L +  G K FY G     + V    S++FG  E  K+        
Sbjct: 253 KPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENC 312

Query: 114 STSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP---LDCIRK 170
             ++ LS    +I G   G+   F   PI+ ++ R+Q    +  N E KG    +   ++
Sbjct: 313 KDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQC---APLNAELKGRKLMIQTAKE 369

Query: 171 LRAQGG---FMRGLTPTML----REGHGCGTYFLV---YEAMVANEINKGFKRTEVPAWK 220
           +  +GG   F RG+T  +L          GT+ ++   Y +  A ++NK  +  E+    
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLV 429

Query: 221 LCLFGALSGTTLWMMVYPLDVIKSVMQ 247
           +   GA SGT    +VYP++++++ +Q
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQ 456

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 87/216 (40%), Gaps = 26/216 (12%)

Query: 7   TPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---- 62
           T +L+  +EN     +   +   +AG   G+       P DT K R+Q +  P  A    
Sbjct: 302 TKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCA--PLNAELKG 359

Query: 63  ----MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPD----- 113
               ++  +++    G K FY+G    ++G+    +L  G    +K+++ S         
Sbjct: 360 RKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKK 419

Query: 114 ----STSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIR 169
                 S ++ LP     G   G   + +  PI  +R RLQ Q        + G  D + 
Sbjct: 420 EEDVELSNLVVLPM----GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLL 475

Query: 170 K-LRAQG--GFMRGLTPTMLREGHGCGTYFLVYEAM 202
           K ++ +G  G  +GL PT+ +        +L YE +
Sbjct: 476 KTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENL 511

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 75/185 (40%), Gaps = 21/185 (11%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEV 65
           E+ P H    V  ++ AG   GI   +VG P    K R+Q+ S           T+    
Sbjct: 120 ESDP-HKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNG 178

Query: 66  IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYY 125
           +  + K EG  G ++G    ++  GA  S+Q  +    K F    +       L L    
Sbjct: 179 LATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSST 238

Query: 126 ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIR---KLRAQGGFMRGLT 182
           + GL  GI    + +P + V  R+  Q G+     +KGP+DC+    K+   G   +G  
Sbjct: 239 VTGLGVGI----VMNPWDVVLTRVYNQKGN----TYKGPIDCMFKTIKIEGIGALYKGFG 290

Query: 183 PTMLR 187
             + R
Sbjct: 291 AQLFR 295

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 111/278 (39%), Gaps = 36/278 (12%)

Query: 15  ENHPKHDNARVIK--DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRK---- 68
           + H K    +V K    +AG       V V  PF+  K R+Q     +   + I +    
Sbjct: 11  KEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQ 70

Query: 69  ----LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAM-----KRFFHSRNPDSTSQIL 119
               + KNEG KG  +G ++  +        + G  E +     K FF   +P    ++ 
Sbjct: 71  ALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPH---KLQ 127

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEF---KGPLDCIRKLRA 173
           ++      G T GI  + + SP+  V+ R+Q+ + +   G    +      L  I K   
Sbjct: 128 NVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEG 187

Query: 174 QGGFMRGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALSG 229
             G  RG+   +LR G G      +Y      ++ N+I K     E  A  L L   ++G
Sbjct: 188 VLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMK-----EGTALHL-LSSTVTG 241

Query: 230 TTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
             + +++ P DV+  + +  N K   Y   I  + KT+
Sbjct: 242 LGVGIVMNPWDVV--LTRVYNQKGNTYKGPIDCMFKTI 277

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 86/221 (38%), Gaps = 15/221 (6%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI 87
            LL+G A G +  LV  P DT K RLQ                 N G KG Y+G  + ++
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKG----------GFFANGGYKGIYRGLGSAVV 56

Query: 88  GVGACVSLQFGVNEAMKR----FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
                 SL F   + MK     +        + Q++    + +    G I    +  P E
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAE 116

Query: 144 HVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMV 203
            V+ R Q  + +      +  L    K   +    RG + T++RE       F +YE + 
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYL- 175

Query: 204 ANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
                K   +++V  WK  + G+++G        PLD +K+
Sbjct: 176 KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKT 216

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  + T  +   VI ++ + EGP  F+ G     + + A  
Sbjct: 200 AGGIAAATT-TPLDFLKTRLMLNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGG 258

Query: 94  SLQFGVNEAMKRFFHSRNPDS 114
           ++  G+ E +        P +
Sbjct: 259 AIFLGMYETVHSLLSKSFPTA 279

>Scas_558.2
          Length = 289

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 101/260 (38%), Gaps = 42/260 (16%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +  LL+G A G +  LV  P DT K RLQ                +N G  G Y+G  + 
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFQNGGYHGIYRGLGSA 56

Query: 86  LIGVGACVSLQFGVNEAMK--------RFFHS---RNPDSTSQILSLPQYYICGLTGGIT 134
           ++      SL F   ++MK        R  +S   R+P S   I+ +    I    G + 
Sbjct: 57  VVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHM----IASSMGELA 112

Query: 135 NSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGT 194
              +  P E ++ R Q  + +     F+  L    +        RG + T++RE      
Sbjct: 113 ACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCI 172

Query: 195 YFLVYE------AMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQT 248
            F +YE      A+  NE+        +  WK  + G+++G        PLD +K+ +  
Sbjct: 173 QFPLYEFMKKEWALYDNEVG------HLKPWKGAICGSIAGGIAAATTTPLDFLKTRLML 226

Query: 249 DNLKSPKYGNSISSVAKTLY 268
           +    P     I S+ + +Y
Sbjct: 227 NKDSIP-----IKSLIRNIY 241

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  +        +IR + K EG K F+ G     + + A  
Sbjct: 206 AGGIAAATT-TPLDFLKTRLMLNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGG 264

Query: 94  SLQFGVNEAMKRFFHSRNPDSTSQIL 119
           ++  GV E M   F  ++ + T  IL
Sbjct: 265 AIFLGVYETMH--FMLQSLEETKTIL 288

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 122/310 (39%), Gaps = 61/310 (19%)

Query: 45  PFDTTKVRLQTS------STPTTA---------------MEVIRKLLKNEGPKGFYKGTL 83
           PFD  K RLQ+        T  TA               + +I+ +   EG +  +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ-----YYICGLTGGITNSFL 138
             L+GV    S+ F        F +    D+ S++L+  Q     +++ G T G   S  
Sbjct: 129 PNLVGVIPARSINF--------FTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTA 180

Query: 139 ASPIEHVRIRLQ-TQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTPTMLREGHGCGT 194
            +PI  V+ RLQ  +   G +  +K   DC++  +R +G  G  +GL+ + L        
Sbjct: 181 TNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQ 240

Query: 195 YFLVYEAMVA----------NEINKGFKRTEVPAWKLCLFGALSGTTLW---MMVYPLDV 241
           + L YE M             +I++  K T +   + C     +G       ++ YP +V
Sbjct: 241 WVL-YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEV 299

Query: 242 IKSVM-----QTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFA 296
           +++ +     +   LK      S S + K                P ++R  P +   F 
Sbjct: 300 VRTRLRQAPKENGKLKYTGLFQSFSLIIK----EEGFASMYSGLTPHLMRTVPNSIIMFG 355

Query: 297 TFELAMRLLG 306
           T+EL ++LL 
Sbjct: 356 TWELVIKLLA 365

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 89/193 (46%), Gaps = 21/193 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGFYKGT 82
           G AGG++ + V    D  + RL   +  +           ++V +K + ++G  G Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           L  +IG+     L FG+ ++ K    + + +  S I S    ++   TG  T S+   P+
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEG-SFIASFLLGWVV-TTGASTASY---PL 236

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGTYFLVY 199
           + VR R+     SG  V++KG +DC++K+ A  G     +G    +LR   G G   L Y
Sbjct: 237 DTVRRRMMMT--SGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISL-Y 293

Query: 200 EAMVANEINKGFK 212
           + +      K FK
Sbjct: 294 DQLQMILFGKKFK 306

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 121/321 (37%), Gaps = 59/321 (18%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--------MEVIRKLLKNEGPKGFYK 80
           L  G +G  A+ L+  P D  K+  QTS+   T         +E  + +  N+G +GF++
Sbjct: 38  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           G    L+ +    +++F   E ++     S+  +S  + L      + G   G+ + F+ 
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRL------VSGSLAGLCSVFIT 150

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG----------------GFMRGLTP 183
            P++ VR+RL  +T     V+    +  I K  A                   F RG  P
Sbjct: 151 YPLDLVRVRLAYET-EHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVP 209

Query: 184 TMLREGHGCGTYFL------------------VYEAMVANEINKGFKRTEVP--AWKLCL 223
           T+L      G  F                   V E    +E+ +  K+   P   W   +
Sbjct: 210 TVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELI 269

Query: 224 FGALSGTTLWMMVYPLDVIKSVMQTDNLKSPK--YGN---SISSVAKTLYXXXXXXXXXX 278
            G L+G       YP ++I+  +Q   L SPK  Y +   SIS +A  ++          
Sbjct: 270 SGGLAGMASQTAAYPFEIIRRRLQVSAL-SPKTMYDHKFQSISEIAHIIFKERGVRGFFV 328

Query: 279 XXXPTMLRAAPANGATFATFE 299
                 ++  P    +F  +E
Sbjct: 329 GLSIGYIKVTPMVACSFFVYE 349

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 11/107 (10%)

Query: 12  DDLENHPKHDNA--RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------ 63
           D+LE   K      R   +L++G   G+A      PF+  + RLQ S+     M      
Sbjct: 249 DELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQ 308

Query: 64  ---EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
              E+   + K  G +GF+ G     I V   V+  F V E MK  F
Sbjct: 309 SISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNF 355

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 70/157 (44%), Gaps = 32/157 (20%)

Query: 128 GLTGGITNSF---LASPIEHVRIRLQTQTGSGPN-VEFKGPL-------------DCIRK 170
           GL GGI+ S    L +P++ ++I  QT   S P+  ++ G L             D +R 
Sbjct: 37  GLAGGISGSCAKTLIAPLDRIKILFQT---SNPHYTKYTGSLIGLVEAAKHIWINDGVR- 92

Query: 171 LRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEI-NKGFKRTEVPAWKLCLFGALSG 229
                GF +G + T+LR        F+ YE +    I +K F+      W+  + G+L+G
Sbjct: 93  -----GFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE----SHWRRLVSGSLAG 143

Query: 230 TTLWMMVYPLDVIKSVMQTD-NLKSPKYGNSISSVAK 265
                + YPLD+++  +  +   K  K G  I  + K
Sbjct: 144 LCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYK 180

>Scas_721.129
          Length = 323

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV---------I 66
           N   H   +V  ++ AG + GI   ++G P    K R+Q+ S      E          +
Sbjct: 118 NEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGL 177

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
             + + EG KG ++G    ++  GA  S+Q  +    K F    +       L L    I
Sbjct: 178 STIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTI 237

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG--GFMRGLTP 183
            GL  G+  + + +P + +  R+  Q G+     +KGP+DC ++ +R +G     +G   
Sbjct: 238 SGL--GV--AVVMNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYKGFQA 289

Query: 184 TMLR 187
            +LR
Sbjct: 290 QILR 293

>Scas_702.10
          Length = 302

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 12/163 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-EVIRKLLKNEGPKGFYKGTLTPLIGVG 90
           G A GI   ++  P D  KVRLQ +  P   +  ++  +L+NE   G Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 91  ACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ 150
              +++FG  + MK     +       +  LP     G  GG+  +F     + V IR+Q
Sbjct: 76  TYTTVRFGAYDLMKENLIPQG-HINDMVYLLPCSMFSGAIGGLVGNF----ADVVNIRMQ 130

Query: 151 TQTGSGPNVE--FKGPLDCIRKLRAQGG----FMRGLTPTMLR 187
             +   P +   ++  +D + K+    G     + G  P M+R
Sbjct: 131 NDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVR 173

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--STPTTAMEVIR 67
           L+  L   PK ++  +   LLAG    +    +  P D  K R+  +  +   +A++++ 
Sbjct: 192 LVTKLSFDPKKNSTHLSASLLAG----LVATTICSPADVIKTRIMNAHKTESESAIKILT 247

Query: 68  KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
             +K EGP   ++G L     +G    L F   E +K+
Sbjct: 248 SAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKK 285

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 124/308 (40%), Gaps = 49/308 (15%)

Query: 41  LVGQPFDTTKVRLQT------------SSTPTTA-------------MEVIRKLLKNEGP 75
           +V  PFD  K RLQ+            S  P  A               +I  + +NEG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
           +  +KG    L+GV    S+ F      K  + S+  ++  + + +  + +   T G   
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIY-SKTLNNGQEAVWI--HLMAAATAGWAT 184

Query: 136 SFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGC 192
           S   +PI  V+ RLQ    +G   ++K   DC++ +  + G +   +GL+ + L    G 
Sbjct: 185 STATNPIWLVKTRLQLDK-AGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGI 243

Query: 193 GTYFLVYEAMVA----------NEINKGFKRTEVPAWKLCLFGALSGTTLW---MMVYPL 239
             + L YE M              I++  K T     + C     +G   +   ++ YP 
Sbjct: 244 LQWVL-YEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPH 302

Query: 240 DVIKSVMQTDNLKSP--KYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           +V+++ ++   L++   KY   + S+ + +              P +LR  P +   F T
Sbjct: 303 EVVRTRLRQAPLENGKLKYTGLVQSI-RVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 361

Query: 298 FELAMRLL 305
           +EL +RLL
Sbjct: 362 WELVIRLL 369

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 86/191 (45%), Gaps = 24/191 (12%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT----AMEVIRK 68
           DL+   K +++  I  +  G AG +++ +V  PF+  K+ LQ  S+ +      +  + +
Sbjct: 2   DLKQLAKQESS--IAFIAGGVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQ 58

Query: 69  LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSLPQYYIC 127
           + K EG  G ++G     + +    ++QF V E  K+  FH        Q+L+  +    
Sbjct: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAG 118

Query: 128 GLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFKGPLDC----------IRKLRAQG- 175
            L GG+  S LA+ P++ VR RL  QT +   +      D           ++  + +G 
Sbjct: 119 ALCGGM--SVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGG 176

Query: 176 --GFMRGLTPT 184
             G  RG+ PT
Sbjct: 177 IRGLYRGIYPT 187

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 5/132 (3%)

Query: 125 YICGLTGGITNSFLASPIEHVRIRLQTQTG-SGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
           +I G   G  +  + SP E V+I LQ Q+  S  N      +  + K     G  RG   
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGL 74

Query: 184 TMLREGHGCGTYFLVYEAMVAN--EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDV 241
             +R        F+VYE    +   ++    + ++  W+    GAL G    +  YPLD+
Sbjct: 75  NCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDL 134

Query: 242 IKS--VMQTDNL 251
           +++   +QT NL
Sbjct: 135 VRTRLSIQTANL 146

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 84/188 (44%), Gaps = 23/188 (12%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI- 87
           L+ G AGG++  +  QP D  K R Q  +   T  + ++ L   + P   ++GTL   I 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSL---DTPWQLWRGTLPSAIR 63

Query: 88  -GVGACVSLQ----FGVNEAMKRFFHSRNPDSTSQILSLPQY--YICGLTGGI---TNSF 137
             VG+ + L          A ++ F + +   T +  +LPQ   Y   +TG     T  +
Sbjct: 64  TSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGY 123

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
           +  PI  +++R ++         +K   +  + + AQ G   F RG  PT LR+    G 
Sbjct: 124 ITMPITIIKVRYESTL-----YNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGL 178

Query: 195 YFLVYEAM 202
           Y L+YE +
Sbjct: 179 YVLLYEKL 186

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 77/192 (40%), Gaps = 30/192 (15%)

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
           + I G  GG++++    P++ ++ R Q QT  G   +    LD   +L       RG  P
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQL------WRGTLP 59

Query: 184 TMLREGHGCGTYFLVYEAM-----------VANEINKGFKRTEVPAWKLCLF-----GAL 227
           + +R   G   Y      M            A+ +  G K + +P  +L ++     GA 
Sbjct: 60  SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTG-KSSNLP--QLSMYENLVTGAF 116

Query: 228 SGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRA 287
           +  T+  +  P+ +IK V     L + K   SI+  AK++              PT LR 
Sbjct: 117 ARGTVGYITMPITIIK-VRYESTLYNYK---SIAEAAKSIAAQEGIRGFFRGFGPTCLRD 172

Query: 288 APANGATFATFE 299
           AP +G     +E
Sbjct: 173 APYSGLYVLLYE 184

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 111/275 (40%), Gaps = 45/275 (16%)

Query: 23  ARVIKDLLAGTAGGIAQ---VLVGQPFDTTKVRLQTSSTPTTAMEVIRK--------LLK 71
           A+ I    +  AGG+A    V V  P +  K+R+Q     + +   + K        + K
Sbjct: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76

Query: 72  NEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH----SRN----PDST-SQILSLP 122
           NEG KG  K       G+ A    Q G+N +   F+     S N    PD    ++ S+ 
Sbjct: 77  NEGIKGLQK-------GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG 129

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQT---GSGPNVEFKGP---LDCIRKLRAQGG 176
                G   GI  + + SP+  V+ RLQ+ +     G    + G    L  I K     G
Sbjct: 130 VNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALSGTTL 232
             RG+   +LR G G      +Y      +V N++ K     + PA  L     +SG  +
Sbjct: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMK-----DGPALHLTA-STISGLGV 243

Query: 233 WMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
            +++ P DVI  + +  N K   Y   I  + KT+
Sbjct: 244 AVVMNPWDVI--LTRIYNQKGDLYKGPIDCLVKTV 276

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 74/180 (41%), Gaps = 20/180 (11%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---------PTTAMEVIRKLL 70
           H    V  ++ +G A GI   ++G P    K RLQ+ S           T     +  + 
Sbjct: 123 HKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130
           K EG KG ++G    ++  GA  S+Q  +    K      +       L L    I GL 
Sbjct: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGL- 241

Query: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG--GFMRGLTPTMLR 187
            G+  + + +P + +  R+  Q G      +KGP+DC ++ +R +G     +G    + R
Sbjct: 242 -GV--AVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 97/251 (38%), Gaps = 19/251 (7%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYK 80
           D++  +  L +G A G +  L   P DT K RLQ                 N G KG Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFH---SRNPDSTSQILSLPQYYICGLTGGITNSF 137
           G  + +I      SL F   ++MK +     S+   S +Q+     +      G ++   
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACL 111

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFL 197
           +  P E ++ R QT   +     F   L             RG   T++RE       F 
Sbjct: 112 VRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFP 171

Query: 198 VYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYG 257
           +YE +      +   +  V  W+  + G+++G        PLDV+K+ +   +   P   
Sbjct: 172 LYEFLKKTWAKRN-GQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP--- 227

Query: 258 NSISSVAKTLY 268
             ++ +AK +Y
Sbjct: 228 --VAQLAKNIY 236

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 86/205 (41%), Gaps = 19/205 (9%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQ---VLVGQPFDTTKVRLQ--------TSSTPTTAM 63
           E H +   A  +    +  AGG+A    V V  PFD  K R+Q         +   T  +
Sbjct: 7   EKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPI 66

Query: 64  EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTS-QILSL 121
           +    + KNEG  G  KG  +  +   A    + G  E ++   ++   P+  S ++  +
Sbjct: 67  QAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHI 126

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKL-RAQG-- 175
                 G T G+  +F+ SP+  V+ R+Q+ + +   G    +    + +  + R++G  
Sbjct: 127 GINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIK 186

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYE 200
           G  RG+   MLR G G      +Y 
Sbjct: 187 GLFRGVDAAMLRTGIGSAVQLPIYN 211

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 76/186 (40%), Gaps = 20/186 (10%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVI 66
           N   H    +  ++ AG   G+    +G P    K R+Q+ S           T+A   +
Sbjct: 117 NVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGL 176

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
             + ++EG KG ++G    ++  G   ++Q  +    K F    +  +    L L    I
Sbjct: 177 ATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTI 236

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG--GFMRGLTP 183
            G   G+      +P + V  R+  Q G+     + GP+DC I+ +R +G     +G   
Sbjct: 237 AGFGVGVA----MNPWDVVLTRVYNQKGN----LYSGPIDCFIKTVRNEGLSALYKGFGA 288

Query: 184 TMLREG 189
            +LR G
Sbjct: 289 QILRIG 294

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 95/244 (38%), Gaps = 22/244 (9%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI 87
            LL+G A G +  LV  P DT K RLQ                +N G +G Y+G  + ++
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFRNGGYRGVYRGLGSAVV 57

Query: 88  GVGACVSLQFGVNEAMKR----FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143
                 SL F   +  K     FF    P  +S +  +  +      G I    +  P E
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFRGLLP--SSNVADVVTHMFSSSMGEIAACMVRVPAE 115

Query: 144 HVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAM- 202
            V+ R QT          +  L        +    RG + T++RE       F +YE M 
Sbjct: 116 VVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMK 175

Query: 203 -VANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSIS 261
            V  E+++      V  WK  + G+++G        PLD +K+ +     KS   G  +S
Sbjct: 176 KVWAELDES---DRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCK-KSIPLGTLVS 231

Query: 262 SVAK 265
           ++ K
Sbjct: 232 TIYK 235

>Kwal_26.7653
          Length = 325

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVIRKLL 70
           H    V  ++++G   GI   ++G P    K R+Q+ S           T+    +  + 
Sbjct: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130
           + EG KG Y+G    ++  GA  S+Q  +    K F    +       L L    + G  
Sbjct: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244

Query: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK---LRAQGGFMRGLTPTMLR 187
            G+    + +P + +  R+  Q G+     +KGPLDC  K   +   G   +G    + R
Sbjct: 245 VGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296

>Scas_721.27
          Length = 374

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 138/342 (40%), Gaps = 64/342 (18%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT----------SSTPTTAME 64
           E+HP   N +     +AG  GG+A  +V  PFD  K RLQ+          ++T T A  
Sbjct: 45  ESHP---NVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHN 101

Query: 65  -------------------VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
                              ++  + K EG +  +KG    L+GV    S+ F      K 
Sbjct: 102 SKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKE 161

Query: 106 FFHS--RNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKG 163
            +     N   T  I     + +   T G   S   +PI  ++ R+Q    +G   ++K 
Sbjct: 162 IYSKAFNNGQETPLI-----HLMSAATAGWATSTATNPIWMIKTRVQLDK-AGTTRKYKN 215

Query: 164 PLDCIRK-LRAQG--GFMRGLTPTMLREGHGCGTYFLVYEAM-----------VANEINK 209
             DC++  L+++G  G  RGL+ + L    G    +L+YE M             +E   
Sbjct: 216 SWDCLKTVLKSEGIYGLYRGLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQL 274

Query: 210 GFKRTE-VPAWKLCLFGALSGTTLWM---MVYPLDVIKSVMQTDNLKS--PKYGNSISSV 263
              RTE +  W  C     +G   ++   + YP +V+++ ++   +++  PKY   + S 
Sbjct: 275 TKSRTEKIKEW--CQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSF 332

Query: 264 AKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
            + +              P ++R  P +   F T+EL +RLL
Sbjct: 333 -RVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELVIRLL 373

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 20/186 (10%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVI 66
           +   H    V  ++ AG A GI   ++G P    K RLQ+ S           T     +
Sbjct: 115 DQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL 174

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYI 126
           + +   EG KG ++G    ++  GA  S+Q  +    K F    +       L L    I
Sbjct: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTI 234

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQG--GFMRGLTP 183
            GL  G+  + + +P + +  R+  Q G      +KGP+DC ++ ++ +G     +G   
Sbjct: 235 SGL--GV--AVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEA 286

Query: 184 TMLREG 189
            + R G
Sbjct: 287 QVFRIG 292

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 83/185 (44%), Gaps = 20/185 (10%)

Query: 25  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKN-EGPKGFYKGTL 83
           V   L++G  GG+A V   QP D  K RLQ +   +     +R +L+     +  ++GTL
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASS-----LRSVLREVRTTRELWRGTL 62

Query: 84  TPLI--GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNS---FL 138
              +   +G+ + L   +N +           + S +L   Q Y   LTG ++ +    +
Sbjct: 63  PSALRTSIGSALYLSL-LNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLV 121

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGTY 195
             PI  +++R ++         + G  +  R + R++G  GF +G   T LR+    G Y
Sbjct: 122 TMPITVIKVRYESTL-----YAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 196 FLVYE 200
            L+YE
Sbjct: 177 VLLYE 181

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 74/192 (38%), Gaps = 19/192 (9%)

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
           +P + + G  GG+ +     P++ ++ RLQ    S            +R++R      RG
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLR-------SVLREVRTTRELWRG 60

Query: 181 LTPTMLREGHGCGTY--FLVYEAMVANEINKGFKRT----EVPAWKLCLFGALSGTTLWM 234
             P+ LR   G   Y   L Y        ++   R+     + +++  L GALS   + +
Sbjct: 61  TLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL 120

Query: 235 MVYPLDVIKSVMQTDNLKSPKYG-NSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
           +  P+ VIK        +S  Y  N ++   + ++              T LR AP  G 
Sbjct: 121 VTMPITVIKV-----RYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGL 175

Query: 294 TFATFELAMRLL 305
               +E A  +L
Sbjct: 176 YVLLYEQAKEML 187

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 29/64 (45%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           PFDT K R+Q  S P   ++ +R ++  E  +  + G    L        + +G+ E + 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 105 RFFH 108
           +  H
Sbjct: 290 KLLH 293

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 117/328 (35%), Gaps = 43/328 (13%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEV 65
            L DD E+ P      +    LAG  GGI         DT K R Q +         ++ 
Sbjct: 43  NLFDDYEHSP------IWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQA 96

Query: 66  IRKLLKNEG-PKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSLPQ 123
            R +   EG  +G Y G    ++G     ++ F   E  KR   +  + + T   L+   
Sbjct: 97  YRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLT--- 153

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQ-------TGSGPNVE-FKGPLDCIRKLRAQG 175
               G  G   +SF+  P E ++ RLQ Q         SG N +  +  +  I +     
Sbjct: 154 ---AGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVA 210

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYEAMVANEI---NKGFKRTEVPAWKLCLFGALSGTTL 232
               G   T+ R+       F  YE           K   + ++      + GA +G   
Sbjct: 211 ALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA 270

Query: 233 WMMVYPLDVIKSVMQTD--------------NLKSP-KYGNSISSVAKTLYXXXXXXXXX 277
            ++  PLDV+K+ +QT               N+  P    NSI    +T+Y         
Sbjct: 271 GILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFF 330

Query: 278 XXXXPTMLRAAPANGATFATFELAMRLL 305
               P  +  +  +      +++A+R+L
Sbjct: 331 SGVGPRFVWTSVQSSIMLLLYQMALRVL 358

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 115/274 (41%), Gaps = 35/274 (12%)

Query: 61  TAMEVIRKLLKNEGPKGFYKG-TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
           +  E   K+ + EG    ++G ++T L+ + A V + F   E  +   HS   DS   + 
Sbjct: 99  STWEAFTKISEVEGLATLWRGLSITLLMAIPANV-VYFSGYEMFRD--HSPMRDSYPSLN 155

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQT----QTGSGPNVEFKGPLDCIRKLRAQG 175
            L     CG T  +  +   +P+E ++ RLQ+    +  +   + FK  L   R     G
Sbjct: 156 PL----FCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSG 211

Query: 176 GF---MRGLTPTMLREGHGCGTYFLVYEAMVAN---EINKGFKRTEV-PAWKLCLF---- 224
           G+    +GL  T+ R+      Y+  YE    N   + ++   R  + P W   +     
Sbjct: 212 GYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIG 271

Query: 225 GALSGTTLWMMVYPLDVIKSVMQT---------DNLKSPKYGNSISSVAKTLYXXXXXX- 274
           G++SG++  ++ +P DV K+ MQ          + L SPK   S   + K LY       
Sbjct: 272 GSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEG 331

Query: 275 --XXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
                    P +++ AP+     +T+EL+ RL  
Sbjct: 332 YGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

>Scas_667.4
          Length = 308

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 78/175 (44%), Gaps = 20/175 (11%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGFYKGT 82
           G AGG++ + V    D  + RL   +  +           ++V ++ L  +G  G Y+G 
Sbjct: 125 GAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           L  ++G+     L FG+ +++K    + + + +     L  + +   TG  T S+   P+
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVT--TGASTASY---PL 238

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
           + VR R+     SG  V++ G  DC RK+ A  G     +G    +LR   G G 
Sbjct: 239 DTVRRRMMMT--SGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 104/253 (41%), Gaps = 26/253 (10%)

Query: 22  NARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKG 81
           ++  +  L++G A G +  +V  P DT K RLQ                 N G +G Y+G
Sbjct: 2   DSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG----------GFFHNGGYRGIYRG 51

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHSR--NPDSTSQILSLPQYYICGLTGGITNSFLA 139
             + ++      SL F   ++MK+          ++ Q+  +  + +    G ++   + 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTMLREGHGCGTYF 196
            P E ++ R QT      N   +     +R    +G   G  RG   T++RE       F
Sbjct: 112 VPAEVIKQRTQTHH---TNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQF 168

Query: 197 LVYEAMVANEINKGFKRTE-VPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPK 255
            +YE +   +    +   E V AW+  + G+L+G        PLDV+K+ M     + P 
Sbjct: 169 PLYEYL--KKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP- 225

Query: 256 YGNSISSVAKTLY 268
               +  +A+TL+
Sbjct: 226 ----MLHLARTLF 234

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           P D  K R+         + + R L + EG + F++G     + + A  ++  GV EA+ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 105 RFF 107
             F
Sbjct: 269 SLF 271

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 126/306 (41%), Gaps = 53/306 (17%)

Query: 45  PFDTTKVRLQT----SSTPTTAME---------VIRKLL-------------KNEGPKGF 78
           PFD  K RLQ+    +   + AM+         V R LL             + EG +  
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
           +KG    L+GV    S+ F +     +  +SR  ++  +   +  + +   T G   S +
Sbjct: 130 FKGLGPNLVGVIPARSINF-LTYGTTKDIYSRTLNNGQEAPWI--HLLAAATAGWATSTV 186

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTPTMLREGHGCGTY 195
            +PI  V+ RLQ          +K  LDCI+  ++ +G  G  +GL+ + L    G   +
Sbjct: 187 TNPIWLVKTRLQLDKAGTKT--YKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQW 244

Query: 196 FLVYEAM--VANE--------INKGFKRTEVPAWKLCLFGALSGTTLW---MMVYPLDVI 242
            L YE M  +  E        I++  K T     + C     +G   +   ++ YP +V+
Sbjct: 245 IL-YEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVV 303

Query: 243 KSVMQ---TDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
           ++ ++   T+N K  KY   + S  + +              P +LR  P +   F T+E
Sbjct: 304 RTRLRQAPTENGK-LKYTGLVQSF-RVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWE 361

Query: 300 LAMRLL 305
           L ++LL
Sbjct: 362 LVIKLL 367

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 82/191 (42%), Gaps = 26/191 (13%)

Query: 5   FPTPQL----IDDLENHPKHDNAR------VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ 54
           FPT  L     D +++   +D  R         +L +G A G   +L     D  + RL 
Sbjct: 88  FPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLA 147

Query: 55  TSSTPTTA---------MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
             +  + +         ++V +K LK +G  G Y+G +  ++G+     L FG+ ++ K 
Sbjct: 148 ADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKP 207

Query: 106 FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPL 165
              +   +      S    ++ G    +  S  + P++ VR R+     SG  +++ G L
Sbjct: 208 VLLTGALEG-----SFVASFLLGWVITMGASTASYPLDTVRRRMMMT--SGQTIKYDGAL 260

Query: 166 DCIRKLRAQGG 176
           DC+RK+  + G
Sbjct: 261 DCLRKIVQKEG 271

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 96/216 (44%), Gaps = 20/216 (9%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF-HSRNPDSTSQILSL 121
           ++  ++   +EG   F++G    ++      +L F   + +K    + R  D  ++  + 
Sbjct: 61  LDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFA- 119

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQ---TGSGPNVEFKGPLDCIRK-LRAQG-- 175
              +  G  GG++  F+ S +++ R RL      + S    +F G LD  +K L+  G  
Sbjct: 120 GNLFSGGAAGGLSLLFVYS-LDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLL 178

Query: 176 GFMRGLTPTMLREGHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALSGTT 231
           G  RG  P++L      G YF +Y++    ++   +   F  + +  W + + GA + + 
Sbjct: 179 GLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITM-GASTAS- 236

Query: 232 LWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
                YPLD ++  M   + ++ KY  ++  + K +
Sbjct: 237 -----YPLDTVRRRMMMTSGQTIKYDGALDCLRKIV 267

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 117/305 (38%), Gaps = 23/305 (7%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKLL 70
            N P  D        LAG+  G  +  +  PF+  K RLQ     + A    + +I    
Sbjct: 83  SNKPAVDP---FHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTG 139

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130
           KN G    Y G    ++G  A   ++F   + +K     +     S    +    + GL 
Sbjct: 140 KNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGV----VAGLG 195

Query: 131 GGITNSFLA-SPIEHVRIRL-QTQTGSGPNVEF--KGPLDCIRKLRAQGGF---MRGLTP 183
            G+  S +A +P E ++  L   +  + P  +   KG +    KL +  GF    RG+ P
Sbjct: 196 AGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLP 255

Query: 184 TMLREGHGCGTYFLVYEAM--VANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDV 241
             +R+          Y  +  +  +     K   + +    + GA SG        P+D 
Sbjct: 256 VSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDT 315

Query: 242 IKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELA 301
           +K+ MQ+  L + +Y ++I+  A T++             P + R   + G  F  +E  
Sbjct: 316 VKTRMQS--LNAGQYSSTINCFA-TIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKV 372

Query: 302 MRLLG 306
           + +L 
Sbjct: 373 LTVLA 377

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVIR 67
           L+ D  N PK          + G   GI  V    P DT K R+Q+  +   ++ +    
Sbjct: 277 LVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFA 336

Query: 68  KLLKNEGPKGFYKGTLTPLIG 88
            + K EG K F+KG  TP +G
Sbjct: 337 TIFKEEGLKTFWKGA-TPRLG 356

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 78/187 (41%), Gaps = 17/187 (9%)

Query: 27  KDLLAGTAGGIAQVLVG-QPFDTTK---------VRLQTSSTPTTAMEVIRKLLKNEGPK 76
           + +LAG   G+ + +V   PF+  K         VR +  +   +       L+K+EG +
Sbjct: 108 RGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFR 167

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNS 136
           G Y G L   +   A  +++ G    +K            + L+    +I G   G+   
Sbjct: 168 GLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTV 227

Query: 137 FLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCG 193
           +   PI+ V+ R+Q+ T S    ++   L+C   +  + G   F +G TP + R     G
Sbjct: 228 YATMPIDTVKTRMQSLTAS----KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGG 283

Query: 194 TYFLVYE 200
             F +YE
Sbjct: 284 IVFTIYE 290

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 112/286 (39%), Gaps = 20/286 (6%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVIRKLLKNEGPKGFYKGT 82
           K  +AG   G  +  +  PF+  K RLQ    +S      + +I    K +G    Y G 
Sbjct: 12  KSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVGC 71

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-SP 141
              ++G  A  + +F   + ++        D  +  LS P+  + GL  G+  S +A +P
Sbjct: 72  PAFIVGNTAKAATRFLGYDTIRNLLK----DKKTGELSGPRGVLAGLGAGLLESVVAVTP 127

Query: 142 IEHVR-IRLQTQTGSGPNVEFKG---PLDCIRKLRAQG--GFMRGLTPTMLREGHGCGTY 195
            E ++ + +  +    P  +  G     + I  ++ +G  G   G+ P  +R+       
Sbjct: 128 FEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVR 187

Query: 196 FLVYEAM--VANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKS 253
              Y  +  +  +     K   + +    + GA SG        P+D +K+ MQ+  L +
Sbjct: 188 LGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQS--LTA 245

Query: 254 PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFE 299
            KY ++++    T+Y             P + R   + G  F  +E
Sbjct: 246 SKYSSTLNCFT-TIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTPTTAMEVIR 67
           L+ D    PK          + G   G+  V    P DT K R+Q  T+S  ++ +    
Sbjct: 197 LVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFT 256

Query: 68  KLLKNEGPKGFYKGTLTPLIG 88
            + K EG K F+KG  TP +G
Sbjct: 257 TIYKEEGLKTFWKGA-TPRLG 276

>Kwal_23.3965
          Length = 307

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRL--QTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI 87
           + G   G    +   P D  + R     S   +T +   +++ ++EG +GF+KG  + ++
Sbjct: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

Query: 88  GVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRI 147
            +    S      E++K F   R PD  S ++ L +     +  GI +  +  PI+ VR 
Sbjct: 173 SIAVATSSILATYESVKIFCEQR-PDRDSSVIQLLESS-ASVIAGIVSKTIVFPIDTVRK 230

Query: 148 RLQT 151
           R Q 
Sbjct: 231 RYQV 234

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 103/255 (40%), Gaps = 21/255 (8%)

Query: 15  ENH-PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVIRKL 69
           E+H  K     V + L+AG   GI+  +V  P DT K+RLQ            +   ++L
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62

Query: 70  LKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
           ++ EG +  +KG +  +       S QF     + +        S SQ+ +     + G 
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL------SKSQLPAQIHTGMVGA 116

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTML 186
             G  ++  + P + +R R      +  + E    L   +++ R +G  GF +G++ +++
Sbjct: 117 LSGTCSAIASYPCDVLRTRFI----ANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

Query: 187 REGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK--- 243
                  +    YE++      +  + + V          ++G     +V+P+D ++   
Sbjct: 173 SIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRY 232

Query: 244 SVMQTDNLKSPKYGN 258
            V+    L  P + N
Sbjct: 233 QVIDWQQLGHPGHTN 247

>Kwal_27.11626
          Length = 299

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
            + EF       D +N       + ++   AG+  GI ++++  P D  K++ QT+    
Sbjct: 94  FANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESF 152

Query: 61  TAMEVIRKLLKNEGPKGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
                I K+LK+EG  G Y+G   T         +L FG N   K +       S++   
Sbjct: 153 KGRGFI-KILKDEGF-GLYRGWGWTAARNAPGSFAL-FGGNAFAKEYILGLKDYSSA--- 206

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMR 179
           +  Q ++  + G   +  +++P++ ++ R+Q +    P   F+   + ++       F +
Sbjct: 207 TWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKN-EGITAFFK 265

Query: 180 GLTPTMLREG 189
           GLTP +L  G
Sbjct: 266 GLTPKLLTTG 275

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--STPTTAMEVIRKLLKNEGPKG 77
           + +A   ++ ++   G  A ++V  P D  K R+Q      P +   +++  LKNEG   
Sbjct: 203 YSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITA 262

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAM 103
           F+KG    L+  G  +   F + +++
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFALAQSL 288

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 107/256 (41%), Gaps = 36/256 (14%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNE------GPKGFY 79
           I  +L   + GI ++ V  P DT   RL ++ T  ++   +  ++  E      G + F 
Sbjct: 10  IARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLF- 68

Query: 80  KGTLTPLIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYI 126
             TL P +G  A   +     ++G        +N+  K  F +   + T + L   +   
Sbjct: 69  --TLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKAL---RSAT 123

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-GFMRGLTPTM 185
            G   GI    L  P++ ++I+ QT   S     FKG    I+ L+ +G G  RG   T 
Sbjct: 124 AGSLIGIGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILKDEGFGLYRGWGWTA 176

Query: 186 LREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKS 244
            R  +  G++ L      A E   G K      W      ++ G +  ++V  PLDVIK+
Sbjct: 177 AR--NAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKT 234

Query: 245 VMQTDNLKSPKYGNSI 260
            +Q  +  +P+ G  I
Sbjct: 235 RIQNRHFDNPESGFRI 250

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 8/190 (4%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
            + EF       D ++       + ++   AG+  GI ++++  P D  K++ QT+    
Sbjct: 95  FANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPEAF 153

Query: 61  TAMEVIRKLLKNEGPKGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
                + K+LK+EG    Y+G   T         +L FG N   K +       S +   
Sbjct: 154 KGRGFL-KILKDEGIFNLYRGWGWTAARNAPGSFAL-FGGNAFAKEYILGLQDYSQA--- 208

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMR 179
           +  Q +I  + G   +  +++P++ ++ R+Q +    P   FK   + ++       F +
Sbjct: 209 TWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKN-EGFTAFFK 267

Query: 180 GLTPTMLREG 189
           GLTP +L  G
Sbjct: 268 GLTPKLLTTG 277

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 109/254 (42%), Gaps = 31/254 (12%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP-TTAMEVIRKLLKNEGPKGFYKG--T 82
           +  LL   + GI ++ V  P DT   RL ++ T  T+  ++   + ++   + F K   T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFT 70

Query: 83  LTPLIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
           L P +G  A   +     ++G        +N+  K+ F S   D T + L   +    G 
Sbjct: 71  LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKAL---RSATAGS 127

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF--MRGLTPTMLR 187
             GI    L  P++ ++I+ QT   +     FKG    ++ L+ +G F   RG   T  R
Sbjct: 128 LIGIGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFLKILKDEGIFNLYRGWGWTAAR 180

Query: 188 EGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKSVM 246
             +  G++ L      A E   G +      W      ++ G +  ++V  PLDVIK+ +
Sbjct: 181 --NAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRI 238

Query: 247 QTDNLKSPKYGNSI 260
           Q  N  +P+ G  I
Sbjct: 239 QNRNFDNPESGFKI 252

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKGFYKGTLT 84
           ++ ++   G  A ++V  P D  K R+Q  +   P +  ++++  LKNEG   F+KG   
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 85  PLIGVGACVSLQFGVNEAM 103
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Kwal_27.12481
          Length = 304

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 76/175 (43%), Gaps = 20/175 (11%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVIRKLLKNEGPKGFYKGT 82
           G AGG++ + V    D  + RL   S              ++V +K L ++G  G Y+G 
Sbjct: 122 GAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142
           L  ++G+     L FG  +++K    + + + +     L  + +   TG  T S+   P+
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVT--TGASTASY---PL 235

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
           + VR R+     SG  V++ G  D  RK+ A  G     +G    +LR   G G 
Sbjct: 236 DTVRRRMMMT--SGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 104/274 (37%), Gaps = 31/274 (11%)

Query: 14  LENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST----------PTTAM 63
           + +  K  N  V  D L G            P +  K+ +Q               T   
Sbjct: 1   MADSKKQSNFAV--DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIG 58

Query: 64  EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ 123
           E  ++   NEG   F++G    +I      +L F   + +K  F  +  +  ++  +   
Sbjct: 59  ECFKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFA-GN 117

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKLRAQ---GGF 177
               G  GG++  F+ S +++ R RL   +     G   +F G +D  +K  A     G 
Sbjct: 118 LASGGAAGGLSLMFVYS-LDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 178 MRGLTPTMLREGHGCGTYFLVYEAM----VANEINKGFKRTEVPAWKLCLFGALSGTTLW 233
            RG  P+++      G YF  Y+++    +   +   F  + +  W +   GA + +   
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTT-GASTAS--- 232

Query: 234 MMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
              YPLD ++  M   + ++ KY  +  +  K +
Sbjct: 233 ---YPLDTVRRRMMMTSGQAVKYNGAFDAFRKIV 263

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 90/234 (38%), Gaps = 27/234 (11%)

Query: 21  DNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYK 80
           D+   I  L++G A G +  L   P DT K RLQ                 N G KG Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF-------FHSRNPDSTSQILSLPQYYICGLTGGI 133
           G  + ++      SL F   ++MK +          +  D T+  LS   + +    G I
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLS---HMVSSSFGEI 108

Query: 134 TNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTMLREGH 190
           +   +  P E ++ R QT      N   +     +R    +G      RG + T++RE  
Sbjct: 109 SACMVRVPAEVIKQRTQTHR---TNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIP 165

Query: 191 GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244
                F +YE M         K    P W+  + G ++G        PLDV+K+
Sbjct: 166 FTCIQFPLYEYMKKRWAEVQGKERAAP-WQGSVCGCIAGGIAAAATTPLDVLKT 218

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           P D  K R+       +A+ + + +L+ EG K F+ G     + + A  ++  GV E + 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 105 RFF 107
             F
Sbjct: 272 SLF 274

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 42/151 (27%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           ++V +K L ++G  G Y+G L  ++G+     L FG+ +++K                  
Sbjct: 161 VDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLL--------------- 205

Query: 123 QYYICGLTGGITNSFLAS----------------PIEHVRIRLQTQTGSGPNVEFKGPLD 166
                 LTG + NSFLAS                P++ VR R+     SG  V++ G  D
Sbjct: 206 ------LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMT--SGQAVKYDGAFD 257

Query: 167 CIRKLRAQGG---FMRGLTPTMLREGHGCGT 194
             RK+ A  G     +G    +LR   G G 
Sbjct: 258 AFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 94/218 (43%), Gaps = 19/218 (8%)

Query: 60  TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
           T  +E  ++   +EG   F++G    +I      +L F   + +K  F  +  +  ++  
Sbjct: 55  TGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWF 114

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKLRAQ-- 174
           +       GL GG++  F+ S +++ R RL   + S   G   +F G +D  +K  A   
Sbjct: 115 A-GNLASGGLAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDG 172

Query: 175 -GGFMRGLTPTMLREGHGCGTYFLVYEAM----VANEINKGFKRTEVPAWKLCLFGALSG 229
             G  RG  P+++      G YF +Y+++    +   +   F  + +  W +   GA + 
Sbjct: 173 VAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTT-GASTA 231

Query: 230 TTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTL 267
           +      YPLD ++  M   + ++ KY  +  +  K +
Sbjct: 232 S------YPLDTVRRRMMMTSGQAVKYDGAFDAFRKIV 263

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 106/248 (42%), Gaps = 31/248 (12%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP-TTAMEVIRKLLKNE--GPKGFYKGTLTP 85
           LL   + GI ++ V  P DT   RL ++ T  T+  E+ R + ++    P G    TL P
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFP 73

Query: 86  LIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGG 132
            +G  A   +     ++G        +N+  K+ F +   + T + +   +    G   G
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM---RSAAAGSLIG 130

Query: 133 ITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF--MRGLTPTMLREGH 190
           I    L  P++ ++I+ QT   S     FKG    I+ LR +G F   RG   T  R  +
Sbjct: 131 IGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILRDEGLFNLYRGWGWTAAR--N 181

Query: 191 GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKSVMQTD 249
             G++ L      A E   G K      W      ++ G    ++V  PLDVIK+ +Q  
Sbjct: 182 APGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNR 241

Query: 250 NLKSPKYG 257
           N  +P+ G
Sbjct: 242 NFDNPESG 249

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKG 77
           +  A   ++ ++   G  + ++V  P D  K R+Q  +   P + + +++  LKNEG   
Sbjct: 205 YSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTA 264

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAM 103
           F+KG    L+  G  +   F + +++
Sbjct: 265 FFKGLTPKLLTTGPKLVFSFALAQSL 290

>Scas_328.1
          Length = 227

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           ++V +K L  +G  G Y+G L  ++G+     L FG+ +++K    + + ++      LP
Sbjct: 83  LDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENA----FLP 138

Query: 123 QYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG 176
             ++ G    I+ S  + P++ VR R+     SG  V++KG +DC +++ +Q G
Sbjct: 139 S-FLLGWAVTISASTTSYPLDTVRRRMMMT--SGQAVKYKGAIDCFQQIVSQEG 189

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 94/250 (37%), Gaps = 14/250 (5%)

Query: 69  LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICG 128
           L +  G + FY G    +I V    +++FG  E  KR          +  LS    Y+ G
Sbjct: 243 LYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAG 302

Query: 129 LTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG---FMRGLTPTM 185
             GGI   F   PI+ ++ R+Q              +   + +  +GG   F RGL   +
Sbjct: 303 GLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGI 362

Query: 186 L----REGHGCGTYFLVYEAMVANEINK-GFKRTEVPAWKLCLF--GALSGTTLWMMVYP 238
           L          GT+  +    +    N  G    EV    L +   GA SGT    +VYP
Sbjct: 363 LGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYP 422

Query: 239 LDVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFAT 297
           ++++++ +Q       P   +    V +                PT+ +  PA   ++  
Sbjct: 423 INLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLC 482

Query: 298 FE---LAMRL 304
           +E    AMRL
Sbjct: 483 YENLKRAMRL 492

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 95/259 (36%), Gaps = 24/259 (9%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARV-IKDLLAGTAGGIAQVLVGQPFDTTKVR--LQTSS 57
           M+    +PQL    E+H +   A   +  ++AG+  G+    V  P DT K+R  LQ +S
Sbjct: 1   MAASSGSPQLAT--EDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS 58

Query: 58  TPTT--AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDST 115
                  +   R + + EG +  +KG +          SLQFG    +       N  + 
Sbjct: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWL-------NTAAA 111

Query: 116 SQILSLPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRA 173
           S  L  PQ +    G   G+ +S L  P++ +R RL     S      +     I     
Sbjct: 112 SAGLP-PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR-SAHFFSLRRQARVIWDTEG 169

Query: 174 QGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLW 233
             GF RG    +       G  F +YE         G        W        +G    
Sbjct: 170 PAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYGLP------WLAAAASPTAGLVSK 223

Query: 234 MMVYPLDVIKSVMQTDNLK 252
             V+PLD ++  +Q  + K
Sbjct: 224 AAVFPLDTVRRRLQIVDAK 242

>Scas_562.12
          Length = 300

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 81/192 (42%), Gaps = 12/192 (6%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
            + EF       D ++       + ++   AG+  GI ++++  P D  K++ QT+    
Sbjct: 95  FANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPEAF 153

Query: 61  TAMEVIRKLLKNEGPKGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
                + K+LK+EG    Y+G   T         +L FG N   K +       S +   
Sbjct: 154 KGRGFV-KILKDEGIFNLYRGWGWTAARNAPGSFAL-FGGNAFAKEYILGLEDYSQA--- 208

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG--GF 177
           S  Q +I  + G   +  +++P++ ++ R+Q ++   P     G        + +G   F
Sbjct: 209 SWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPET---GLTIVKNTFKNEGITAF 265

Query: 178 MRGLTPTMLREG 189
            +GLTP +L  G
Sbjct: 266 FKGLTPKLLTTG 277

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKG 77
           +  A   ++ ++   G    ++V  P D  K R+Q  S   P T + +++   KNEG   
Sbjct: 205 YSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITA 264

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAM 103
           F+KG    L+  G  +   F + +++
Sbjct: 265 FFKGLTPKLLTTGPKLVFSFALAQSL 290

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 108/254 (42%), Gaps = 31/254 (12%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEG---PKGFYKGT 82
           +  LL   + GI ++ V  P DT   RL ++ T       + +++  E    P G    T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFT 70

Query: 83  LTPLIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYICGL 129
           L P +G  A   +     ++G        +N+  K+ F S   + T + +   +    G 
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAM---RSATAGS 127

Query: 130 TGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF--MRGLTPTMLR 187
             GI    L  P++ ++I+ QT   +     FKG    ++ L+ +G F   RG   T  R
Sbjct: 128 LIGIGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGIFNLYRGWGWTAAR 180

Query: 188 EGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKSVM 246
             +  G++ L      A E   G +     +W      ++ G +  ++V  PLDVIK+ +
Sbjct: 181 --NAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRI 238

Query: 247 QTDNLKSPKYGNSI 260
           Q  +  +P+ G +I
Sbjct: 239 QNRSFDNPETGLTI 252

>Kwal_26.7972
          Length = 358

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 106/266 (39%), Gaps = 53/266 (19%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSS-----TPTTAMEVIR---KLLKNEGPKGFYK 80
           L  G AG  A+ L+  P D  K+  QTS+        + M +IR    +  ++G +GFY+
Sbjct: 32  LAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF-FHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           G    LI +    +++F   E ++ F   S+  ++ ++ L+       G   G+ + F+ 
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLA------SGSMAGLCSVFMT 144

Query: 140 SPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG----------------FMRGLTP 183
            P++ +R+RL   T     ++    +  I   RA                   F RG TP
Sbjct: 145 YPLDLIRVRLAYVTDRS-RIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTP 203

Query: 184 TMLREGHGCGTYFLVYEAM----------------VANE--INKGFKRTEVP--AWKLCL 223
           T+L      G  F  ++                  +++E    +  K++  P   W   +
Sbjct: 204 TVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELV 263

Query: 224 FGALSGTTLWMMVYPLDVIKSVMQTD 249
            G L+G       YP ++I+  +Q  
Sbjct: 264 AGGLAGMASQTASYPFEIIRRRLQVS 289

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 19/114 (16%)

Query: 12  DDLENHPKHDNARVIK---DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM----- 63
           ++L    K  ++R +K   +L+AG   G+A      PF+  + RLQ S    T++     
Sbjct: 242 EELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQT 301

Query: 64  --EVIRKLLKNEGPKGFYKG------TLTPLIGVGACVSLQFGVNEAMKRFFHS 109
             ++IR + K  G +GF+ G       +TP++   AC   +   NE +  +  +
Sbjct: 302 IPDMIRIIYKERGWRGFFVGLSIGYIKVTPMV---ACSFFRLRKNEVVSEYLRT 352

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 19/145 (13%)

Query: 112 PDSTSQILSLPQYYI--CGLTGGITNSF---LASPIEHVRIRLQTQTGSGPN-VEFKGP- 164
           P     +     +YI   GL GGI  S    L +P++ ++I  QT   S P+ +++ G  
Sbjct: 13  PSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQT---SNPHYLKYSGST 69

Query: 165 LDCIR---KLRAQGG---FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPA 218
           +  IR    + A  G   F +G + T++R        F+ YE +    I    K  E  A
Sbjct: 70  MGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPS--KEYETHA 127

Query: 219 WKLCLFGALSGTTLWMMVYPLDVIK 243
            +L   G+++G     M YPLD+I+
Sbjct: 128 RRLAS-GSMAGLCSVFMTYPLDLIR 151

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 200 EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259
           ++MV ++     KR+     +  L G ++G+    ++ PLD IK + QT N    KY  S
Sbjct: 9   DSMVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGS 68

>Kwal_23.3042
          Length = 542

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 112/309 (36%), Gaps = 41/309 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSSTPTTAMEVIRK---------------- 68
            +AG   G+       PFD  KV    R   SST   + ++I +                
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 69  ----LLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQY 124
               L +  G + FY G     + V    +++FG  E  KR          +  LS    
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 125 YICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP---LDCIRKLRAQGG---FM 178
           Y+ G  GG+       PI+ ++ R+Q    +  N E KG    +   + +  +GG   F 
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQC---APLNTESKGRQLLISTAKDMYKEGGLRIFY 404

Query: 179 RGLTPTML----REGHGCGTYFLVYEAMVANEIN-KGFKRTEVPAWKL--CLFGALSGTT 231
           RG+T  ++          GT+  + +  +A +    G    +V    +   L GA SGT 
Sbjct: 405 RGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTV 464

Query: 232 LWMMVYPLDVIKSVMQTD-NLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPA 290
               VYP++++++ +Q       P   N    V                  P + +  PA
Sbjct: 465 GATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPA 524

Query: 291 NGATFATFE 299
              ++  +E
Sbjct: 525 VSISYLCYE 533

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------EVIRKLLKNEGPKGFYKGT 82
           LL G   G        P +  + RLQ   T           +V+ K ++ EG +G +KG 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 83  LTPLIGVGACVSLQFGVNEAMKR 105
           +  L  V   VS+ +   E +KR
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKR 537

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 108/256 (42%), Gaps = 34/256 (13%)

Query: 23  ARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNE---GPKGFY 79
           ARV+       + GI ++ V  P DT   RL ++ T  T  + +  ++  E    P G  
Sbjct: 11  ARVV----GSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFGQR 66

Query: 80  KGTLTPLIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYI 126
             TL P +G  A   +     ++G        +N+  K  F     + T + L   +   
Sbjct: 67  LFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKAL---RSAT 123

Query: 127 CGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-GFMRGLTPTM 185
            G   GI    L  P++ ++I+ QT   S     F+G    +R LR +G G  RG   T 
Sbjct: 124 AGSLIGIGEIVLL-PLDVLKIKRQTNPES-----FRGR-GFLRILRDEGMGLYRGWGWTA 176

Query: 186 LREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKS 244
            R  +  G++ L      A E   G K      W      ++ G +  ++V  PLDVIK+
Sbjct: 177 AR--NAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKT 234

Query: 245 VMQTDNLKSPKYGNSI 260
            +Q+ N +S + G +I
Sbjct: 235 RIQSRNFESAESGFTI 250

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKGFYKGTLT 84
           ++ ++   G  A ++V  P D  K R+Q+ +  +  +   +++  LKNEG   F+KG   
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTP 269

Query: 85  PLIGVGACVSLQFGVNEAM 103
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFAIAQTL 288

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 82/220 (37%), Gaps = 12/220 (5%)

Query: 18  PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--IRKLLKNEGP 75
           P++  +  +K  LAG  G  +      P D  K R+Q   T      V   ++++  EG 
Sbjct: 10  PQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGA 69

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
                G    L+G     + +FG  E  K+FF       T+       Y           
Sbjct: 70  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLA 129

Query: 136 SFLASPIEHVRIRL--QTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCG 193
                P+E  RIRL  Q Q  +G      G    I K    G F  G TP + ++     
Sbjct: 130 DIALCPLEATRIRLVSQPQFANG----LVGGFSRILKEEGIGSFYSGFTPILFKQIPYNI 185

Query: 194 TYFLVYEAMVANEINKGFK--RTEVPAWKLCLFGALSGTT 231
             FLV+E   A+E   GF   + ++ +    L   LSG T
Sbjct: 186 AKFLVFER--ASEFYYGFAGPKEKLSSTSTTLLNLLSGLT 223

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L K  G  G + G  T 
Sbjct: 217 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTR 276

Query: 86  LIGVGACVSLQFGVNEAMK 104
           L+ VG   SLQFG+  ++K
Sbjct: 277 LVMVGTLTSLQFGIYGSLK 295

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKGFYKGTLT 84
           ++ ++   G  A ++V  P D  K R+Q  +   P +  ++I+  LKNEG   F+KG   
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTP 270

Query: 85  PLIGVGACVSLQFGVNEAM 103
            L+  G  +   F + + +
Sbjct: 271 KLLTTGPKLVFSFALAQTL 289

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 83/193 (43%), Gaps = 15/193 (7%)

Query: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
            + EF       D +        + ++   AG+  GI ++++  P D  K++ QT+    
Sbjct: 95  FANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESF 153

Query: 61  TAMEVIRKLLKNEGPKGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQIL 119
                + K++K+EG  G Y+G   T         +L FG N   K +         +   
Sbjct: 154 KGRGFL-KIIKDEGF-GLYRGWGWTAARNAPGSFAL-FGGNAFAKEYILGLKDYGQA--- 207

Query: 120 SLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--G 176
           +  Q ++  + G   +  +++P++ ++ R+Q +    P   FK     I+  L+ +G   
Sbjct: 208 TWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK----IIKNTLKNEGFTA 263

Query: 177 FMRGLTPTMLREG 189
           F +GLTP +L  G
Sbjct: 264 FFKGLTPKLLTTG 276

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 104/251 (41%), Gaps = 32/251 (12%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME----VIRKLLKNEGPKGFYKGTLT 84
           +L   + GI ++ V  P DT   RL ++ T   +      VI +   +E P G    +L 
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASE-PLGRRLLSLF 72

Query: 85  PLIGVGACVSL-----QFG--------VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTG 131
           P +G  A   +     ++G        +N+  K  F     + T + L   +    G   
Sbjct: 73  PGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKAL---RSATAGSLI 129

Query: 132 GITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-GFMRGLTPTMLREGH 190
           GI    L  P++ ++I+ QT   S     FKG    ++ ++ +G G  RG   T  R  +
Sbjct: 130 GIGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFLKIIKDEGFGLYRGWGWTAAR--N 180

Query: 191 GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKSVMQTD 249
             G++ L      A E   G K      W      ++ G +  ++V  PLDVIK+ +Q  
Sbjct: 181 APGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNR 240

Query: 250 NLKSPKYGNSI 260
           N  +P+ G  I
Sbjct: 241 NFDNPESGFKI 251

>Kwal_47.19228
          Length = 281

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 70/144 (48%), Gaps = 18/144 (12%)

Query: 63  MEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           +  ++++ ++ G +GF +GT+  +I   +  +++F    ++K+      P        L 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKP--------LN 183

Query: 123 QYYICGLTGGITNSFLAS---PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG--- 176
           +YY   L G I++  + +   PI+ ++ R+Q++        +K  L+C  ++  + G   
Sbjct: 184 EYYAFAL-GFISSCAVVAVTQPIDVIKTRMQSKYTWS---NYKNSLNCAYRIFVEEGFTK 239

Query: 177 FMRGLTPTMLREGHGCGTYFLVYE 200
           F +G  P +++ G   G  F VY+
Sbjct: 240 FWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 68/162 (41%), Gaps = 6/162 (3%)

Query: 144 HVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMV 203
           H R +        P+ +F   +  I + R   GF++G  PT++R+       F  Y ++ 
Sbjct: 114 HPRQKWALYYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL- 172

Query: 204 ANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSV 263
              I+      E  A+ L   G +S   +  +  P+DVIK+ MQ+    S  Y NS+ + 
Sbjct: 173 KQMISPNKPLNEYYAFAL---GFISSCAVVAVTQPIDVIKTRMQSKYTWS-NYKNSL-NC 227

Query: 264 AKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           A  ++             P +++   + G +F  ++    L+
Sbjct: 228 AYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 3/83 (3%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           G     A V V QP D  K R+Q   T S    ++    ++   EG   F+KG    L+ 
Sbjct: 191 GFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 250

Query: 89  VGACVSLQFGVNEAMKRFFHSRN 111
           VG    + FGV + +     + N
Sbjct: 251 VGLSGGVSFGVYQYVDNLMKAVN 273

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L K  G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 69/190 (36%), Gaps = 14/190 (7%)

Query: 18  PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVIRKLLKNEGP 75
           P +  +   K  LAG  G         P D  K R+Q   T      +   ++++ +EG 
Sbjct: 6   PDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGA 65

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
                G    L+G     S +FG  E  K+ F   +     Q ++       G +  I  
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLF--IDVLGYDQAVNYKNSIYIG-SAAIAE 122

Query: 136 SF---LASPIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
            F      P+E  RIRL +Q    P       G    I K    G F  G TP + ++  
Sbjct: 123 FFADIALCPLEATRIRLVSQ----PTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIP 178

Query: 191 GCGTYFLVYE 200
                FLV+E
Sbjct: 179 YNIAKFLVFE 188

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 21/173 (12%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTK-----VRLQTSSTPT----TAMEVIRKLLKNEGPKGFY 79
           +L G +GG+AQ  +   F T        R + +S P     ++++V +++   EG +G  
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 80  KGT----LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
           KG     +  +   G+   L   V + ++R  H R+ +  S   ++ +     L GG+  
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLS---AMEKIVASALGGGL-- 225

Query: 136 SFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKLRAQGGFMRGLTPTM 185
           S    PIE +R+ +Q++T       N+        I +     G  RG+TP +
Sbjct: 226 SAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI 278

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 66/187 (35%), Gaps = 8/187 (4%)

Query: 18  PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--IRKLLKNEGP 75
           P++  +   K  LAG  G  +      P D  K R+Q   T      V   RK++  EG 
Sbjct: 6   PQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGA 65

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
                G    L+G     + +FG  E  K+FF       T+       Y           
Sbjct: 66  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLA 125

Query: 136 SFLASPIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCG 193
                P+E  RIRL +Q    P       G    I K    G F  G TP + ++     
Sbjct: 126 DIALCPLEATRIRLVSQ----PTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNI 181

Query: 194 TYFLVYE 200
             FLV+E
Sbjct: 182 AKFLVFE 188

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV   + +   + + ++ +L K  G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+   +K+
Sbjct: 273 LVMVGTLTSLQFGIYGQLKK 292

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 98/236 (41%), Gaps = 28/236 (11%)

Query: 45  PFDTTKVRLQTS-STPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAM 103
           P D  K RLQ +    T+ ++  RK++ NEG K  Y G     +G     + ++G  E  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97

Query: 104 KRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFK 162
           K  + S  +P  T        Y +   T       +  P E ++++ QT      N    
Sbjct: 98  KHLYSSWLSPGVTV-------YLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN---- 146

Query: 163 GPLDCIRKLRAQGG----FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGF--KRTEV 216
             +D  +K+ A+ G    F +G+ P   R+       F  +E +V  +I      K+ E+
Sbjct: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV-QKIYSVLPKKKEEM 205

Query: 217 PAWKLC----LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLY 268
            A +      + G L+G     + +P DV+ S + ++     K   S+S  +K +Y
Sbjct: 206 NALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIY 257

>Kwal_33.15597
          Length = 305

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L K  G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 69/190 (36%), Gaps = 14/190 (7%)

Query: 18  PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVIRKLLKNEGP 75
           P++  +   K  LAG  G         P D  K R+Q   T      +   ++++ +EG 
Sbjct: 6   PQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGA 65

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
                G    L+G     S +FG  E  K+ F   +     Q ++       G +  I  
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFI--DTLGYDQAVNYKNSIYIG-SAAIAE 122

Query: 136 SF---LASPIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
            F      P+E  RIRL +Q    P       G    I K      F  G TP + ++  
Sbjct: 123 FFADIALCPLEATRIRLVSQ----PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIP 178

Query: 191 GCGTYFLVYE 200
                FLV+E
Sbjct: 179 YNIAKFLVFE 188

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 80/185 (43%), Gaps = 26/185 (14%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKG----TLT 84
           L+ G  GG+   +V QPFD  K RLQ  +  TT    ++++     PK  ++G    +L 
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQ-QNKDTTLWGTLKEI---RSPKQLWRGALPSSLR 66

Query: 85  PLIGVGACVSLQFGVNEAM-KRFFHSRNPDSTSQILSLPQY--YICGLTGGITN---SFL 138
             IG    +S       AM K    + NP S+     LPQ   Y    +G  T     F+
Sbjct: 67  TSIGSALYLSTLNVFRTAMAKGKTQTLNPGSS----FLPQLTMYENLASGAFTRGVVGFI 122

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTMLREGHGCGTY 195
             PI  +++R ++   S     +K   +  R + +     GF  G   T++R+    G Y
Sbjct: 123 TMPITIIKVRYESTMYS-----YKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLY 177

Query: 196 FLVYE 200
            L+YE
Sbjct: 178 VLLYE 182

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 6/145 (4%)

Query: 53  LQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI-GVGACVSLQFGVNEAMKRFFHSRN 111
           LQ +ST     + I K+ K EG +G Y+G  T ++ G     S  F  +   K +F  + 
Sbjct: 73  LQYNST----FDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKL 128

Query: 112 PDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTG-SGPNVEFKGPLDCIRK 170
            +  +   +  +  + G+    T+    +PI  +  R QT+ G  G N       +  ++
Sbjct: 129 INRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKE 188

Query: 171 LRAQGGFMRGLTPTMLREGHGCGTY 195
            R+  GF +GL  +++   +   TY
Sbjct: 189 QRSIKGFWKGLKVSLMLTINPSITY 213

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVIRKLLKNEGPKG 77
           +  A   ++ ++   G  A +++  P D  K R+Q  +   P +   +++  LKNEG   
Sbjct: 203 YSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSA 262

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAM 103
           F+KG    L+  G  +   F + + +
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFALAQTL 288

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 104/247 (42%), Gaps = 24/247 (9%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEG---PKGFYKGTLTP 85
           +L   + GI ++ V  P DT   RL ++ T   +   +  ++  E    P      TL P
Sbjct: 13  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFP 72

Query: 86  LIGVGACVSL-----QFG----VNEAMKRFFHSRNPDSTSQILSLP-QYYICGLTGGITN 135
            +G  A   +     ++G     NE + R F +   ++  +      +    G   GI  
Sbjct: 73  GLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIGE 132

Query: 136 SFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-GFMRGLTPTMLREGHGCGT 194
             L  P++ ++I+ QT   +     FKG    ++ L+ +G G  RG   T  R  +  G+
Sbjct: 133 IVLL-PLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGLGLYRGWGWTAAR--NAPGS 183

Query: 195 YFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVY-PLDVIKSVMQTDNLKS 253
           + L      A E   G K      W      ++ G +  +++  PLDVIK+ +Q  N ++
Sbjct: 184 FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFEN 243

Query: 254 PKYGNSI 260
           P+ G +I
Sbjct: 244 PESGFTI 250

>Scas_715.45
          Length = 305

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (44%), Gaps = 28/210 (13%)

Query: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAMEVI 66
            L+ D     K+  +  I  L + TA   A +++  PF+  KV+ QT+  P     +E  
Sbjct: 102 HLVKDEATAYKYRTS--IYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGW 158

Query: 67  RKLLKNEGPKGFYKGTLTPL----IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122
           +K+   EG  GFYKG +TPL    I    C   +F   E +    ++R P   S++ +L 
Sbjct: 159 KKMYAKEGLNGFYKG-ITPLWCRQIPYTMC---KFTSFERIVEAIYARLPTKKSEMSALQ 214

Query: 123 QY---YICGLTGGITNSFLASPIEHV--RIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF 177
           Q    ++ G   GI  + ++ P + +  +I  + +     NV  K       ++ ++ GF
Sbjct: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALK-------RIYSRIGF 267

Query: 178 M---RGLTPTMLREGHGCGTYFLVYEAMVA 204
           +    GL   +L  G      +L+Y++  A
Sbjct: 268 VGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 99/252 (39%), Gaps = 26/252 (10%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVI---RKLLKNEG-PKGFYKGTLT 84
           +++G  GG          DT K R Q +        +I   R +   EG  +G Y G + 
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMA 116

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144
            ++G     ++ FG  E  KR           QI     +   G  G   +SF+  P E 
Sbjct: 117 AMLGSFPSAAIFFGTYEYTKRTM-----IEDWQINDTITHLSAGFLGDFISSFVYVPSEV 171

Query: 145 VRIRLQTQT-------GSGPNVEFKGPLDCIRKLRAQGGFMR---GLTPTMLREGHGCGT 194
           ++ RLQ Q         SG N  +    + I+ +  + GF     G   T+ R+      
Sbjct: 172 LKTRLQLQGRFNNPFFQSGYN--YSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSAL 229

Query: 195 YFLVYEAM--VANEINKGFKRT-EVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251
            F  YE    +A +I +   R  E+      L GA +G    ++  P+DV+K+ +QT   
Sbjct: 230 QFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQ-- 287

Query: 252 KSPKYGNSISSV 263
           + P   N   SV
Sbjct: 288 QPPSQSNKSYSV 299

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 53/139 (38%), Gaps = 12/139 (8%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----------TSSTPTTAMEVIRKLLKNEG 74
           I  L AG  G      V  P +  K RLQ           +    +     I+ ++K EG
Sbjct: 149 ITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEG 208

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKRF-FHSRNPDSTSQILSLPQYYICGLTGGI 133
            +  + G    L       +LQF   E  ++  F     D     LS+P   + G   G 
Sbjct: 209 FRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGG 268

Query: 134 TNSFLASPIEHVRIRLQTQ 152
               + +P++ V+ R+QTQ
Sbjct: 269 LAGIITTPMDVVKTRVQTQ 287

>Scas_669.6
          Length = 373

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 53/139 (38%), Gaps = 12/139 (8%)

Query: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----------TSSTPTTAMEVIRKLLKNEG 74
           +  L AG  G      V  P +  K RLQ           +     +    IR ++  EG
Sbjct: 147 VSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEG 206

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGI 133
            K  + G    L       +LQFG  E  ++  F     D T   LS+P     G   G 
Sbjct: 207 VKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGG 266

Query: 134 TNSFLASPIEHVRIRLQTQ 152
               + +P++ ++ RLQTQ
Sbjct: 267 LAGIITTPMDVIKTRLQTQ 285

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 93/233 (39%), Gaps = 46/233 (19%)

Query: 44  QPFDTTKVRLQTSS-TP-----TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQF 97
              DT K R Q +  TP     TTA   I   L+    +G Y G    ++G     ++ F
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKNMTTAYRTI--FLEEGIARGLYGGYFAAMLGSFPSAAIFF 127

Query: 98  GVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSG 156
           G  E  KR        + T   LS       GL G   +SF+  P E ++ RLQ Q G  
Sbjct: 128 GTYEWCKRKMIGDLGFNDTVSHLS------AGLLGDFVSSFVYVPSEVLKTRLQLQ-GRV 180

Query: 157 PNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEI-----NKGF 211
            N  F+   +  R LR     +R +  T      G    F  Y+A +A ++       GF
Sbjct: 181 NNPFFQSGYNY-RSLRTA---IRIIVNT-----EGVKALFFGYKATLARDLPFSALQFGF 231

Query: 212 -KRTEVPAWKL---------------CLFGALSGTTLWMMVYPLDVIKSVMQT 248
            ++    A+KL                  GA++G    ++  P+DVIK+ +QT
Sbjct: 232 YEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQT 284

>Kwal_27.11419
          Length = 298

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 102/246 (41%), Gaps = 36/246 (14%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI- 87
            + G  GG+   ++ QPFD  K RLQ + + +  ++V+R +   E P   +KGTL   + 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKS-SNLLDVVRSI---ETPGQLWKGTLPSALR 66

Query: 88  -GVGACVSLQF--GVNEAM--KRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS-- 140
             VG+ + L     V  A+  KR       + +S  L     Y   ++G IT + +    
Sbjct: 67  TSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT 126

Query: 141 -PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGTYF 196
            PI  +++R ++         +K   +    + R++G  G   G   T++R+    G Y 
Sbjct: 127 MPITVLKVRFESTM-----YNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYV 181

Query: 197 LVYEA------------MVA-NEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK 243
           L YE             MV  NE      +T      +  F + S  T   +  P D IK
Sbjct: 182 LFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLAT--TITSPFDTIK 239

Query: 244 SVMQTD 249
           + MQ +
Sbjct: 240 TRMQLN 245

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 74/188 (39%), Gaps = 24/188 (12%)

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
           ++I G  GG+T++ +  P + ++ RLQ    S         LD +R +   G   +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSS-------NLLDVVRSIETPGQLWKGTLP 62

Query: 184 TMLREGHGCGTYFL---VYEAMVANEINKGFKRT--------EVPAWKLCLFGALSGTTL 232
           + LR   G   +     +  + +A++  KG            ++  ++  + GA++   +
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 233 WMMVYPLDVIKSVMQTDNLKSPKYG-NSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPAN 291
            +   P+ V+K        +S  Y   S+   A  +Y              T++R AP  
Sbjct: 123 GVATMPITVLKV-----RFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYA 177

Query: 292 GATFATFE 299
           G     +E
Sbjct: 178 GLYVLFYE 185

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 25  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-MEVIRKLLKNEGPKGFYKGTL 83
           +I  + A ++  +A  +   PFDT K R+Q + +     ++  + +++ E P+  + G  
Sbjct: 215 IINSIAAFSSASLATTIT-SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLS 273

Query: 84  TPLIGVGACVSLQFGVNEAMKRFF 107
             L        + +G+ E + + F
Sbjct: 274 LRLSRKALSAGIAWGIYEELVKKF 297

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 23  ARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVIRKLLKNEG 74
           A + K  +   +GG+AQ LV  PFD  + R Q  +     +        + +  + K EG
Sbjct: 9   ANLYKLAMGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEG 67

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
           PKG+YKG    L  V    ++ + V E ++ 
Sbjct: 68  PKGYYKGLTANLFKVIPSTAVSWLVYEVIRE 98

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 4/112 (3%)

Query: 139 ASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLV 198
           A P++    R        P+  F G +  I + R   GF++G  PT+ R+       F  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 199 YEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDN 250
           Y A +   ++      E  A+     GALS   +  +  P+DVIK+ MQ+  
Sbjct: 233 Y-AWIVQSLSPHKALDEYQAFAA---GALSSAAVVALTQPIDVIKTRMQSKT 280

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 10  LIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS---TPTTAMEVI 66
           ++  L  H   D     +   AG     A V + QP D  K R+Q+ +   T  +++   
Sbjct: 236 IVQSLSPHKALDE---YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCA 292

Query: 67  RKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
            ++   EG +  +KG +  L  V     + FGV + ++
Sbjct: 293 YRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 73/178 (41%), Gaps = 20/178 (11%)

Query: 45  PFDTTKVRLQ-----TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGV 99
           P    K R+Q      + T   + + ++ +L+NEG  G Y+G     +G    + LQ+ +
Sbjct: 199 PIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGI-LQWLL 257

Query: 100 NEAMKRFFHSRN------PDSTSQILSLPQYYICGLTGGI-TNSFLAS----PIEHVRIR 148
            E +K     R+       D ++   +      C  +GG     F+AS    P E VR R
Sbjct: 258 YEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTR 317

Query: 149 LQTQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVYEAMV 203
           L+        V++ G +   R +  + G      GLTP ++R        F  +E ++
Sbjct: 318 LRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVI 375

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 127/313 (40%), Gaps = 46/313 (14%)

Query: 24  RVIKDLLAGTAGGIAQVLVGQPFDTTKVR-----LQTSSTPTTAMEVIRKLLKNEGPKGF 78
           R+  D+        A+ L+    +TT+ R     LQ ++     + +I  + + EG +  
Sbjct: 83  RLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSL 139

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ-----YYICGLTGGI 133
           +KG    L+GV    S+ F        F +    D  S+  +  Q     + +   T G 
Sbjct: 140 FKGLGPNLVGVIPARSINF--------FTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGW 191

Query: 134 TNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTPTMLREGH 190
             +   +PI  V+ R+Q    +G    +K   DC++  LR +G  G  RGL+ + L    
Sbjct: 192 ATATATNPIWMVKTRVQLDK-AGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

Query: 191 GCGTYFLVYEAMV------------ANEINKGFKRTEVPAWKLCLFGALSGTTLWM---M 235
           G    +L+YE +             A++ +      ++  W  C     +G   +M   +
Sbjct: 251 GI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQW--CQRSGGAGLAKFMASIV 307

Query: 236 VYPLDVIKSVMQTDNLKS--PKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGA 293
            YP +V+++ ++   L++   KY   + S  + +              P ++R  P +  
Sbjct: 308 TYPHEVVRTRLRQSPLENGKVKYTGLVQSF-RVIIKEEGLASMYSGLTPHLMRTVPNSII 366

Query: 294 TFATFELAMRLLG 306
            F T+E+ ++LL 
Sbjct: 367 MFGTWEVVIKLLS 379

>Scas_673.17
          Length = 314

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           +LL+G   G A   V QP DT  +KV     +   + + ++ +L K  G  G + G  T 
Sbjct: 220 NLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTR 279

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           LI VG   SLQF +  ++K 
Sbjct: 280 LIMVGTLTSLQFAIYGSLKN 299

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 75/206 (36%), Gaps = 18/206 (8%)

Query: 13  DLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--IRKLL 70
           D    P +  +   K  LAG  G         P D  K R+Q   T      V   +K++
Sbjct: 8   DAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKII 67

Query: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130
            +EG      G    L+G     + +FG  E  K+     + D+     ++       + 
Sbjct: 68  ADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKL----SIDTIGYENAVHYKNSVYMG 123

Query: 131 GGITNSFLAS----PIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGGFMRGLTPT 184
                 FLA     P+E  RIRL +Q    P       G    I K    G F  G TP 
Sbjct: 124 SAAVAEFLADIALCPLEATRIRLVSQ----PTFANGLVGGFSRILKEEGVGSFYSGFTPI 179

Query: 185 MLREGHGCGTYFLVYEAMVANEINKG 210
           + ++       FLV+E   A+E+  G
Sbjct: 180 LFKQIPYNIAKFLVFER--ASEVYYG 203

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 61/175 (34%), Gaps = 8/175 (4%)

Query: 18  PKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--IRKLLKNEGP 75
           P +  +   K  LAG  G  A      P D  K R+Q      ++  V   RK++  EG 
Sbjct: 8   PNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGA 67

Query: 76  KGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
                G    L+G     + +FG  E  K+ F       T+     P Y           
Sbjct: 68  AALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFA 127

Query: 136 SFLASPIEHVRIRLQTQTGSGPNVE--FKGPLDCIRKLRAQGGFMRGLTPTMLRE 188
                P+E  RIRL +Q    P       G    I K    G F  G TP + ++
Sbjct: 128 DIALCPLEATRIRLVSQ----PTFANGLVGGFARILKEEGIGSFYNGFTPILFKQ 178

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 41  LVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFG 98
           ++ QP DT  +KV     +   +   ++ +L K  G  G + G  T L+ VG   SLQFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 99  VNEAMKR 105
           +   +K+
Sbjct: 288 IYGKLKQ 294

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 131/344 (38%), Gaps = 59/344 (17%)

Query: 12  DDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT---------------- 55
            ++ENHP     +     +AG  GG+A  +V  PFD  K RLQ+                
Sbjct: 42  SEIENHP---TVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISK 98

Query: 56  -SSTPTTAMEVIR-------------KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNE 101
            S+ P +   VI+              + K EG +  +KG    L+GV    S+ F    
Sbjct: 99  GSTRPKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYG 158

Query: 102 AMKRFFHS--RNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNV 159
             K  +     N   T  I     + +   T G   +   +PI  ++ R+Q       +V
Sbjct: 159 TTKDMYAKAFNNGQETPMI-----HLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSV 213

Query: 160 -EFKGPLDCIRK-LRAQG--GFMRGLTPTMLREGHGCGTYFLVYEAM----VANEINK-- 209
            ++K   DC++  +R +G  G  +GL+ + L    G    +L+YE M        I K  
Sbjct: 214 RQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFG 272

Query: 210 ----GFKRTEVPAWKLCLFGALSGTTLW---MMVYPLDVIKSVM-QTDNLKSPKYGNSIS 261
               G K T     + C     +G   +   +  YP +V+++ + QT      +    + 
Sbjct: 273 YQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLV 332

Query: 262 SVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
              K +              P ++R  P +   F T+E+ +RLL
Sbjct: 333 QSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

>Kwal_23.4354
          Length = 343

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 103/274 (37%), Gaps = 24/274 (8%)

Query: 51  VRLQTSSTP-TTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
           VR +TS     +  +   K+ K EG +  ++G    L+       + F   E+++    S
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD--KS 132

Query: 110 RNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPL-DCI 168
           R  D    +  L    +CG    +  +   +P+E  R RLQ+   S P       + D I
Sbjct: 133 RLQDKYPTLNPL----MCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLI 188

Query: 169 RKLRAQ------GGFMRGLTPTMLREGHGCGTYFLVYEAMVAN---EINKGFKRTEVPAW 219
           ++ R +          RGL  T+ R+      Y+  YE   +N   +  K    +    W
Sbjct: 189 KESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNW 248

Query: 220 KLCLF----GALSGTTLWMMVYPLDVIKSVMQTDNLKS---PKYGNSISSVAKTLYXXXX 272
              +     G+  G    ++ +P DV K+ MQ   L S    K   ++      +     
Sbjct: 249 NHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEG 308

Query: 273 XXXXXXXXXPTMLRAAPANGATFATFELAMRLLG 306
                    P +++ AP+     +T+E+  RL  
Sbjct: 309 LAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 8/102 (7%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-------STPTTAM-EVIR 67
           N    +    +   + G+ GG    ++  PFD  K R+Q +         P+  M + + 
Sbjct: 242 NSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLN 301

Query: 68  KLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
           ++ K+EG    Y G +  +I +    ++     E  KR F +
Sbjct: 302 QMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFST 343

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP-------TTAMEVIRKLLKNEGPKGFYK 80
           +LLAG   G+A      PF+  + RLQ  +         T+  E+ + +    G +GF+ 
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFV 352

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF 106
           G     I V   V+  F V E MK +
Sbjct: 353 GLSIGYIKVTPMVACSFFVYERMKWY 378

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 67/331 (20%), Positives = 114/331 (34%), Gaps = 61/331 (18%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGP--------KGFYK 80
           L  G AG  A+ L+  P D  K+  QTS+          + L N G         +G ++
Sbjct: 58  LAGGVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYIC-GLTGGITNSFLA 139
           G    L+ +    +++F   E +      RN    S+        +C G   G+ + F  
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQI------RNVIIPSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 140 SPIEHVRIRLQ--------------TQTGSGPNVEFKGPLDCIRKLRAQG-GFMRGLTPT 184
            P++ +R+RL                Q  S P  E       + K  AQ   F RG  PT
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 185 MLREGHGCGTYFLVYEAM--------------------------VANEINKGFKRTEVPA 218
           ++      G  F  ++                            V  +  +  KR  +  
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNT 290

Query: 219 WKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP---KYGNSISSVAKTLYXXXXXXX 275
           W   L G L+G       YP ++I+  +Q   + +P   K+  S+S +AK ++       
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKF-TSMSEMAKIIFHERGWRG 349

Query: 276 XXXXXXPTMLRAAPANGATFATFELAMRLLG 306
                    ++  P    +F  +E     +G
Sbjct: 350 FFVGLSIGYIKVTPMVACSFFVYERMKWYMG 380

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 128 GLTGGITNSF---LASPIEHVRIRLQTQTGSGPNV-----EFKGPLDCIRKLRAQG---G 176
           GL GG+  S    L +P++ ++I  QT   S P+       F+G L+    + ++    G
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQT---SNPHYVKYAGSFQGLLNAGVHIWSRDRLRG 113

Query: 177 FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMV 236
             +G + T+LR        F+ YE  + N I    K  E    +LC  G+L+G       
Sbjct: 114 VFQGHSATLLRIFPYAAVKFIAYE-QIRNVIIPS-KEYETHFRRLCS-GSLAGLCSVFCT 170

Query: 237 YPLDVIK 243
           YPLD+I+
Sbjct: 171 YPLDLIR 177

>Scas_613.24
          Length = 177

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 12/163 (7%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           L++G  GG++  +  QP D  K R+Q     T    +  K +K+  P  F++GTL   + 
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAI--KDIKD--PIQFWRGTLPSALR 67

Query: 89  VGACVSLQFGVNEAMK-RFFHSRNPDSTSQILSLPQY--YICGLTGGITN---SFLASPI 142
                +L       M+ +  H +   + S+  SLPQ   Y   LTG +      ++  PI
Sbjct: 68  TSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITMPI 127

Query: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTM 185
             +++R ++   S  ++     +  I K+    GF +G  PT+
Sbjct: 128 TILKVRYESTYYSYKSMN--EAIKDIYKMEGISGFFKGFGPTV 168

 Score = 31.2 bits (69), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 124 YYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTP 183
           + + G  GG++++    P++ ++ R+Q   G+      K   D I+       F RG  P
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPIQ-------FWRGTLP 63

Query: 184 TMLREGHGCGTYF 196
           + LR   G   Y 
Sbjct: 64  SALRTSIGSALYL 76

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 54/152 (35%), Gaps = 22/152 (14%)

Query: 45  PFDTTKVRLQTSS------TPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFG 98
           P    K R+Q  +       P      +  L K+ G +G Y+G    L+  G   ++Q  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 99  VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPN 158
           V    K       PD       +  Y +      +      +P +    R+    G    
Sbjct: 197 VYSHAKEALSRHVPD------GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG--- 247

Query: 159 VEFKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
             ++GPLDC+ K   Q GF      + L +GH
Sbjct: 248 -LYRGPLDCLCKTVRQEGF------SALYKGH 272

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 97/243 (39%), Gaps = 26/243 (10%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT-AMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           +AG+ GG A + V  P  T    LQT        +E I+++    G  G++ G  + + G
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 89  VGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIR 148
           +     + +   E   +   +    +T Q LS  +  +     G   +  ++PI     R
Sbjct: 76  MATTNFVYYYFYEWCAK---TARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVANTR 132

Query: 149 LQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEIN 208
           +        +   +  +D + K       + GL P ++   +    Y  VYE +    + 
Sbjct: 133 M--TVAKSNHSTLRTVIDIV-KTDGPLTLLNGLKPALVLVSNPIIQY-TVYEQLKNLVLR 188

Query: 209 KGFKRTEVPAWKLCLFGAL-----SGTTLWMMVYPLDVIKS---VMQTDNLKSPKYGNSI 260
              K+   P+W   L GA+     +GTT     YP   +K+   +MQ D    PK+  S+
Sbjct: 189 LQRKKVLSPSWAF-LLGAIGKLAATGTT-----YPYITLKTRMHLMQND----PKHQKSM 238

Query: 261 SSV 263
            S+
Sbjct: 239 WSL 241

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 11/200 (5%)

Query: 62  AMEVIRKLLKNEGPKGFYKGTLTPLIGVG-ACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120
           A++VI K+ +NEG  G Y G    L+G      S  F      + +F  +     +   S
Sbjct: 90  ALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFS 149

Query: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180
             +  +  +    T+    +PI  V  + QT+ G   +  FK     +       GF + 
Sbjct: 150 TIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFWKS 209

Query: 181 LTPTMLREGHGCGTY--------FLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTL 232
           L  +++   +   TY         L +    A ++N      ++   +  L G LS    
Sbjct: 210 LKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDS--SLQLKPGQNFLIGVLSKIIS 267

Query: 233 WMMVYPLDVIKSVMQTDNLK 252
             + +PL V K+ +Q  + K
Sbjct: 268 TCLTHPLIVAKASLQRSSSK 287

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-EVIRKLLKNEGPKGFYKGTLTP 85
           ++ L G    I    +  P    K  LQ SS+  T+  EV+  L ++EG    +KG L P
Sbjct: 255 QNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKG-LLP 313

Query: 86  LIGVGACV 93
            +  G  V
Sbjct: 314 QLTKGVIV 321

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 5   FPTPQLIDDLENHPKHDNA---RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPT 60
           + + Q + ++  H   ++A     +++ + G    +   LV QP    K  LQ++ S  T
Sbjct: 199 YASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFT 258

Query: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACV 93
           T  E +  L KNEG K  +KG L P +  G  V
Sbjct: 259 TFQEALLYLYKNEGLKSLWKGVL-PQLTKGVIV 290

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 78/205 (38%), Gaps = 34/205 (16%)

Query: 4   EFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM 63
           E+   Q+I++ + H  + +      L AG  G +   +V  P +  K RLQ         
Sbjct: 133 EWVKRQMINEWQIHETYSH------LAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRH 186

Query: 64  -----------EVIRKLLKNEGPKGF---YKGTLTPLIGVGACVSLQFGVNEAMKR--FF 107
                      + +R +++ EG       YK TL+  +   A   LQF   E  ++  F 
Sbjct: 187 FQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSA---LQFAFYERFRKWAFL 243

Query: 108 HSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ-TGSGPNVEFKGPLD 166
             R P      LS     + G + G     + +P++ V+ R+QTQ  GS       G  D
Sbjct: 244 LERKP--VDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSA------GTPD 295

Query: 167 CIRKLRAQGGFMRGLTPTMLREGHG 191
                R  G   R L   +  EG G
Sbjct: 296 ASAPARLNGSIFRSLLVVLRYEGLG 320

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 88/224 (39%), Gaps = 23/224 (10%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAMEVI---RKLLKNEG-PKGFYKGTLTPLIGVGACVSLQF 97
           V    DT K R Q +        +I   R L   EG  +G Y G    ++G     ++ F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 98  GVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQT---- 153
           G  E +K     R   +  QI     +   G  G + +S +  P E ++ RLQ Q     
Sbjct: 130 GTYEWVK-----RQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNN 184

Query: 154 ---GSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGTYFLVYEAM--VAN 205
               SG N  ++G  D +R + R +G      G   T+ R+       F  YE     A 
Sbjct: 185 RHFQSGYN--YRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAF 242

Query: 206 EINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTD 249
            + +      +      + GA +G    ++  PLDV+K+ +QT 
Sbjct: 243 LLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQ 286

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 62/334 (18%), Positives = 115/334 (34%), Gaps = 72/334 (21%)

Query: 25  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGP-------KG 77
           ++  ++AG+   + Q  +  PF+  K  LQ           + + L N  P       K 
Sbjct: 94  LLAPIVAGSCASVFQTTISYPFEFLKTGLQ-----------LHRSLPNAHPFNMMHQFKY 142

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSF 137
           ++ G     +G       +F   E   +    ++P S S  +S P+  + G   G   S 
Sbjct: 143 YFSGCAALNVGTLFKTVTRFTTFEKACQLL--KDPSSPSAFISGPRLLMAGAITGFMESL 200

Query: 138 LASPIEHVRIRL-------------------QTQTGSG---------------------- 156
              P E+++  +                   + +TGS                       
Sbjct: 201 WVVPFENIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFL 260

Query: 157 -----PNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGF 211
                P   F   +  I   R   GF++G  PT+ R+       F  Y ++    I+   
Sbjct: 261 HYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL-KQLISPNK 319

Query: 212 KRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXX 271
              E  A+ L   G +S   +  +  P+DVIK+ MQ+       Y NS+ + A  ++   
Sbjct: 320 PLNEYYAFVL---GFISSCAVVAVTQPIDVIKTRMQSK-YAWANYKNSL-NCAYRIFVEE 374

Query: 272 XXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
                     P +++   + G +F  ++    L+
Sbjct: 375 GIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLI 408

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 72/186 (38%), Gaps = 24/186 (12%)

Query: 29  LLAGTAGGIAQVLVGQPF--------DTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYK 80
           ++ G  GG+AQ  +   F         T K      + P ++    +++ K +G KG  K
Sbjct: 112 IMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINK 171

Query: 81  GTLTPLIGVGACVSLQFG----VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNS 136
           G     I        +FG    V E ++      NPD   ++ +L +     + GG+  S
Sbjct: 172 GVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPD--DKLTALEKIAASAIGGGL--S 227

Query: 137 FLASPIEHVRIRLQTQT---GSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCG 193
               PIE +R+ +Q++        N+        I +     G  RG+ P +     G G
Sbjct: 228 AWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAPRI-----GLG 282

Query: 194 TYFLVY 199
            +  V+
Sbjct: 283 VWQTVF 288

>Kwal_23.3529
          Length = 395

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 76/197 (38%), Gaps = 23/197 (11%)

Query: 4   EFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--------- 54
           E    +LIDD   +        +  L AG +G +   +V  P +  K RLQ         
Sbjct: 165 ELTKRKLIDDWGVN------ETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPH 218

Query: 55  --TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNP 112
             +        + I  +++ EG +  + G    L       + QF   E  +++  +   
Sbjct: 219 FHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEG 278

Query: 113 DSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLR 172
            + SQ LSL    + G   G     + +P++ ++ R+QTQ  S          D  R +R
Sbjct: 279 KTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTV------ASDSTRLVR 332

Query: 173 AQGGFMRGLTPTMLREG 189
            +   ++GLT     EG
Sbjct: 333 IENSLIKGLTAVYRSEG 349

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 86/224 (38%), Gaps = 25/224 (11%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAMEVI---RKLLKNEG-PKGFYKGTLTPLIGVGACVSLQF 97
           V    DT K R Q +        +I   +K+   EG  +G Y G    ++G     ++ F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 98  GVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ----- 152
           G  E  KR     +    ++ LS   +   GL+G + +S +  P E ++ RLQ Q     
Sbjct: 162 GTYELTKRKL--IDDWGVNETLS---HLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNN 216

Query: 153 --TGSGPNVE-FKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINK 209
               SG N    +  +  I +L        G   T+ R+       F  YE         
Sbjct: 217 PHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTL 276

Query: 210 GFKRTEVPAWKLCLFG-----ALSGTTLWMMVYPLDVIKSVMQT 248
             K    P+  L L       A +G    ++  P+DVIK+ +QT
Sbjct: 277 EGK---TPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQT 317

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 40/110 (36%), Gaps = 16/110 (14%)

Query: 16  NHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV---------- 65
            H   +    I     G+ GG    L+  PFD  K R+Q +      + V          
Sbjct: 235 THNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDS 294

Query: 66  ------IRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
                 +  + K+EG +  Y G L  ++ +    ++     E  K+FF S
Sbjct: 295 RGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 73/212 (34%), Gaps = 27/212 (12%)

Query: 15  ENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-------TSSTPTTAMEVIR 67
           +N P      V   L+ G    I       P +  + RLQ       T  T     +++R
Sbjct: 126 DNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLR 185

Query: 68  KLLKNE----GPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNP--DSTSQILSL 121
           ++ ++E    G +  +KG    L       ++ +G  E  K  F +R+    + S     
Sbjct: 186 EM-RHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHF 244

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGP-------------LDCI 168
              + CG  GG   + L  P +  + R+Q    S   +   G              L+ I
Sbjct: 245 IGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAI 304

Query: 169 RKLRAQGGFMRGLTPTMLREGHGCGTYFLVYE 200
           RK         GL P +++    C      YE
Sbjct: 305 RKSEGIRALYTGLLPRVMKIAPSCAIMISTYE 336

>Scas_645.9
          Length = 391

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 66/193 (34%), Gaps = 26/193 (13%)

Query: 34  AGGIAQVLVGQ---PFDTTKVRLQT---SSTPTTAMEVIRKLLKNE--------GPKGFY 79
            G IA++L      P +  K +LQ+    S  TT+  ++++LLK               +
Sbjct: 191 CGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALF 250

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA 139
           KG    L       ++ +G  E  K         S S +      +I G   G   + + 
Sbjct: 251 KGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVT 310

Query: 140 SPIEHVRIRLQTQ-TGSGPNVEFKGP-----------LDCIRKLRAQGGFMRGLTPTMLR 187
            P +  + R Q    G+      K P           L  I KL   G    GL P M++
Sbjct: 311 HPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVK 370

Query: 188 EGHGCGTYFLVYE 200
               C      YE
Sbjct: 371 IAPSCAIMISSYE 383

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 41/112 (36%), Gaps = 16/112 (14%)

Query: 14  LENHPKHDNARV-IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIR----- 67
           ++    H N    I   + G+  G    LV  PFD  K R Q S        V++     
Sbjct: 280 MDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIE 339

Query: 68  ------KLLKN----EGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHS 109
                 K L+N    EG    Y G +  ++ +    ++     E  KR F++
Sbjct: 340 QTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 104/270 (38%), Gaps = 38/270 (14%)

Query: 63  MEVIRKLLKNEGPKGFYKG-TLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSL 121
           +E   K+ K EG    ++G ++  L+ + A +    G       +    +P +TS     
Sbjct: 133 LEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGY-----EYLRDNSPLATSSPTFN 187

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQT------QTGSGPNVE--FKGPLDCIRKLRA 173
           P   +CG    I  +   +P+E ++ +LQ+       T S   V+   K     +R   A
Sbjct: 188 P--LMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGA 245

Query: 174 QGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLF--GALSGTT 231
                +GL  T+ R+      Y+  YE    +      K      + +  F  G++SGT 
Sbjct: 246 SNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTI 305

Query: 232 LWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKT---------------LYXXXXXXXX 276
             ++ +P DV K+  Q   +     GN+  SV K+               ++        
Sbjct: 306 AALVTHPFDVGKTRWQISFM-----GNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGAL 360

Query: 277 XXXXXPTMLRAAPANGATFATFELAMRLLG 306
                P M++ AP+     +++EL+ RL  
Sbjct: 361 YTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 119 LSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ 152
           L+L Q  +   TG +  S   +P++ VRIRLQ Q
Sbjct: 34  LTLHQRMLSASTGSLLTSLTLTPMDVVRIRLQQQ 67

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 105/279 (37%), Gaps = 31/279 (11%)

Query: 45  PFDTTKVRLQT----SSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVN 100
           PF+  K RLQ     S      + ++ +  + +G    Y G    ++G      ++F   
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 101 EAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA-SPIEHVRIRL-QTQTGSGPN 158
           +A++R             LS P+  + GL  G+  S LA +P E V+  L   +  + P 
Sbjct: 90  DALRRALQDERG-----ALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPR 144

Query: 159 VEFKGP-----LDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKR 213
            +  G         + +     G   GL P  LR+       F  Y      ++ +  +R
Sbjct: 145 YQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCY-----TQLKQAVQR 199

Query: 214 -TEVPA------WKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKT 266
               PA       +  L GALSG        P+D +K+ MQ   L + +YG+++    + 
Sbjct: 200 YAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA--LDAARYGSTVGCF-RA 256

Query: 267 LYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           +              P + R   + G  F  +E  + LL
Sbjct: 257 VVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/134 (19%), Positives = 51/134 (38%), Gaps = 1/134 (0%)

Query: 54  QTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLI-GVGACVSLQFGVNEAMKRFFHSRNP 112
           Q +     A++ ++++   EG  G Y+G  +  + G     S  F      K +F  +  
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQA 126

Query: 113 DSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLR 172
                  S P+  + G+    T+    +PI  V  R QT+  +    + +     +    
Sbjct: 127 RGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAEN 186

Query: 173 AQGGFMRGLTPTML 186
              GF  GL  +++
Sbjct: 187 GWRGFWAGLKVSLV 200

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 69/172 (40%), Gaps = 19/172 (11%)

Query: 29  LLAGTAGGIAQVLVGQPF----DTTKVRLQTSST----PTTAMEVIRKLLKNEGPKGFYK 80
           +L G  GG+ Q  +   F     T ++    S++    P ++  V + + K EG +G  K
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 81  GT----LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNS 136
           G     +  +   G+   L   V + +++     N D   ++    +     L GG+  S
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKD--DKLNPFEKIGASALGGGL--S 229

Query: 137 FLASPIEHVRIRLQTQT---GSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTM 185
               PIE +R+ +Q++        N+        I +     G  RG+TP +
Sbjct: 230 AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRI 281

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 80/195 (41%), Gaps = 24/195 (12%)

Query: 29  LLAGTAGGIAQVLVGQPF----DTTKVRLQTSST-----PTTAMEVIRKLLKNEGPKGFY 79
           ++ G  GG+ Q  +   F     T ++  Q ++      P ++ +V + + K EG +G  
Sbjct: 106 IMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGIN 165

Query: 80  KGT----LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITN 135
           KG     +  +   G+   L   V + +++       D   ++ +L +     + GG+  
Sbjct: 166 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKD--DKLTALEKIMASAIGGGL-- 221

Query: 136 SFLASPIEHVRIRLQTQT---GSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGC 192
           S    PIE +R+ +Q++        N+        I +     G  RG+TP   R G G 
Sbjct: 222 SAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTP---RVGLGI 278

Query: 193 G-TYFLVYEAMVANE 206
             T F+V    +A E
Sbjct: 279 WQTVFMVGFGDMARE 293

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 29/217 (13%)

Query: 45  PFDTTKVRLQTS-------STPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQF 97
           P  T   R+Q S       +   + +E +R++ + EG  GFY G  + + G+ A  SL +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAAN-SLNY 94

Query: 98  G-----VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ 152
                    A  R   SR  +++  ILS        + G +T +  ++PI  V  R+   
Sbjct: 95  YYFYELAARATMRVRGSRRLNTSEAILS------SAVAGSMT-AIASNPIWVVNTRMTVA 147

Query: 153 TGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFK 212
                 +     LD +RK      F  GL P ++   +    Y  V+E +    +     
Sbjct: 148 KSEQSTLAV--LLDIVRKDGVTALF-NGLRPALMLVSNPIIQY-TVFEQLKNVVLKWSGS 203

Query: 213 RTEVPAWKLCL--FGALSGTTLWMMVYPLDVIKSVMQ 247
              +P+W   L   G L+ T      YP   +K+ M 
Sbjct: 204 DVLLPSWAFLLGAVGKLAATG---STYPYITLKTRMH 237

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 110/288 (38%), Gaps = 39/288 (13%)

Query: 47  DTTKVRLQTSSTPTTAMEVI---RKLLKNEG-PKGFYKGTLTPLIGVGACVSLQFGVNEA 102
           DT K R Q + +      +I   R ++  EG  KG Y G    ++G     ++ F   E 
Sbjct: 77  DTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEY 136

Query: 103 MKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ-------TG 154
            KR        + T   L+       G  G   +SF+  P E ++ RLQ Q         
Sbjct: 137 TKRKMIGEWGINETFSHLT------AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFR 190

Query: 155 SGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVYEAM----VANEI 207
           SG N  +K   D +  +  + G+     G   T+ R+    G  F  YE       A E 
Sbjct: 191 SGYN--YKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVE- 247

Query: 208 NKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQT----------DNLKSPKYG 257
           NK F   ++      + GA +G    ++  PLDV+K+ +QT           NLK     
Sbjct: 248 NKTFDE-DLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLT 306

Query: 258 NSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
           NSI+    T+Y             P  +  +  +      +++A++ L
Sbjct: 307 NSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTL 354

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 55/141 (39%), Gaps = 23/141 (16%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQ-----------TSSTPTTAMEVIRKLLKNEG-PK 76
           L AG  G      V  P +  K RLQ           +        + +  +++ EG P 
Sbjct: 154 LTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPT 213

Query: 77  GF--YKGTLT---PLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTG 131
            F  YK TL+   P  G      LQF   E  ++   +    +  + LSL    I G   
Sbjct: 214 LFFGYKATLSRDLPFSG------LQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAA 267

Query: 132 GITNSFLASPIEHVRIRLQTQ 152
           G     + +P++ V+ R+QTQ
Sbjct: 268 GGLAGIITTPLDVVKTRIQTQ 288

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 70/155 (45%), Gaps = 21/155 (13%)

Query: 59  PTTAMEVIRKLLKNEGPKGFYKGTLTPLI-GVGACVSLQFGVNEAMKRFF--HSRNPDST 115
           PT  +    +L +  G + ++KGT+  L+  VG  V ++F     +K+F     +N +  
Sbjct: 178 PTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSV-VRFTTFTMLKQFAPKEYQNNEYF 236

Query: 116 SQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG 175
           + +L L     C + G         P++ ++ R+Q +      + ++  ++C  ++  + 
Sbjct: 237 ATLLGLISS--CAVVGA------TQPLDVIKTRMQAKDSV---LLYRNSINCAYRIFVEE 285

Query: 176 GF---MRGLTPTMLREGHGCGTYFLVY---EAMVA 204
           GF    +G  P +++ G      F +Y   E M+A
Sbjct: 286 GFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIA 320

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 3/75 (4%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVIRKLLKNEGPKGFYKGTLTPL 86
           L G     A V   QP D  K R+Q   +      ++    ++   EG    +KG L  L
Sbjct: 239 LLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRL 298

Query: 87  IGVGACVSLQFGVNE 101
           + VG   S+ FG+ +
Sbjct: 299 MKVGLSGSVSFGIYQ 313

>Kwal_55.21338
          Length = 323

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 98/249 (39%), Gaps = 28/249 (11%)

Query: 15  ENHPKHDNARVIKD---------LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-- 63
           + HPK   + V  D          LAG AGG   + +  P      +LQT       +  
Sbjct: 3   QRHPKSTGSMVAIDPSQADAFAHALAGGAGGAISMTLTYPLIVVTTKLQTQDAKGEKLSL 62

Query: 64  -EVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHSRNPDSTSQILSL 121
            + I+ + + +G  GF+ G  + L G      + +   EA  R    +R+    +Q L+ 
Sbjct: 63  ADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVLRARH----TQRLTT 118

Query: 122 PQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFM 178
            +  + G   G  N+  A+P+     R+  Q         +G L  I  + + +G  G  
Sbjct: 119 AESMLVGSIAGSLNATAANPLWVANTRMTVQKSD------RGTLSTIFDIVKDEGISGLF 172

Query: 179 RGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYP 238
           +GL P ++   +    Y  VYE +    ++    RT  P+W   L GA+         YP
Sbjct: 173 KGLNPALILVINPIIQY-TVYEQLKNWILSSRQTRTLSPSWAFIL-GAVGKLAATGSTYP 230

Query: 239 LDVIKSVMQ 247
              +K+ M 
Sbjct: 231 YVTMKARMH 239

>Scas_705.9
          Length = 323

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 10  LIDDLENHPKHDNAR--VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME-VI 66
           L+  + N  K  + +  V ++ + G    I   ++ QP    KV LQ S++     E V+
Sbjct: 205 LLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVL 264

Query: 67  RKLLKNEGPKGFYKGT 82
           R L K EG    +KG 
Sbjct: 265 RYLYKEEGVLALWKGV 280

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 225 GALSGTTLWMMVYPLDVIKSVMQTD 249
           GA++ T   ++VYPLDV K+V+Q++
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSE 34

>Scas_687.15*
          Length = 328

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 3/81 (3%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           G     A V + QP D  K R+Q+ +       ++    ++   EG    +KG L  L  
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

Query: 89  VGACVSLQFGVNEAMKRFFHS 109
           VG    + FGV + ++   H+
Sbjct: 300 VGLSGGISFGVYQYVENLSHT 320

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 53/133 (39%), Gaps = 6/133 (4%)

Query: 172 RAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTT 231
           R   GF +G  PT+ R+       F  Y  +    I+      EV A+ + LF   S   
Sbjct: 191 RGLRGFAQGAMPTVFRQVSNSTVRFTAYTTL-KQLISPTQPLNEVYAFGIGLF---SSCA 246

Query: 232 LWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYXXXXXXXXXXXXXPTMLRAAPAN 291
           +  +  P+DV+K+ MQ+       Y NS+ + A  ++             P + +   + 
Sbjct: 247 VVALTQPIDVVKTRMQSKTAHY-FYKNSL-NCAYRVFVEEGMVSLWKGWLPRLFKVGLSG 304

Query: 292 GATFATFELAMRL 304
           G +F  ++    L
Sbjct: 305 GISFGVYQYVENL 317

>Kwal_23.5757
          Length = 307

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 22/173 (12%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGF---YKGTLTPL----IGVGACVSLQF 97
           P++  KVR QT+  P  A  V     K  G +GF   YKG +TPL    I    C   +F
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-ITPLWFRQIPYTMC---KF 191

Query: 98  GVNEAMKRFFHSRNPDSTSQILSLPQYYIC---GLTGGITNSFLASPIEHVRIRLQTQTG 154
              E +    ++R P    ++  L Q  +    G   GI  + ++ P + +  ++  +  
Sbjct: 192 TSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251

Query: 155 SGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVYEAMVA 204
           SG +      L    ++  + GF     GL   +L  G      +L+Y++  A
Sbjct: 252 SGEST-----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 41  LVGQPFDT--TKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFG 98
           +V QP DT  +KV     +   + + ++ +L K  G  G + G  T L+ VG   SLQFG
Sbjct: 226 VVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFG 285

Query: 99  VNEAMKR 105
           +   +K+
Sbjct: 286 IYGTLKK 292

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 71/190 (37%), Gaps = 14/190 (7%)

Query: 18  PKHDNARVIKDLLAGTAG-GIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--IRKLLKNEG 74
           P++  +   K  LAG  G GI    +  P D  K R+Q   T      V   ++++ +EG
Sbjct: 6   PEYTVSDYAKFALAGAIGCGITHSSM-VPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEG 64

Query: 75  PKGFYKGTLTPLIGVGACVSLQFGVNEAMKRF----FHSRNPDSTSQILSLPQYYICGLT 130
                 G    L+G     S +FG  E  K+         N  +    + +    I    
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFF 124

Query: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190
             I       P+E  RIRL +Q  +  N  F G    I K    G F  G TP + ++  
Sbjct: 125 ADIA----LCPLEATRIRLVSQP-TFANGLFGG-FSRILKEEGVGSFYNGFTPILFKQIP 178

Query: 191 GCGTYFLVYE 200
                F V+E
Sbjct: 179 YNIAKFFVFE 188

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT---TAMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           G     A V + QP D  K R+Q+  T +    ++  + +    EG    +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 89  VGACVSLQFGV 99
           VG    + FGV
Sbjct: 313 VGLSGGVSFGV 323

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 66/342 (19%), Positives = 121/342 (35%), Gaps = 73/342 (21%)

Query: 22  NARVIKDLLAGTAGGIAQVLVGQPFDTTKV--RLQTSSTPTTAMEVIRKLLKNEGPKGFY 79
           N  +  +LLAG+A  + Q  +  PF+  K   +L  S     A  +   +      K ++
Sbjct: 5   NPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAFNMFHHV------KSYF 58

Query: 80  KGTLTPLIGVGACVSLQFGV-NEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFL 138
            G     IG+    + +F   ++A +      NP++    L L      G   G   S L
Sbjct: 59  AGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRL---IAAGSITGFMESML 115

Query: 139 ASPIEHVRIRL-------------QTQTG--------SGPNVEFKGPL------------ 165
             P E+++ R+             + +TG        S  N+E K  +            
Sbjct: 116 IIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVKKEI 175

Query: 166 -------------------DCIRKLRAQGG---FMRGLTPTMLREGHGCGTYFLVYEAMV 203
                                +R++    G   F +G  PT+ R+       F  Y  + 
Sbjct: 176 NPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTL- 234

Query: 204 ANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSV 263
              I+     +E  A+ +   G  S   +  +  P+DV+K+ MQ+    S  Y NS++ V
Sbjct: 235 KQMISPNKPLSEYYAFGI---GVFSSCAVVALTQPIDVVKTRMQSKYTWS-LYRNSLNCV 290

Query: 264 AKTLYXXXXXXXXXXXXXPTMLRAAPANGATFATFELAMRLL 305
            +T +             P + +   + G +F  ++    L+
Sbjct: 291 YRT-FIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLM 331

>Kwal_55.21106
          Length = 328

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 225 GALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGN 258
           GA++ +   ++VYPLD++K+++QT N K P  G+
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQN-KEPNIGS 42

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 75/187 (40%), Gaps = 21/187 (11%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPLIG 88
           L+ G  GG+   +  QP D  K R+Q     T    + + L + + P   ++GTL   + 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----LWKNLKEIDSPLQLWRGTLPSALR 69

Query: 89  VGACVSLQFGVNEAMKRFFHSRN---PDST--SQIL-----SLPQY--YICGLTGGITN- 135
                +L       M+     R    P  T  S I+     SLP+   Y   LTG     
Sbjct: 70  TSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARG 129

Query: 136 --SFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCG 193
              ++  PI  +++R ++   +  ++  K  +  I       GF RG   T LR+    G
Sbjct: 130 LVGYITMPITVIKVRYESTLYNYSSL--KEAITHIYTKEGLFGFFRGFGATCLRDAPYAG 187

Query: 194 TYFLVYE 200
            Y L+YE
Sbjct: 188 LYVLLYE 194

>Scas_696.9
          Length = 312

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 47  DTTKVRLQTSSTPT-TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFG----VNE 101
           + T+++  ++  P  ++  V R +   EG +G YKG     I        +FG    V +
Sbjct: 137 EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVED 196

Query: 102 AMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQT---GSGPN 158
            +++      P+   ++ +  +     + GG+  S    PIE +R+ +Q++        N
Sbjct: 197 WVRKATGKTKPE--DRLNAWEKIGATAVGGGL--SAWNQPIEVIRVEMQSKKEDPNRPKN 252

Query: 159 VEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCG-TYFLV 198
           +        I K     G  RG+TP   R G G   T F+V
Sbjct: 253 LTVAKTFKYIMKTNGVKGLYRGVTP---RIGLGIWQTVFMV 290

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 66/163 (40%), Gaps = 24/163 (14%)

Query: 127 CGLTGGITNSFLAS---PIEHVRIRLQTQ---TGSGPNVE---FKGPLDCIRKLRAQGGF 177
              TG + +S  A+   P++  +  +QTQ     SG + E   +K  +DCI K+  + GF
Sbjct: 6   SAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 178 M---RGLTPTMLREGHGCGTYFLVYEAMVAN---------EINKGFKRTEVPAWKLCLFG 225
           +   +GL   +         YF  Y  + +N         ++    K  E+   +    G
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALG 125

Query: 226 ALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLY 268
             +G    ++  P+ VI +  Q   L       S+ +V K +Y
Sbjct: 126 MSAGAMTQVVTNPISVISTRQQ---LTKDGEDASLKAVIKQIY 165

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTP 85
           ++ L G    +    V QP    K+ LQ   S   T  EV++ + +NEG    +KG + P
Sbjct: 223 ENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVI-P 281

Query: 86  LIGVGACV 93
            +  G  V
Sbjct: 282 QVSKGVIV 289

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 114 STSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQ 152
           +TS  L+L +  +    G +  S + +P++ VRIRLQ Q
Sbjct: 5   NTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQ 43

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 82/217 (37%), Gaps = 32/217 (14%)

Query: 63  MEVIRKLLKNEGPKGFYKG-TLTPLIGVGACVSLQFGVNEAMKR-----FFHSRNPDSTS 116
           +E   K+ K EG    ++G ++T L+ + A V    G      R      + + NP    
Sbjct: 114 LEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLYPTINP---- 169

Query: 117 QILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGS----GPNVEFKGPLDCIRKLR 172
                    ICG       +   +P+E ++ +LQ+   S    G  + ++   + I+   
Sbjct: 170 --------LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEI 221

Query: 173 AQGG----FMRGLTPTMLREGHGCGTYFLVYE---AMVANEINKGFKRTEVPAWKLC--- 222
           A  G      +GL  T+ R+      Y+  YE     VA      F +     +      
Sbjct: 222 AMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSF 281

Query: 223 LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259
           L G +SG+   +  +P DV K+  Q   +   K  NS
Sbjct: 282 LGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANS 318

>AFR352C [3544] [Homologous to ScYJR045C (SSC1) - SH; ScYEL030W
           (ECM10) - SH] (1073990..1075918) [1929 bp, 642 aa]
          Length = 642

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 33/68 (48%)

Query: 7   TPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVI 66
           T + ++D E+      A+ +KD +A      A+ L G+  +   ++ +T    + ++++ 
Sbjct: 565 TEKAVNDFEDKVDKAEAQKVKDQIAALKELTARALSGEEVNADDLKAKTDELQSASLKLF 624

Query: 67  RKLLKNEG 74
            KL K  G
Sbjct: 625 EKLHKESG 632

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 9/138 (6%)

Query: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGT 194
           L  P+  +  +LQTQ G+  N + K  L+ I+++ R  G  GF  GL   +         
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 195 YFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSP 254
           Y+  YE + +  + K  K  ++   +  L G ++G+   +   P+ V  + M     +  
Sbjct: 89  YYYFYE-LTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEKT 147

Query: 255 KYGNSISSV----AKTLY 268
                I  V    AKTL+
Sbjct: 148 ALATIIEIVKKDSAKTLF 165

>Sklu_2409.5 YBR296C, Contig c2409 19658-21397
          Length = 579

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 12/94 (12%)

Query: 178 MRGLTPTMLREGHGC-------GTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGT 230
           ++ +T   +   HG        G    VY+    N++     ++EVP W L   GA    
Sbjct: 411 LQAITAATMSFAHGANDVANATGPLAAVYDIWRTNDVTS---KSEVPVWVLAYGGAALVI 467

Query: 231 TLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVA 264
             W   Y  ++IK++     L+SP  G SI   A
Sbjct: 468 GCWTFGY--NIIKNLGNKMILQSPSRGFSIELAA 499

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,337,864
Number of extensions: 365884
Number of successful extensions: 1921
Number of sequences better than 10.0: 208
Number of HSP's gapped: 1228
Number of HSP's successfully gapped: 411
Length of query: 306
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 205
Effective length of database: 13,099,691
Effective search space: 2685436655
Effective search space used: 2685436655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)